http://www.podcastforhire.comenBusinessCopyright Produced by Podcast For Hirehttps://d3wo5wojvuv7l.cloudfront.net/t_rss_itunes_square_1400/images.spreaker.com/original/64e10fb8c53c3cb2adc2c1dbeeb64d18.jpghttp://www.podcastforhire.comSun, 24 May 2026 15:12:49 +0000Produced by Podcast For HireProduced by Podcast For Hirebswithbob@gmail.comPodcastforhire.com helps businesses gain new customers with micro-podcasts geared toward their clientele. Microcasts are 3-5 minute podcasts and are a powerful way to build authority—listeners can hear your voice, your passion, and your expertise.trueepisodichttps://www.spreaker.com/episode/ferryville-wisconsin-unexpected-power-of-community--72141722
Community
Small Town
Reinke Brothers
Hunting and Fishing
Historic Preservation
Personal Growth]]>https://api.spreaker.com/episode/72141722Sun, 24 May 2026 15:12:12 +0000Produced by Podcast For HireThe episode explores the transformative journey of moving to a small town, highlighting the sense of community and personal growth experienced by Andy Novak. It delves into the history of the Reinke Brothers tackle shop, the challenges and joys of...
Community
Small Town
Reinke Brothers
Hunting and Fishing
Historic Preservation
Personal Growth]]>807brothers,brothers hunting,community small,ferryville,fins,fishing,fishing historic,growth,history,hunting,preservation personal,reinke,small,town,wisconsinfalsefullhttps://www.spreaker.com/episode/ferryville-wisconsin-a-lifetime-of-river-farming-and-community--70239600

• Local history and community stories
• Impact of law changes on small towns
• River life and fishing industry in Ferryville
• "I was born and raised on a farm near Ferryville"
• "Counted 160 deer behind the post office daily"

]]>https://api.spreaker.com/episode/70239600Mon, 23 Feb 2026 21:34:29 +0000Produced by Podcast For HireIn this engaging interview, Thurman shares a lifetime of stories from Ferryville, covering local history, fishing, farming, and community life. Discover how small-town traditions, river life, and changing laws shaped this unique Wisconsin town. -...

• Local history and community stories
• Impact of law changes on small towns
• River life and fishing industry in Ferryville
• "I was born and raised on a farm near Ferryville"
• "Counted 160 deer behind the post office daily"

]]>705changes,community,farming,ferryville,fishing,history,law,life,local,river,small-town,stories key,topics,wisconsinfalsefullhttps://www.spreaker.com/episode/tri-states-home-inspection--58687294https://api.spreaker.com/episode/58687294Wed, 14 Feb 2024 17:47:01 +0000Produced by Podcast For HireLeRoy is a Certified Master Inspector serving the Tri-State Area serving all of the Tri State area, he will give you information about home inspections and why choosing the right home inspector is so important. Which inturn will help you with the most...267building,buying,checking,electric,holm,home,homeowner,house,inspection,leroy,power,problems,realestate,structure,tristate,tristatehomeinspectionfalsefullhttps://www.spreaker.com/episode/ferryville-wisconsin-pool-9-lock-and-dam--58063895
For more information on Ferryville, Wisconsin, please visit our website www.VisitFerryville.com]]>https://api.spreaker.com/episode/58063895Tue, 19 Dec 2023 21:00:40 +0000Produced by Podcast For HireFerryville is a little village with a population of 192 in Southwestern Wisconsin. It is located on National Scenic State Highway 35 between Prairie du Chien and LaCrosse Wisconsin. Ferryville is at rivers edge and is an excellent area for hunting,...
For more information on Ferryville, Wisconsin, please visit our website www.VisitFerryville.com]]>444business,commercial,commercial-fishing,eagle,ferryville,ferryville-wisconsin,fishing,great,great-river-road,lock-and-dam,mississippi,mississippi-river,people,podcast,podcastforhire,pool9,river,road,scenic,wisconsinfalsefullhttps://www.spreaker.com/episode/multiple-ventures-llc-who-we-are-podcast--56844030
We offer a wide variety of air duct cleaning services for both residential and commercial customers in Crawford & Grant County, Wisconsin, and the surrounding areas. You can count on our team at Multiple Ventures Duct Cleaning, LLC to not only provide you with exceptional service, but the best in class air duct cleaning in the area. Our air duct cleaning team is committed to adhere to both local regulatory and industry standards when it comes to servicing our customers.

GET A FREE QUOTE TODAY - CALL US 608-306-2541
]]>https://api.spreaker.com/episode/56844030Mon, 18 Sep 2023 17:02:18 +0000Produced by Podcast For HireTop Rated Air Duct Cleaning Service in Crawford & Grant County, Wisconsin We offer a wide variety of air duct cleaning services for both residential and commercial customers in Crawford & Grant County, Wisconsin, and the surrounding areas....
We offer a wide variety of air duct cleaning services for both residential and commercial customers in Crawford & Grant County, Wisconsin, and the surrounding areas. You can count on our team at Multiple Ventures Duct Cleaning, LLC to not only provide you with exceptional service, but the best in class air duct cleaning in the area. Our air duct cleaning team is committed to adhere to both local regulatory and industry standards when it comes to servicing our customers.

GET A FREE QUOTE TODAY - CALL US 608-306-2541
]]>226clean,cleaning,darrel,darrell,dryer,ducts,multiple,pdc,podcastforhire,vents,ventures,wiestfalsefullhttps://www.spreaker.com/episode/ferryville-wisconsin-commercial-fishing--52719836
For more information on Ferryville, Wisconsin, please visit our website www.VisitFerryville.com

Transcription for SEO purposes only

Ferryville, Wisconsin. The people, the location, the place for all seasons. Jerry Bordman and I'm a commercial fisherman. Jerry, how long have you been a commercial fisherman? Well, at 80 years old and all my life. Is commercial fishing something you can do year round? Yes. How long have you been calling this area of the Mississippi River your home? All my life. I was born born here on the river. Matter of fact, my brother, my oldest brother, my folks used to live on the islands and he was born on the refuge before locking dams. And he's still alive? I think he's probably one of the last few people. He's 88, basically. This is something you've done your entire life? Yes. So what is commercial fishing on the Mississippi River? Like the type of fishing we do, we sane, we call sandy and then deal netting, tram netting, hoop netting, hoop nets and fox traps. Many various different types of fishing and all various different skills. The fishing nowadays is very easy. It's a lot of manual labor, but it's still easy. What it used to be, I can remember when, like back in the late forties and early 50s, there wasn't hardly any boat landings on the river. And so when we were standing underneath the ice, these fish had to be hand slated to the banks, to the railroad tracks and carried up over the railroad tracks and then carried up over the road bank. Now that was work that I want to tell you. So gradually the boat landings opened up where you could get to the landings and transport your fish. In 1947, the dyke going to Lansing, when the ice went out that spring, they went out thick and it took every one of the bridges out. Therefore you couldn't get the fish to Lansing because that's what the main market was. You had to go by a boat and hope you have enough ice to get in there in the wintertime. My oldest brother. And my dad stood at the Windowski bridge there and they watched that ice take that bridge out and they just went to Lansing and come back for that about a half an hour before that. Wow. That was how long did it take to fix that bridge? 1956. Ten years? Yep. Put in ten years. Wow. Like I said, that was the biggest market around. We had a lot of markets around, small markets. Quite a few of the one in furnishing and one in the big halls. The big bunches always went to landscape. So, Jerry, is commercial ice fishing your big time for fishing, or is it during the summer as well? No, we used to fish year round, but now the markets have gone and the only fishing that we do now is we fish under the ice. In the spring, when the ice goes out, we sell all our fish to New York live. We shift them all live to New York. They go out and semis tanks on with liquid oxygen and we put £20,000 of fish on a truck. And also in the springtime, when the water opens up in, we have what they call a Jewish holidays. At that time, we go for the big carp. For the holidays, they want the big Carp, anything £12 and up, and then after that usually done from the summer. So besides the carp, what other kind of fish are you fishing for? Buffalo carpent. Buffalo, primarily because catfish, we catch a lot of catfish in the scene, but in the state of Wisconsin, if you're sanding underneath the ice, you can only keep £100 of fish per haul. So you'd mentioned that you sell all of your fish to the state of New York. Why is the market in New York rather than anywhere closer to here? Because that's where the population is, and especially a Jewish population. And the Jewish population is not as big as Myers. Like a filter fish. There was millions and millions of pounds of carp crawd in, you know, the year turner all made into filter fish. As the years progressed, I guess what is that?]]>https://api.spreaker.com/episode/52719836Mon, 13 Feb 2023 19:24:35 +0000Produced by Podcast For HireFerryville is a little village with a population of 192 in Southwestern Wisconsin. It is located on National Scenic State Highway 35 between Prairie du Chien and LaCrosse Wisconsin. Ferryville is at rivers edge and is an excellent area for hunting,...
For more information on Ferryville, Wisconsin, please visit our website www.VisitFerryville.com

Transcription for SEO purposes only

Ferryville, Wisconsin. The people, the location, the place for all seasons. Jerry Bordman and I'm a commercial fisherman. Jerry, how long have you been a commercial fisherman? Well, at 80 years old and all my life. Is commercial fishing something you can do year round? Yes. How long have you been calling this area of the Mississippi River your home? All my life. I was born born here on the river. Matter of fact, my brother, my oldest brother, my folks used to live on the islands and he was born on the refuge before locking dams. And he's still alive? I think he's probably one of the last few people. He's 88, basically. This is something you've done your entire life? Yes. So what is commercial fishing on the Mississippi River? Like the type of fishing we do, we sane, we call sandy and then deal netting, tram netting, hoop netting, hoop nets and fox traps. Many various different types of fishing and all various different skills. The fishing nowadays is very easy. It's a lot of manual labor, but it's still easy. What it used to be, I can remember when, like back in the late forties and early 50s, there wasn't hardly any boat landings on the river. And so when we were standing underneath the ice, these fish had to be hand slated to the banks, to the railroad tracks and carried up over the railroad tracks and then carried up over the road bank. Now that was work that I want to tell you. So gradually the boat landings opened up where you could get to the landings and transport your fish. In 1947, the dyke going to Lansing, when the ice went out that spring, they went out thick and it took every one of the bridges out. Therefore you couldn't get the fish to Lansing because that's what the main market was. You had to go by a boat and hope you have enough ice to get in there in the wintertime. My oldest brother. And my dad stood at the Windowski bridge there and they watched that ice take that bridge out and they just went to Lansing and come back for that about a half an hour before that. Wow. That was how long did it take to fix that bridge? 1956. Ten years? Yep. Put in ten years. Wow. Like I said, that was the biggest market around. We had a lot of markets around, small markets. Quite a few of the one in furnishing and one in the big halls. The big bunches always went to landscape. So, Jerry, is commercial ice fishing your big time for fishing, or is it during the summer as well? No, we used to fish year round, but now the markets have gone and the only fishing that we do now is we fish under the ice. In the spring, when the ice goes out, we sell all our fish to New York live. We shift them all live to New York. They go out and semis tanks on with liquid oxygen and we put £20,000 of fish on a truck. And also in the springtime, when the water opens up in, we have what they call a Jewish holidays. At that time, we go for the big carp. For the holidays, they want the big Carp, anything £12 and up, and then after that usually done from the summer. So besides the carp, what other kind of fish are you fishing for? Buffalo carpent. Buffalo, primarily because catfish, we catch a lot of catfish in the scene, but in the state of Wisconsin, if you're sanding underneath the ice, you can only keep £100 of fish per haul. So you'd mentioned that you sell all of your fish to the...]]>475boardman,business,commercial,commercial-fishing,eagle,ferryville,ferryville-wisconsin,fishing,great,great-river-road,mississippi,mississippi-river,people,podcast,podcastforhire,river,road,scenic,village,wisconsinfalsefullhttps://www.spreaker.com/episode/jeffs-tractors-june-2022-podcast--5004265312011 Hwy 61
Fennimore, WI 53809
608-988-6182

Jeff's Tractors https://www.jeffstractorsllc.com/
Tractor House https://www.tractorhouse.com/dealer-directory/jeffs-tractors/listings/farm-equipment/for-sale/list?PCID=2939125&SCF=True
https://www.jeffstractorsllc.com/bidcaller.htm
Consignment Sale
June 15, 2022
Time 8:00 a.m.
Fall Tractor & Machinery Consignment Sale]]>https://api.spreaker.com/episode/50042653Thu, 02 Jun 2022 19:49:19 +0000Produced by Podcast For HireJeff's Tractors, LLC 12011 Hwy 61 Fennimore, WI 53809 608-988-6182 Jeff's Tractors https://www.jeffstractorsllc.com/ Tractor House...12011 Hwy 61
Fennimore, WI 53809
608-988-6182

Jeff's Tractors https://www.jeffstractorsllc.com/
Tractor House https://www.tractorhouse.com/dealer-directory/jeffs-tractors/listings/farm-equipment/for-sale/list?PCID=2939125&SCF=True
https://www.jeffstractorsllc.com/bidcaller.htm
Consignment Sale
June 15, 2022
Time 8:00 a.m.
Fall Tractor & Machinery Consignment Sale]]>507atv,auction,boat,buy,consignment,deere,equiptment,farm,jeffs,john,large,lawn,machinery,mowers,sell,skidsteers,tractor,tractors,trade,utvfalsefullhttps://www.spreaker.com/episode/ferryville-wisconsin-growing-up-and-running-business--46709119
For more information on Ferryville, Wisconsin, please visit our website www.Ferryville.com

Transcription is for seo purposes only.

Deb Lomas is the owner of scenic River in in Ferryville Wisconsin and you’re lifelong resident of Ferryville tell you what your first memory of Ferryville and now the end that I ran my parents were owners of the Ferryville see which not only the people depot they lived right across the street so I grandpa line the river my life when we were dating on the river when I let all waterskiing baking the normal thing to do while growing up a lot. I never realized until I got older, how beautiful the area live and how good it was to live along the river never appreciated it because at the time I would let all all you can think about is going bigger and better places and away from home and away from your parents. I did do that for a year when I went to college I always came back proceeded to build my own house here in town and make my daily care when I can cast away, I decided to keep their how to turn it into the vacation rental. When I asked my renters what they come to the area for a lot of my fisherman and hunter site see the high just to get away for the weekend, it seems like everybody comes to the area. Everybody wants to come during the weekend in the summer. I have that book and I get multiple calls for the same weekend people looking for places to say, a lot of everything booked because everybody wants to come here and I realize now as I get older. How beautiful it really is along the river and the sunset and just the beauty of it and now I know why people come here senses here are amazing. So what are some of the things you tell your guests that they should check out when they're in the Ferryville area. I always got in the ring thing I tell him to go over there and look at the quaint little door. I send them to the local union for burgers is a prime rib on Saturday nights are to the wooden nickel just for a quaint little marker drinker dear my send them to Prairie if they like to gamble and go on the boat broke one of the staff just on the local area thing hiking over and not have more if they want to be chasing them to plant clock if they want to golf I send him to Brooklyn or Prairie orchards are a big hit. They like to go over to the orchards which are close by double so the gist of extreme you going up here and raise your kids here between then and now, when I grew up here, there was a lot of kids in town so there is always something to do and something to hang out and even when my kids were young, there was still several families and and kids their age and how and people for them to play with but now it's becoming more touristy and not many families come here will hear that a lot of weekenders and vacation are, it seems to be really up-and-coming for a vacation place and a place to visit with me to stay here. I just I love being a lot better. I own property in La Crosse, but I can't even imagine looking out at traffic when I can look at that in the river. I just can't even imagine my delight, Ferryville coming down the river from across the prairie variable is one of the most beautiful places you can drive through the road passes right to the heart of the town and it's right on the river. It's the only way that you drive right to the heart of the town and can see the river. The whole time. You mention the river quite a bit in your answers. What is this also the river to I grew up along the river. I can't even imagine not living by water as I like to live in my jet ski boat fish camp on the sandbar. I can't imagine not living by the river being a bit erratic and it doesn't really draw people tell me about the people that live in for most of my neighbors nowadays are people that came from the city and had bought properties around me and have picked them up in their permanent residence. Now the house behind me just got sold but for the most part the Norton account is a pretty stable crowd of people that actually live here and then as you had felt the town more than a vacation rental not as many resident properties and upright Eagle Mountain, which is also part of the village. There's quite a few permanent residents up there along with. I think a lot of weekenders, summer residents is a big crowd]]>https://api.spreaker.com/episode/46709119Mon, 27 Sep 2021 15:17:25 +0000Produced by Podcast For HireFerryville is a little village with a population of 192 in Southwestern Wisconsin. It is located on National Scenic State Highway 35 between Prairie du Chien and LaCrosse Wisconsin. Ferryville is at rivers edge and is an excellent area for hunting,...
For more information on Ferryville, Wisconsin, please visit our website www.Ferryville.com

Transcription is for seo purposes only.

Deb Lomas is the owner of scenic River in in Ferryville Wisconsin and you’re lifelong resident of Ferryville tell you what your first memory of Ferryville and now the end that I ran my parents were owners of the Ferryville see which not only the people depot they lived right across the street so I grandpa line the river my life when we were dating on the river when I let all waterskiing baking the normal thing to do while growing up a lot. I never realized until I got older, how beautiful the area live and how good it was to live along the river never appreciated it because at the time I would let all all you can think about is going bigger and better places and away from home and away from your parents. I did do that for a year when I went to college I always came back proceeded to build my own house here in town and make my daily care when I can cast away, I decided to keep their how to turn it into the vacation rental. When I asked my renters what they come to the area for a lot of my fisherman and hunter site see the high just to get away for the weekend, it seems like everybody comes to the area. Everybody wants to come during the weekend in the summer. I have that book and I get multiple calls for the same weekend people looking for places to say, a lot of everything booked because everybody wants to come here and I realize now as I get older. How beautiful it really is along the river and the sunset and just the beauty of it and now I know why people come here senses here are amazing. So what are some of the things you tell your guests that they should check out when they're in the Ferryville area. I always got in the ring thing I tell him to go over there and look at the quaint little door. I send them to the local union for burgers is a prime rib on Saturday nights are to the wooden nickel just for a quaint little marker drinker dear my send them to Prairie if they like to gamble and go on the boat broke one of the staff just on the local area thing hiking over and not have more if they want to be chasing them to plant clock if they want to golf I send him to Brooklyn or Prairie orchards are a big hit. They like to go over to the orchards which are close by double so the gist of extreme you going up here and raise your kids here between then and now, when I grew up here, there was a lot of kids in town so there is always something to do and something to hang out and even when my kids were young, there was still several families and and kids their age and how and people for them to play with but now it's becoming more touristy and not many families come here will hear that a lot of weekenders and vacation are, it seems to be really up-and-coming for a vacation place and a place to visit with me to stay here. I just I love being a lot better. I own property in La Crosse, but I can't even imagine looking out at traffic when I can look at that in the river. I just can't even imagine my delight, Ferryville coming down the river from across the prairie variable is one of the most beautiful places you can drive through the road passes right to the heart of the town and it's right on the river. It's the only way that you drive right to the heart of the town and can see the river. The whole time. You...]]>276business,deb,deb-lomas,ferryville,ferryville-wisconsin,great,great-river-road,inn,lomas,mississippi,mississippi-river,people,podcast,podcastforhire,river,road,scenic,scenic-river-inn,village,wisconsinfalsefullhttps://www.spreaker.com/episode/ferryville-wisconsin-heritage-and-history--46618503
For more information on Ferryville, Wisconsin, please visit our website www.Ferryville.com

Transcription is for seo purposes only.

Larry Quamme is my guest on the Ferryville podcast. I don't worry I'm doing fine why you're calling me by my nickname. My nickname is Larry as opposed to what lower it's Jacob Quamme month. That's how my grandmother Clara Quamme me gave me the name popular in Norway. Jacob is pronounced Jacob Quamme. Me and Norm. Norway is, so did you ever spent any time in Norway. Our two sons gave us a trip to Norway. On our 40th wedding anniversary and we spent two weeks we went to the home farm and the cemeteries are full of headstones that say lower its living in Ferryville now where there's a large Norwegian population. Is there any similarities between Norway and here all once I got to Norway I knew why they came here if you put your back to the Mississippi River and you look up the coulees you're in layer doll Norway where my relatives came from. Really they didn't know how to farm except on a side hill so very very similar terrain in that area. What brought you to ferret my wife and I in 1999 went out for a drive. One day she's from Richland Center came down Highway C and we happened to turn on white Road and we went up the farm road up to the top and we were in Eagle Mountain and we came out on this big beautiful area. Lots of vacant land, and we were very attracted to that because I used to come to Ferryville with my grandpa and we ended up buying 15 acres in 1999 was a good move. Larry oh, definitely. We love it here. Let's talk about the Norwegian immigrants that are in the area. My great grandfather, whose name was Jacob Larson Quamme me and his brother Hawken came from Norway in 1870 and they came via what today would be the St. Lawrence Seaway there was a railroad that ran a little ways out of Québec and then from there, the two brothers walked to Mount Sterling, what's Mount Sterling today. All they had is what they could carry my great grandfather was 24 years old and he had just graduated from a Norwegian seminary, and he was a Norwegian Lutheran minister and he promptly settled, and founded Utica Lutheran Church upon Highway 27. When you think about it, Bob. The Civil War was just ending in 1865 and they were coming to America. Some people settle maybe they didn't even know about the Civil War I found some things that would suggest that there was a can be a way of communicating with the ancestors in Norway with a letter and it took about a month to go each way. When they left Norway they went to Liverpool, England, and then brought wooden ship from Liverpool and then came down the Seaway we have no records on Ellis Island. We were immigrants that came into the United States across the border. So he told people you know in Madison that you're moving to Ferryville full time. How did you explain the area that you're moving to the next thing is that I later learned on my the sister 10 years older than I am. She's 88, she had more recall about things around here and we learned that our grandpa had actually rented some land above Ferryville that is today, Eagle Mountain, so I would tell people I moved back to the homeland. When you explain to them where the homeland was which footage of them like this is going for Madison where there's, you know, the hustle and bustle and people all over the place to know hundred 76 people and we see an occasional car drive by now and how did you explain it to them that you're going to go to the promise that go to the homeland going to the homeland. Most people had no idea when you said Ferryville. They did didn't get it. So I started talking about moving to the West Coast of Wisconsin. It became where were halfway between Prairie and lacrosse. Most people knew where that was. Most people looked at you quizzically and said are you okay was a good move for you. Great move. We've enjoyed it. We've enjoyed life. My wife got very involved in many volunteer activities. I ended up being the clerk Treas. for the file chair for a number of years. We've enjoyed it. We love the move. So tell me what the history of Pharaoh. Well, you know, it was a humble Bush you know it one time. Why did the change man from humble Bush to ferret out. I think it had to do with the people at ran a fairy so I'm not certain why it became Ferryville. You know I started coming down here in 1947, 48, my grandpa, kinda like to make the rounds and have a beer or two. My grandmother was very Lutheran and deftly against drinking, but we use to leave and and stop first at the rising sun. He go in the grocery store get me a bottle of grape soda and I'd have to sit outside and then we would go to Fargo Junction and we would make our way back down to Ferryville bustling town. I used to sit near the swing in can't remember what the name was then and watch them load the cattle and hogs on to the railroad and there was a big lumberyard right there and the depot with the big water tower and then shoveling the coal. There's a picture that a lot of people have of the Prince and Princess of Norway visiting Ferryville in 1935. My grandparents Larson Clara were were on the dock there that morning. Ferryville was a real area of commerce up in the north and the trees were growing in they had kinda made a tunnel where you kinda went through a shade and then a course where the Grandview motel. You went over that knoll and grandpa used to drive fast and we thought we were flying through the air. On the other side did Ferryville become a drive through town rather than a destination will I think probably maybe in the slight 60s 70s. The stockyards closed. I believe the lumberyard may have burned and I can't remember early 60s when the train derailed and that took the depot and the entirely at know it ruined you know the depot area where was it just south of the post office which was the bank was at the first place. The plumbing and, for I have heard that yes we used to go and see my my grandmother was a friend of Elvira Smith and that's the White House and we used to go there and in those days you would step up a step to go into the house and then when they have redone 35 today you could sit in that house and look underneath the trucks going by. That's how much the road is been raise. I don't remember the years there's been a couple times at 35, was redone they ran across Dino down by the village hall because the train used to wrap around there. Go down with Pine Street. Today, Ferryville, Wisconsin, being the place for all seasons, but your favorite season. Well I like fall. I'm not a hot summer guy. I love it when the leaves are coming off I given up hunting some years ago I was never much of a Fisher but I like the scenes and I love the you know the hills and mountains's. There are challenges you know where we live because we have 600 foot to keep Wells the nature of it. The Norwegian heritage. It's kind of my little area of the world. I would say that it's a different kind of life to relaxed. If you're interested in. No stoplights and relaxed enforcement of stop signs and it's a great it's a great place to to live in great friends, very, very, you know people that are very interested in being social. Hiking is becoming a really big thing in a course if they were from Stoughton, I'd say you don't come back to one of the epi centers where the Norwegians came to.]]>https://api.spreaker.com/episode/46618503Tue, 21 Sep 2021 14:07:14 +0000Produced by Podcast For HireFerryville is a little village with a population of 192 in Southwestern Wisconsin. It is located on National Scenic State Highway 35 between Prairie du Chien and LaCrosse Wisconsin. Ferryville is at rivers edge and is an excellent area for hunting,...
For more information on Ferryville, Wisconsin, please visit our website www.Ferryville.com

Transcription is for seo purposes only.

Larry Quamme is my guest on the Ferryville podcast. I don't worry I'm doing fine why you're calling me by my nickname. My nickname is Larry as opposed to what lower it's Jacob Quamme month. That's how my grandmother Clara Quamme me gave me the name popular in Norway. Jacob is pronounced Jacob Quamme. Me and Norm. Norway is, so did you ever spent any time in Norway. Our two sons gave us a trip to Norway. On our 40th wedding anniversary and we spent two weeks we went to the home farm and the cemeteries are full of headstones that say lower its living in Ferryville now where there's a large Norwegian population. Is there any similarities between Norway and here all once I got to Norway I knew why they came here if you put your back to the Mississippi River and you look up the coulees you're in layer doll Norway where my relatives came from. Really they didn't know how to farm except on a side hill so very very similar terrain in that area. What brought you to ferret my wife and I in 1999 went out for a drive. One day she's from Richland Center came down Highway C and we happened to turn on white Road and we went up the farm road up to the top and we were in Eagle Mountain and we came out on this big beautiful area. Lots of vacant land, and we were very attracted to that because I used to come to Ferryville with my grandpa and we ended up buying 15 acres in 1999 was a good move. Larry oh, definitely. We love it here. Let's talk about the Norwegian immigrants that are in the area. My great grandfather, whose name was Jacob Larson Quamme me and his brother Hawken came from Norway in 1870 and they came via what today would be the St. Lawrence Seaway there was a railroad that ran a little ways out of Québec and then from there, the two brothers walked to Mount Sterling, what's Mount Sterling today. All they had is what they could carry my great grandfather was 24 years old and he had just graduated from a Norwegian seminary, and he was a Norwegian Lutheran minister and he promptly settled, and founded Utica Lutheran Church upon Highway 27. When you think about it, Bob. The Civil War was just ending in 1865 and they were coming to America. Some people settle maybe they didn't even know about the Civil War I found some things that would suggest that there was a can be a way of communicating with the ancestors in Norway with a letter and it took about a month to go each way. When they left Norway they went to Liverpool, England, and then brought wooden ship from Liverpool and then came down the Seaway we have no records on Ellis Island. We were immigrants that came into the United States across the border. So he told people you know in Madison that you're moving to Ferryville full time. How did you explain the area that you're moving to the next thing is that I later learned on my the sister 10 years older than I am. She's 88, she had more recall about things around here and we learned that our grandpa had actually rented some land above Ferryville that is today, Eagle Mountain, so I would tell people I moved back to the homeland. When you explain to them where the homeland was which footage of them like this is going for Madison where there's, you know, the hustle and bustle and people all over the place to know...]]>565bob,business,ferryville,ferryville-wisconsin,great,great-river-road,larry,mississippi,mississippi-river,people,podcast,podcastforhire,quamme,river,road,schmidt,village,wisconsinfalsefullhttps://www.spreaker.com/episode/ferryville-wisconsin-the-people--46499818
For more information on Ferryville, Wisconsin, please visit our website www.Ferryville.com

Transcription is for seo purposes only.

Charley Fisher, we think of Ferryville what first comes to mind for the river. What about the river. All the Mississippians on the white spots of the Mississippi. Bob and I've been in sales for a long time and seen a lot of the Mississippi River, but quite honestly, the river has a is a real dynamic in this part of it, you know, a lot of this is my father-in-law used to say was the hayfields and ballparks until the dams came in in the 30s and the work project brought people to the Mississippi and brought people here in the said you know what we want to be here in course people laughed with work, but they always come back Ferryville pharaohs concert at hundred and 76 people what's her to do a small town, you know, it's kinda interesting. This town is a really welcoming community so the tractor pull started years and years ago the tractor pulls were a big thing in very well and they went away and then the bow to 15 years ago. They came back and so it draws people in, you know they do the fireworks out here on the river in the wintertime the Eagles that you see along the river all winter course. All the fishermen in the duck hunters Bob, that's what brings people to Ferryville so you didn't grow up here. We've lived here most of her adult life. When you think of Ferryville, Wisconsin, Charley, what keeps you here well my wife's family. Of course, you know her, it's a much deeper even than mine here. I mean, her great-grandfathers buried at Freeman Lutheran Church or grandpa and grandma were buried up there were married and her folks were married and buried up there as well and that quite honestly we were married in buried there as well, or you're very not barren for me and Terry. Let's start all over there so actually the roots come from my right side just to be here. What keeps you in the variable, Charley other people to really good group of people that are here, Bob, and for that, we really appreciate it. It's the people and the environment because it's a great area. I mean, you know there's fish and there's hunting the senior years. Good even crop in Ferryville but you spent your erasure children here you live here you got a farm here wife, Ferryville, Wisconsin. He could live anywhere. Wife's roots of course are from here but the people Bob and the people of This year. It's a great network of people and that the scenery is good and the environment. We see a lot of different people come to this area that want to come and see what this is all about it at 176 people. According to the sign that may change. Who knows, but being a small town is there huge draw for people for being a small town ever been here how many opening weekends. It's been just wild you know with people that are here Bob so I yeah there's a lot of draw the fishing the Eagles lot of people draw here is the drawing of raising your daughter here and for the schools are good when my daughter was young. The Prairie view schools out in the middle of the country between Ferryville and DeSoto up on the hills and it's a good group of people again. I got to say about it because it's the truth. It's a network of people that raise these kids, I'm on the road in sales Bob somebody had to do it and she turned out to be valedictorian so I got a given complement. check for the first time came to Ferryville, you know you're courting Christie what were your thoughts of you know, Ferryville, Wisconsin. I keep coming back to about the network of people you know that there's a group of people here that are different then in a lot of areas. Click start the clicks and Ferryville Bob because people. It's such a melted pot of people that have come here and been able to adapt your because of 170 some people's all in the community. People welcomed into the community. See start to see people and you start to know people and you got involved in the church and you got involved in coming downtown have a few beers and knowing the people and the people that couldn't wait to be here on weekends. Bob from their jobs. Whether they were in Chicago or they were in Milwaukee or they worked in Janesville. They couldn't wait to be here in Ferryville so anyway yeah very well spent. Been a great run. Keep bringing up people. Charley and I agree the people in Ferryville are fantastic and the size of the hundred and 76 but I mean it's more than the 176 people communities. Another big word and another cool thing and you know we touched on it a minute ago. Tell me about the tractor pull. So the tractor pull started years ago, long before I was part of Ferryville and my father-in-law was involved in a lot at that point in the Gilman's and a lot of the farms in this area, but even back then, but they do farms from all over coming to be part of the tractor pulls you know you hear people talking about from being over by musket alien blue River and way down and I will come in over here to be part of the tractor pulls back in those days. And of course, it went away for a while. But guess what it's like a lot of things in the soul river. The river changes and so the community changed again and so different people came back and wanted to be part of them. Tractor pulls you mentioned the river and if you bench you know you mentioned people you mentioned the tractor pull and one of the big draws for a lot of people is the river what your thoughts on the Mississippi River. I come from the world of industry and commercial and agriculture. It's it's the reason we have so much strong cash drain in this area. That's why our fertilizers are able to be at a more affordable price. Because of what we can do coming off the river with product versus trucking. It all in and in being in a lot of those areas but it's also the recreation thing about how many people's lives have changed so that not a pontoon boat, drinking a few drinks on a Sunday afternoon with your best friends. People don't forget that stuff Bob know they really don't you deal with a lot of the local people that are farmers and that you know that are that the backbone of our community. There was a lot of tobacco raised here in the day you know and insert tobacco was a big cash crop and a lot of Norwegian heritage. When you get up in the hills around outside of Ferryville. Here, the Lutheran Church, the Freeman Lutheran Church got a strong heritage that way. So me and coming to the ferry to tell me a story about why would want to come here and stay here yet so for Milwaukee are only 3 1/2 hours so it isn't like it's a three day run to come out here and be part of this when you get here you can see some of the prettiest areas that you'll see just comparable to the Black Hills. People want to go to the Black Hills to look at the hills, nice hills out in the Black Hills but they don't have the river as we got here. Do they Bob know they really don't and 3 miles across your one of the widest spots in the in on the in the river right here in favor Wisconsin? He looks out there and I mean it it it's an amazing view. So I was blessed. Looking back on it now that that farm up on the ridge right beside us turned in Eagle Mountain. We got discovered Bob and so went once we got discovered and people started to buy land here and become part of the community. It was like they wanted to stay a part of that was really because of the people that were here and nationally that Them here. It introduced a minute and brought them into the area when we moved that Eagle Mountain was nothing but a farm called the lower place and it was that there was a set of buildings there in a tobacco shed and they burnt the whole thing. They started building roads. They started making views of the river and we met so many unique people that have come here to be part of the community to tell you a story about that that was really interesting so years ago, Christie, Ruben and me. We had tobacco right along the road there and the guy stopped and he built a new house out here. He was a long searching in Chicago and he said I want to stop and I want. I'd love to buy three beliefs tobacco I can have them what you do in a long searching and I want to show people what kills him. Got three big leaves that tobacco and took it back to us back to his office and he always told us he had him in his office and said we raise this back were I I I have a house that we raise it. He wasn't raising it, but he was part of the community. So use we Bob what your favorite story about Fernando. I think one of the things that's one of my favorite stories is actually been part of the celebrations of life with no cone funerals anymore Bob for a couple of really neat people over the years Tom Tower who is a big part of Ferryville and he loved very well. He loved the community, Wilbur Dinger was an old guy that used to be downtown near a lot. That was a great part of the community that they like the community they had a passion and they're all resting here now and so we're part of their life and be part of celebrating their heritage year. So, when push comes to shove, this is where I want to be.]]>https://api.spreaker.com/episode/46499818Mon, 13 Sep 2021 17:08:16 +0000Produced by Podcast For HireFerryville is a little village with a population of 192 in Southwestern Wisconsin. It is located on National Scenic State Highway 35 between Prairie du Chien and LaCrosse Wisconsin. Ferryville is at rivers edge and is an excellent area for hunting,...
For more information on Ferryville, Wisconsin, please visit our website www.Ferryville.com

Transcription is for seo purposes only.

Charley Fisher, we think of Ferryville what first comes to mind for the river. What about the river. All the Mississippians on the white spots of the Mississippi. Bob and I've been in sales for a long time and seen a lot of the Mississippi River, but quite honestly, the river has a is a real dynamic in this part of it, you know, a lot of this is my father-in-law used to say was the hayfields and ballparks until the dams came in in the 30s and the work project brought people to the Mississippi and brought people here in the said you know what we want to be here in course people laughed with work, but they always come back Ferryville pharaohs concert at hundred and 76 people what's her to do a small town, you know, it's kinda interesting. This town is a really welcoming community so the tractor pull started years and years ago the tractor pulls were a big thing in very well and they went away and then the bow to 15 years ago. They came back and so it draws people in, you know they do the fireworks out here on the river in the wintertime the Eagles that you see along the river all winter course. All the fishermen in the duck hunters Bob, that's what brings people to Ferryville so you didn't grow up here. We've lived here most of her adult life. When you think of Ferryville, Wisconsin, Charley, what keeps you here well my wife's family. Of course, you know her, it's a much deeper even than mine here. I mean, her great-grandfathers buried at Freeman Lutheran Church or grandpa and grandma were buried up there were married and her folks were married and buried up there as well and that quite honestly we were married in buried there as well, or you're very not barren for me and Terry. Let's start all over there so actually the roots come from my right side just to be here. What keeps you in the variable, Charley other people to really good group of people that are here, Bob, and for that, we really appreciate it. It's the people and the environment because it's a great area. I mean, you know there's fish and there's hunting the senior years. Good even crop in Ferryville but you spent your erasure children here you live here you got a farm here wife, Ferryville, Wisconsin. He could live anywhere. Wife's roots of course are from here but the people Bob and the people of This year. It's a great network of people and that the scenery is good and the environment. We see a lot of different people come to this area that want to come and see what this is all about it at 176 people. According to the sign that may change. Who knows, but being a small town is there huge draw for people for being a small town ever been here how many opening weekends. It's been just wild you know with people that are here Bob so I yeah there's a lot of draw the fishing the Eagles lot of people draw here is the drawing of raising your daughter here and for the schools are good when my daughter was young. The Prairie view schools out in the middle of the country between Ferryville and DeSoto up on the hills and it's a good group of people again. I got to say about it because it's the truth. It's a network of people that raise these kids, I'm on the road in sales Bob somebody had to do it and she turned out to be valedictorian so I got a given...]]>523business,charley,ferryville,ferryville-wisconsin,fisher,great,great-river-road,mississippi,mississippi-river,people,podcast,river,road,village,wisconsinfalsefullhttps://www.spreaker.com/episode/jeff-s-tractors-informational-podcast--4641641112011 Hwy 61
Fennimore, WI 53809
608-988-6182

Jeff's Tractors https://www.jeffstractorsllc.com/
Tractor House https://www.tractorhouse.com/dealer-directory/jeffs-tractors/listings/farm-equipment/for-sale/list?PCID=2939125&SCF=True

Fall Consignment Sale
Sept 17, 2021
Time 9:00 a.m.
Fall Tractor & Machinery Consignment Sale]]>https://api.spreaker.com/episode/46416411Tue, 07 Sep 2021 18:49:18 +0000Produced by Podcast For HireJeff's Tractors, LLC 12011 Hwy 61 Fennimore, WI 53809 608-988-6182 Jeff's Tractors https://www.jeffstractorsllc.com/ Tractor House...12011 Hwy 61
Fennimore, WI 53809
608-988-6182

Jeff's Tractors https://www.jeffstractorsllc.com/
Tractor House https://www.tractorhouse.com/dealer-directory/jeffs-tractors/listings/farm-equipment/for-sale/list?PCID=2939125&SCF=True

Fall Consignment Sale
Sept 17, 2021
Time 9:00 a.m.
Fall Tractor & Machinery Consignment Sale]]>36817,atv,auction,bagers,boat,buy,consignment,equiptment,farm,jeffs,large,lawn,machinery,mowers,sell,september,tractor,tractors,trade,utvfalsefullhttps://www.spreaker.com/episode/e12-healthfirst-top-program--46218505Podcast For Hire

E11-HealthFirst - Breastfeeding
INFO
HealhFirst Network
216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

Justine is a public relations and education specialist for health first network in Wausau, Wisconsin, as well as in other counties in North Central Wisconsin, what programs you guys are working on her with a program to do it is between outreach program or top what is Topl about top is a great program that we currently have implemented into the six grade curriculum at Adams Friendship area school district that we go in for one hour each week with different groups of students and we are able to provide curriculum lessons and then in addition to that we do a community service learning component that is part of this curriculum as well. Top is an evidence-based curriculum. There are different components to an indifferent fidelity requirements to make sure that this program is working to the best of its ability where some of the effects of the top program. The top program is really great for the students. There is a community service learning component so and that they are building ties to their community and we found that through doing that these students feel more of a responsibility to their community by having that tie, they are less likely to engage in behavior that is detrimental to their community. In addition to that the curriculum has three different components to it. So there is a connecting with others component of building my skills and learning about myself, so through those three different areas that are able to as it sounds, build their skills so there are things such as relieving stress and emotional intelligence. There is a social emotional learning component to this. So there are so many things that are going into this so that the students are able to learn about themselves connect with others connect with their community. So by building all these things we are scaffolding and building these students up to create self-confidence and by doing that it really has long-term positive effects on their health and on all the different realms of their health. So, not just health and the way often we think about it a physical health but there is an emotional health is a social health and so on and so forth that comes with this curriculum are the ties we made to the community. The tither being made to the community through community service learning which is a component of the top program or teen outreach program so community service learning projects could include a wide variety of things we often do projects with the students within the classroom. Since we are part of the school day where we may be. Create letters that we send then to an assisted living home or we have created things such as fleece blankets that we've donated to the assisted living home down there. We have created dog treats cat toys for humane societies. There's a lot of different ways that this can go. But as long as we have that tie to the community and something that can benefit the community members as the main thing that were looking for and then as part of that. We want the students to feel the glow and that comes right from the Wyman or top curriculum. And that's the big piece of it. So with the community service learning project. Those students are choosing what they want to do so. This isn't something that we tell them that you're gonna be doing this project or that project. It's something that they have a tie into and that they have communicated that they would like to do and that helps them really build that tie versus being told what to do because as we know that usually doesn't work with students or anybody. Anybody that that matter]]>https://api.spreaker.com/episode/46218505Tue, 07 Sep 2021 17:00:05 +0000Produced by Podcast For HireE11-HealthFirst - Breastfeeding Podcast For Hire E11-HealthFirst - Breastfeeding INFO HealhFirst Network 216 South 3rd Avenue Wausau, WI 54401 (800) 246-5743 Transcription for SEO purposes only Justine is a public relations and education...Podcast For Hire

E11-HealthFirst - Breastfeeding
INFO
HealhFirst Network
216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

Justine is a public relations and education specialist for health first network in Wausau, Wisconsin, as well as in other counties in North Central Wisconsin, what programs you guys are working on her with a program to do it is between outreach program or top what is Topl about top is a great program that we currently have implemented into the six grade curriculum at Adams Friendship area school district that we go in for one hour each week with different groups of students and we are able to provide curriculum lessons and then in addition to that we do a community service learning component that is part of this curriculum as well. Top is an evidence-based curriculum. There are different components to an indifferent fidelity requirements to make sure that this program is working to the best of its ability where some of the effects of the top program. The top program is really great for the students. There is a community service learning component so and that they are building ties to their community and we found that through doing that these students feel more of a responsibility to their community by having that tie, they are less likely to engage in behavior that is detrimental to their community. In addition to that the curriculum has three different components to it. So there is a connecting with others component of building my skills and learning about myself, so through those three different areas that are able to as it sounds, build their skills so there are things such as relieving stress and emotional intelligence. There is a social emotional learning component to this. So there are so many things that are going into this so that the students are able to learn about themselves connect with others connect with their community. So by building all these things we are scaffolding and building these students up to create self-confidence and by doing that it really has long-term positive effects on their health and on all the different realms of their health. So, not just health and the way often we think about it a physical health but there is an emotional health is a social health and so on and so forth that comes with this curriculum are the ties we made to the community. The tither being made to the community through community service learning which is a component of the top program or teen outreach program so community service learning projects could include a wide variety of things we often do projects with the students within the classroom. Since we are part of the school day where we may be. Create letters that we send then to an assisted living home or we have created things such as fleece blankets that we've donated to the assisted living home down there. We have created dog treats cat toys for humane societies. There's a lot of different ways that this can go. But as long as we have that tie to the community and something that can benefit the community members as the main thing that were looking for and then as part of that. We want the students to feel the glow and that comes right from the Wyman or top curriculum. And that's the big piece of it. So with the community service learning project. Those students are choosing what they want to do so. This isn't something that we tell them that you're gonna be doing this project or that project. It's something that they have a tie into and that they have communicated that they would like to do and that helps them really build that tie versus being told what to do because as we know that usually doesn't work with students or anybody. Anybody that that matter]]>229assistance,care,community,first,health,healthfirst,healthy,help,learning,low-income,market,outreach,planing,project,schools,service,services,wausau,wisconsin,womenfalsefullhttps://www.spreaker.com/episode/e11-healthfirst-breastfeeding--45758848216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

Karen Zimmerman, a WIC specialist from health first networks talking with this the third time we've had a chance to talk in this podcast, which great this almost focus on breast-feeding. How does WIC and breast-feeding go hand-in-hand to doesn't seem like they would be in conjunction with each other. So, how we feed our babies is one of the main components of what the WIC program is breast-feeding is the gold standard for how we should feed our babies now a lot of moms haven't had very much support in their own histories and own lives to be successful at that, even if that is what they want to do because none of their people that they associate with have ever done that one of the things that the WIC program has is called a breast-feeding peer program and what that is is we have moms who have breast-fed their own children and have been involved in the WIC program. They connect with our new moms to be there support person. Oh, that's cool. One of the aspects of it as a peer is that they need to speak the same language and be of the same culture as the mom. So in our population. We have like 30% of our population is mom so we have a Monk's woman who is breast-fed her babies that can speak among that can call those moms and chat or be that support person for them to call back to and how it works. The moms are connected via text or phone call and we just reach out to them and say hey here a.m. if you have troubles. If you have questions. I'm here to help you is your typical? It all depends on the mom situation. If there's no problems then you talk about what to expect and what's normal baby behavior. In the beginning, but if there are troubles or the mom just has questions like is this normal or is my baby getting enough to eat. This doesn't seem like he's growing good enough or how do I breast-feed my baby when I have a two-year-old. That's also running around ripping the house apart right so those kind of just mom kinda conversations in support is what the program is all about is your such a thing as breast-feeding classes. Oh yes, yes, most definitely. That's another aspect of our program that we offer moms breast-feeding class that is available to them in in the last month or two before they are scheduled to deliver their babies and things that we talk about in that class we cover things like what are the benefits of breast-feeding. How do you get started. What can you expect from a normal healthy baby in the beginning what's normal newborn behavior and as a new mom. How do I know if my babies okay and what can I expect the baby to do or not do. And then if these symptoms show her this behavior shows then that's worth a call to reach out to somebody. It really helps moms be prepared so they're confident going into having this baby whether there breast-feeding or decide after they get going that maybe that it isn't working so well, but they have the ammunition then to do the an informed decision about what and how they feed their baby going forward. So, certain certification, the staff has to go through yes all of the counselors for the WIC program are certified to some level of breast-feeding certifications and there's varying levels of that all of the counselors have had additional training on breast-feeding and be certified and one of our breast-feeding counselors is in the process of becoming an IBC LC certified lactation specialist and that stands for international Board of certified lactation consultants, and that's the highest level it's a certification that's geared towards medical care professionals who undertake the clinical management of breast-feeding in support and education. So for those moms that are having more difficulties. She will be able to help them in a very specific way because of all this extra training that she said in the testes is quite involved. One of the goals with having her at the certification level. Besides being that extra asset and resource for all of us and our WIC population is that we'd like to open that up to the general population so that we can serve as a resource for that within our community. The local healthcare systems have very limited numbers of this level certification with in the hospital and primary care systems in our communities and so we've identified that is a lack and were trying to fill that void with this certification here so Karen, it seems to me that health first networks wants families and moms and babies to be successful, and that's why you guys are helping a staff member get through and get certified as IBC LC. It seems like you guys are working toward something that a lot of other people are pushing away. Yeah, I guess we really saw that there was a void in our community. So supporting our staff member to become an IBC LC we feel that this is just a way for us to support moms and I'm more complete way better resources for a moms to be successful at breast-feeding]]>https://api.spreaker.com/episode/45758848Tue, 03 Aug 2021 17:00:11 +0000Produced by Podcast For HireHealhFirst Network 216 South 3rd Avenue Wausau, WI 54401 (800) 246-5743 Transcription for SEO purposes only Karen Zimmerman, a WIC specialist from health first networks talking with this the third time we've had a chance to talk in this podcast,...216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

Karen Zimmerman, a WIC specialist from health first networks talking with this the third time we've had a chance to talk in this podcast, which great this almost focus on breast-feeding. How does WIC and breast-feeding go hand-in-hand to doesn't seem like they would be in conjunction with each other. So, how we feed our babies is one of the main components of what the WIC program is breast-feeding is the gold standard for how we should feed our babies now a lot of moms haven't had very much support in their own histories and own lives to be successful at that, even if that is what they want to do because none of their people that they associate with have ever done that one of the things that the WIC program has is called a breast-feeding peer program and what that is is we have moms who have breast-fed their own children and have been involved in the WIC program. They connect with our new moms to be there support person. Oh, that's cool. One of the aspects of it as a peer is that they need to speak the same language and be of the same culture as the mom. So in our population. We have like 30% of our population is mom so we have a Monk's woman who is breast-fed her babies that can speak among that can call those moms and chat or be that support person for them to call back to and how it works. The moms are connected via text or phone call and we just reach out to them and say hey here a.m. if you have troubles. If you have questions. I'm here to help you is your typical? It all depends on the mom situation. If there's no problems then you talk about what to expect and what's normal baby behavior. In the beginning, but if there are troubles or the mom just has questions like is this normal or is my baby getting enough to eat. This doesn't seem like he's growing good enough or how do I breast-feed my baby when I have a two-year-old. That's also running around ripping the house apart right so those kind of just mom kinda conversations in support is what the program is all about is your such a thing as breast-feeding classes. Oh yes, yes, most definitely. That's another aspect of our program that we offer moms breast-feeding class that is available to them in in the last month or two before they are scheduled to deliver their babies and things that we talk about in that class we cover things like what are the benefits of breast-feeding. How do you get started. What can you expect from a normal healthy baby in the beginning what's normal newborn behavior and as a new mom. How do I know if my babies okay and what can I expect the baby to do or not do. And then if these symptoms show her this behavior shows then that's worth a call to reach out to somebody. It really helps moms be prepared so they're confident going into having this baby whether there breast-feeding or decide after they get going that maybe that it isn't working so well, but they have the ammunition then to do the an informed decision about what and how they feed their baby going forward. So, certain certification, the staff has to go through yes all of the counselors for the WIC program are certified to some level of breast-feeding certifications and there's varying levels of that all of the counselors have had additional training on breast-feeding and be certified and one of our breast-feeding counselors is in the process of becoming an IBC LC certified lactation specialist and that stands for international Board of certified lactation consultants, and that's the highest level it's a certification that's geared towards medical care professionals who undertake the clinical management of breast-feeding in support and education. So for those moms that are having more difficulties. She will be able to help them in a very specific way because of all this extra training that she said in the testes is quite involved. One of...]]>364advocate,assistance,breastfeeding,care,checkups,community,first,foods,health,healthfirst,healthy,help,low-income,market,planing,service,services,wausau,wisconsin,womenfalsefullhttps://www.spreaker.com/episode/e10-healthfirst-community-involvement--45639445216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

Justin public relations and education specialist at health first networks. What is helpers network do for the schools that you are involved with. So we provide education within the schools and most of the counties we serve. We either provide in tandem with the curriculum that they are providing. Or we might be there main point of education for the students and we either provide education on STI's are sexy transmitted infections and/or on contraceptives as well. So in one of the schools, in particular, we are one of many community partners that come in so we provide as a set on STI's in contraceptives and then they also have other community partners come in and talk about other things related to healthy relationships. Sexual activity and the law and things of that nature wears other schools. We are there main point of education and maybe the only education that they are receiving as far as contraceptives or STI prevention to deliver school presentations. We do we do a lot of school presentations and then we can adapt our presentations to fit whatever grade level were presenting to so for talking with middle school students that might look a little bit different than if we are presenting to seniors and we can really tailor it as well to what the school is looking for. So if they've already covered STI's are contraceptives we can provide the opposite, or if they are looking for something more in that middle school level. I've presented on things such as healthy relationships and consent and communication and focusing more on that piece before we dive into some of those heavier topics so health first network is a lot of things of network means that you're probably involved a lot of different things a lot of different people a lot of different organizations. How are you working with some of the other organizations in the area to help out the students and help out the population as a whole so we work like you said in coalition so we have the tricounty coalition in our southern counties. So in Sauk Juneau in Adams County. We work with different organizations with different health departments talking about the topics that are important to the communities that we serve and the clients that we serve or hope to serve. We are part of coalitions in our northern counties as well and different workgroups in different counties who try to be involved in all the counties again that we serve. Making sure that we are working with our community partners determining how we can help serve those individuals making sure that they are aware of our services that we can serve as a resource we can provide education, we can help provide care at a lower cost or no cost for those who are in need of that. So, although we serve one kind of niche were able to help a wide variety of people at different points in their life know you should care what you mean by care care could be annual visits. It can be STI or sexy transmitted infection screening. It could be pregnancy testing, and referrals for prenatal care or adoption services. It could be for our WIC programs so women, infants and children, and that's our nutrition program so there's a lot of different facets of what we provide. You can find all this information on our website as well. Justin is one or two but you know when you're talking what kids in school so click that I hear about kids texting and doing things like, you know that they shouldn't be doing online on texting you know on different social media sites is that something that you work with students on it as well. It is so that is something that we are starting to see more and more of they will get referred to us. So if they have minor fence and this is their first offense they get referred to us for education so we can provide education on not only the STI's in the contraceptives and things like that to help them take care of themselves or to help them be healthy, but in addition to that we talk to them about the laws in Wisconsin and how partaking in these certain activities are going to affect them or could affect them if they get caught doing those things. So in addition to us again community involvement. We also work with other community organizations that provide education as well. So it's really a group and community effort to ensure that these students are getting the education that they need to hopefully get them on the right path should just be one of the other things that he is working with with the community projects and the involvement that health first networks is in. I'd heard that just recently guys started working with Special Olympics Wisconsin. So in addition to working with special effects Wisconsin. We are working with Special Olympics international as well so they are working to create a curriculum with another organization and then in addition to that we are working on a clinic experience guide that we can provide to the athletes and their caretakers, and through that those individuals will be able to use this guide to help those individuals understand what those reproductive health visits that they might have what those all entail what to expect. What sorts of medical equipment and supplies they might see during that visit just to be able to prepare them for that. So they aren't surprised when they get asked certain questions are not surprised when they're asked to do certain things. So just helps take away some of that fear factor that individuals might have walking into an appointment if they're not sure what two of the anxiety you about is amazing. You know it's it's probably overwhelming to some people, absolutely. And this is geared for special-effects athletes. But really, we see that a lot of individuals it's just sometimes the fear of the unknown whether it's reproductive health or anything in life, so anything that we can do to ease that fear and make people more aware and provide the education that really helps to empower them to come in and be able to advocate for their own health]]>https://api.spreaker.com/episode/45639445Fri, 09 Jul 2021 15:45:16 +0000Produced by Podcast For HireHealhFirst Network 216 South 3rd Avenue Wausau, WI 54401 (800) 246-5743 Transcription for SEO purposes only Justin public relations and education specialist at health first networks. What is helpers network do for the schools that you are involved...216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

Justin public relations and education specialist at health first networks. What is helpers network do for the schools that you are involved with. So we provide education within the schools and most of the counties we serve. We either provide in tandem with the curriculum that they are providing. Or we might be there main point of education for the students and we either provide education on STI's are sexy transmitted infections and/or on contraceptives as well. So in one of the schools, in particular, we are one of many community partners that come in so we provide as a set on STI's in contraceptives and then they also have other community partners come in and talk about other things related to healthy relationships. Sexual activity and the law and things of that nature wears other schools. We are there main point of education and maybe the only education that they are receiving as far as contraceptives or STI prevention to deliver school presentations. We do we do a lot of school presentations and then we can adapt our presentations to fit whatever grade level were presenting to so for talking with middle school students that might look a little bit different than if we are presenting to seniors and we can really tailor it as well to what the school is looking for. So if they've already covered STI's are contraceptives we can provide the opposite, or if they are looking for something more in that middle school level. I've presented on things such as healthy relationships and consent and communication and focusing more on that piece before we dive into some of those heavier topics so health first network is a lot of things of network means that you're probably involved a lot of different things a lot of different people a lot of different organizations. How are you working with some of the other organizations in the area to help out the students and help out the population as a whole so we work like you said in coalition so we have the tricounty coalition in our southern counties. So in Sauk Juneau in Adams County. We work with different organizations with different health departments talking about the topics that are important to the communities that we serve and the clients that we serve or hope to serve. We are part of coalitions in our northern counties as well and different workgroups in different counties who try to be involved in all the counties again that we serve. Making sure that we are working with our community partners determining how we can help serve those individuals making sure that they are aware of our services that we can serve as a resource we can provide education, we can help provide care at a lower cost or no cost for those who are in need of that. So, although we serve one kind of niche were able to help a wide variety of people at different points in their life know you should care what you mean by care care could be annual visits. It can be STI or sexy transmitted infection screening. It could be pregnancy testing, and referrals for prenatal care or adoption services. It could be for our WIC programs so women, infants and children, and that's our nutrition program so there's a lot of different facets of what we provide. You can find all this information on our website as well. Justin is one or two but you know when you're talking what kids in school so click that I hear about kids texting and doing things like, you know that they shouldn't be doing online on texting you know on different social media sites is that something that you work with students on it as well. It is so that is something that we are starting to see more and more of they will get referred to us. So if they have minor fence and this is their first offense they get referred to us for education so we can provide education on not only the STI's in the contraceptives and things like that...]]>357assistance,care,checkups,community,first,foods,fpos,health,healthfirst,healthy,help,low-income,market,planing,pregnancy,service,services,wausau,wisconsin,womenfalsefullhttps://www.spreaker.com/episode/e9-healthfirst-farmers-market--44606655216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

Jesse Scharfenberg is the Chief Executive Officer and health first network in Wausau, Wisconsin in nine counties usually all over the place, which is great and my favorite times of the year's planting started gardening a couple years ago and I love gardening. I love the fresh vegetables and love the fresh fruits that love the chance to get out there and see what other people of harvested and farmers markets are huge thing farmers markets are a good thing you see them everywhere there every day of the week in every county and they're just a great access points to fresh fruits and vegetables. Some of the really cool things about the WIC program is that in the summer between June 1 and October 31. Individuals will receive farmers market check you can go to the farmers market and get fresh fruits and vegetables with the WIC program so give you a lot of variety of the early-season versus the late seasons on the October timeframe. The key to go to apple orchards and get fresh apples. So depending on the year. Individual families will get between 30 and $35 worth of farmers market checks. One of those little differences with this is that mostly with the WIC program. Each individual within the family gets their own food package to farmers market. Checks are per family. Okay, so it's not that each person is been received, the $30-$35 at each family will receive what you get a lot of things in the farmers market for 30 but you can get all have fresh fruits and vegetables, which is really great because it's an extremely important part of the diet but also supports local farmers by giving back to them by using their fruits and vegetables what we do is kind of a twofold so we work with the local farmers that the farmers market to see if they want to accept WIC checks so they have to go through a training program and then when you are actually a shopper at the farmers market. You probably see a bunch of yellow signs on different vendors and that you will find means that they accept WIC benefits. Individuals with the farmers market. Checks can go to the farmers market and the checks are for five dollars each so that you can go to different vendors so you can only use one check per vendor.]]>https://api.spreaker.com/episode/44606655Tue, 01 Jun 2021 17:00:12 +0000Produced by Podcast For HireHealhFirst Network 216 South 3rd Avenue Wausau, WI 54401 (800) 246-5743 Transcription for SEO purposes only Jesse Scharfenberg is the Chief Executive Officer and health first network in Wausau, Wisconsin in nine counties usually all over the place,...216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

Jesse Scharfenberg is the Chief Executive Officer and health first network in Wausau, Wisconsin in nine counties usually all over the place, which is great and my favorite times of the year's planting started gardening a couple years ago and I love gardening. I love the fresh vegetables and love the fresh fruits that love the chance to get out there and see what other people of harvested and farmers markets are huge thing farmers markets are a good thing you see them everywhere there every day of the week in every county and they're just a great access points to fresh fruits and vegetables. Some of the really cool things about the WIC program is that in the summer between June 1 and October 31. Individuals will receive farmers market check you can go to the farmers market and get fresh fruits and vegetables with the WIC program so give you a lot of variety of the early-season versus the late seasons on the October timeframe. The key to go to apple orchards and get fresh apples. So depending on the year. Individual families will get between 30 and $35 worth of farmers market checks. One of those little differences with this is that mostly with the WIC program. Each individual within the family gets their own food package to farmers market. Checks are per family. Okay, so it's not that each person is been received, the $30-$35 at each family will receive what you get a lot of things in the farmers market for 30 but you can get all have fresh fruits and vegetables, which is really great because it's an extremely important part of the diet but also supports local farmers by giving back to them by using their fruits and vegetables what we do is kind of a twofold so we work with the local farmers that the farmers market to see if they want to accept WIC checks so they have to go through a training program and then when you are actually a shopper at the farmers market. You probably see a bunch of yellow signs on different vendors and that you will find means that they accept WIC benefits. Individuals with the farmers market. Checks can go to the farmers market and the checks are for five dollars each so that you can go to different vendors so you can only use one check per vendor.]]>349assistance,care,checkups,farmers,first,foods,fpos,fruit,health,healthfirst,healthy,low-income,market,planing,pregnancy,services,vegetable,wausau,wisconsin,womenfalsefullhttps://www.spreaker.com/episode/e8-healthfirst-what-is-fit-families--44606540216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

We talked about a lot of different programs with health first network and Suzanne plot check. During this time talking about food families and for families, ties in with the WIC program which makes sense because you're with dietitian and you soon taking over the WIC program here correct. Yes. So the for families program is a program that we do in conjunction with the WIC program it's geared towards 2 to 4-year-old children and potentially their families. The program is one that focuses on childhood obesity and preventing childhood obesity. So what the program does is families choose a goal, something that they want to work on and then we help them achieve that goal. Over the 13 month time. So how do you do that the families to the goal that they like to work on it could be something from decreasing screen time, increasing physical activity increasing the amount of fruits and vegetables they consume in a day or changing the beverages that they drink we set a goal with them and then work with them on a monthly basis by either texting, calling or emailing them and checking in with them to see how their goal is going and then giving them tips and suggestions on how they can better achieve that goal they mentioned was 13 months why 13 months rather than like six or 12 or you know that the typical time link that usually think of something going sir. So we collected starting data we get BMI from the family and then we ask some of the questions regarding how much screen time how much fruits and vegetables they consume and then we wait, that full year to make sure that you know we've captured all the data we can and then we re-ask the same questions at the 13 month mark to see what changes they made, or if there's been improvements in certain areas with use of the data for the state that family program analyzes that data they have a separate team that analyzes it and then they send back reports annually that tells each program how they've done in terms of improving the fruit and vegetable consumption in children or decreasing screen time]]>https://api.spreaker.com/episode/44606540Tue, 04 May 2021 17:00:04 +0000Produced by Podcast For HireHealhFirst Network 216 South 3rd Avenue Wausau, WI 54401 (800) 246-5743 Transcription for SEO purposes only We talked about a lot of different programs with health first network and Suzanne plot check. During this time talking about food families...216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

We talked about a lot of different programs with health first network and Suzanne plot check. During this time talking about food families and for families, ties in with the WIC program which makes sense because you're with dietitian and you soon taking over the WIC program here correct. Yes. So the for families program is a program that we do in conjunction with the WIC program it's geared towards 2 to 4-year-old children and potentially their families. The program is one that focuses on childhood obesity and preventing childhood obesity. So what the program does is families choose a goal, something that they want to work on and then we help them achieve that goal. Over the 13 month time. So how do you do that the families to the goal that they like to work on it could be something from decreasing screen time, increasing physical activity increasing the amount of fruits and vegetables they consume in a day or changing the beverages that they drink we set a goal with them and then work with them on a monthly basis by either texting, calling or emailing them and checking in with them to see how their goal is going and then giving them tips and suggestions on how they can better achieve that goal they mentioned was 13 months why 13 months rather than like six or 12 or you know that the typical time link that usually think of something going sir. So we collected starting data we get BMI from the family and then we ask some of the questions regarding how much screen time how much fruits and vegetables they consume and then we wait, that full year to make sure that you know we've captured all the data we can and then we re-ask the same questions at the 13 month mark to see what changes they made, or if there's been improvements in certain areas with use of the data for the state that family program analyzes that data they have a separate team that analyzes it and then they send back reports annually that tells each program how they've done in terms of improving the fruit and vegetable consumption in children or decreasing screen time]]>352assistance,care,checkups,families,family,first,fit,health,healthfirst,healthy,low-income,planing,pregnancy,screen,services,teamwork,time,wausau,wisconsin,womenfalsefullhttps://www.spreaker.com/episode/e7-healthfirst-sti-prevention--44249181216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

One of the question with a lot of people that are sexually active have is how to prevent having a sexually-transmitted disease or infection you know what. Since this is such a big topic to both you guys here Jesse Scharfenberg is the Chief Executive Officer of health first network and just the entity is the public relations and education specialist. It is a much of STI's are scary. What can we do to prevent them. Use a condom that the number one thing is to use a condom and we don't see individuals using condoms anymore. Why is that so there's many reasons that people don't use condoms anymore. One thing is that we have really great access, birth control methods so they know that if their partner is on a birth control method there's no risk of pregnancy. So we kind of forget about the STI side of things and preventing those. The other aspect is we have some really great resources to prevent HIV in a taxi take medication that's prophylaxis so that you could have sexual intercourse with someone with HIV and not get HIV. So now that were not wearing about preventing HIV as much because there's other medications that are working for that people kind of forget about having to use a condom to prevent chlamydia and gonorrhea and herpes and warts because those aren't thought as long term diseases or a consequence infections. Here's a question, although still viable diseases. Yes, we are seeing large numbers of chlamydia still occurring gonorrhea for the last five years we have seen increases in STI's across the United States in all categories. So this isn't something that is even plateauing or that were seen going away by any means not just the Jesse mentioned using condoms is that as an educator. Is that something you have to teach people how to do, how to use a condom. Yes, absolutely. So when we go into education for students or we are doing outreach in the community. We make sure that we let folks know about condoms how to use them and we can provide demonstrations as well so we are able to show how to use internal and external condoms, or more commonly known as male and female condom okay you got me there. What is an internal condom. So an internal condom is sometimes still known as a female condom but that is a condom that can be used internally as the name would imply, so that could be utilized in someone with of the China they would insert the condom internally and it would provide protection that way. So you would use either the internal or external condom, but you would not use them both together to use one or the other and that internal condom can also provide some additional STI prevention externally. So when were thinking of those STI's that can be spread through skin to skin contact. The internal condom can provide some additional protection by having some of that condom outside of the body as well much in my stupid for not knowing what those are. No, but I feel that a lot of people don't know what they are. They're not commonly used is something that we encourage and we give out to all of our clients on a normal basis is using the internal condom should be used. It should be widely known but it's not. We think there's a lot of education that just focuses on the external or the male condom and when education occurs. They just forget about the internal condom. The other great thing about the internal condom is that it can be used for a no sex as well and exit points. The annual cavity. So one thing that we talk about. STI prevention ever it is that all penile to the badge. No sex will actually STI Xerox you can get Estes and Uranus. You can get it on your penis or in your Regina. So when were talking about. STI prevention were talking about. If you're having oral sex, wearing a condom to follow it out. That is why there are flavored so we went to the Reading is coming. We don't know that there are flavored condoms so if you are having oral sex and the penis is going into your mouth that individuals should be wearing a condom. There's also what we call dental dams, which are they got almost like a piece of plastic that would go over the national area that an individual could put there over the penis just so that there's for the protection from the skin to skin contact so that were not transmitting infections between individuals just review offer both of these types of condoms at health first network. Yes, we have both of these and all of our clinics available for anyone who's looking for them so people can pick these up regardless of sex, so again as we said for the internal and external condom with health first network to talk about. STI prevention. What about if you know you had unprotected sex and you're worried about you know, did I catch something or did so in noted something slick by the combo Maury got a bit your burner. It is your testing available yes. So we do testing for STI's and just as you said it whether someone has had unprotected sex, and even if they had protected sex, condoms work really really great at preventing STS, but since they aren't 100% we do recommend getting screened routinely for STI's. If you are sexually active, so at least once a year on the everyone should be getting screen for STI's, and if you are having a change in partner. If you have multiple partners then we would likely recommend getting screen more routinely so you can talk with one of our providers and then they would be able to let you know how frequently to be screened for that at health first. We test for chlamydia, gonorrhea, syphilis, HPV genital herpes genital warts trichomoniasis or sometimes known as trick and HIV is there like a shot or vaccine or something that that somebody could take to prevent STI's there is a vaccine is called got a cell and it will protect you against nine of the most common cancer causing strains of HPV, which is the human papilloma virus. So what we see is that human papilloma virus is There's a lot of people out there that have cervical cancer that don't know that they have it or have the precancerous cells for cervical cancer correct. Yeah that's very true. So that is why when individuals come in for their annual exams. They are on schedules to have their Done and then we also do eight what's called HPV Co. testing. So we are taking samples of the cervix to be looking for the HPV virus as well. As part of the FP OS and is part of the family-planning only services or F because so with the Gardasil vaccine in the annual exams that Pap smear the HPV co-testing all of that is covered FP OS so individuals are getting these services at zero cost and were do we go about getting appointments. You call 1-800-246-5743 in nine counties in north-central Wisconsin]]>https://api.spreaker.com/episode/44249181Thu, 08 Apr 2021 00:30:21 +0000Produced by Podcast For HireHealhFirst Network 216 South 3rd Avenue Wausau, WI 54401 (800) 246-5743 Transcription for SEO purposes only One of the question with a lot of people that are sexually active have is how to prevent having a sexually-transmitted disease or infection...216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

One of the question with a lot of people that are sexually active have is how to prevent having a sexually-transmitted disease or infection you know what. Since this is such a big topic to both you guys here Jesse Scharfenberg is the Chief Executive Officer of health first network and just the entity is the public relations and education specialist. It is a much of STI's are scary. What can we do to prevent them. Use a condom that the number one thing is to use a condom and we don't see individuals using condoms anymore. Why is that so there's many reasons that people don't use condoms anymore. One thing is that we have really great access, birth control methods so they know that if their partner is on a birth control method there's no risk of pregnancy. So we kind of forget about the STI side of things and preventing those. The other aspect is we have some really great resources to prevent HIV in a taxi take medication that's prophylaxis so that you could have sexual intercourse with someone with HIV and not get HIV. So now that were not wearing about preventing HIV as much because there's other medications that are working for that people kind of forget about having to use a condom to prevent chlamydia and gonorrhea and herpes and warts because those aren't thought as long term diseases or a consequence infections. Here's a question, although still viable diseases. Yes, we are seeing large numbers of chlamydia still occurring gonorrhea for the last five years we have seen increases in STI's across the United States in all categories. So this isn't something that is even plateauing or that were seen going away by any means not just the Jesse mentioned using condoms is that as an educator. Is that something you have to teach people how to do, how to use a condom. Yes, absolutely. So when we go into education for students or we are doing outreach in the community. We make sure that we let folks know about condoms how to use them and we can provide demonstrations as well so we are able to show how to use internal and external condoms, or more commonly known as male and female condom okay you got me there. What is an internal condom. So an internal condom is sometimes still known as a female condom but that is a condom that can be used internally as the name would imply, so that could be utilized in someone with of the China they would insert the condom internally and it would provide protection that way. So you would use either the internal or external condom, but you would not use them both together to use one or the other and that internal condom can also provide some additional STI prevention externally. So when were thinking of those STI's that can be spread through skin to skin contact. The internal condom can provide some additional protection by having some of that condom outside of the body as well much in my stupid for not knowing what those are. No, but I feel that a lot of people don't know what they are. They're not commonly used is something that we encourage and we give out to all of our clients on a normal basis is using the internal condom should be used. It should be widely known but it's not. We think there's a lot of education that just focuses on the external or the male condom and when education occurs. They just forget about the internal condom. The other great thing about the internal condom is that it can be used for a no sex as well and exit points. The annual cavity. So one thing that we talk about. STI prevention ever it is that all penile to the badge. No sex will actually STI Xerox you can get Estes and Uranus. You can get it on your penis or in your Regina. So when were talking about. STI prevention were talking about. If you're having oral sex, wearing a condom to follow it out. That is why there are flavored so we went to the Reading is coming. We...]]>456assistance,care,checkups,disease,first,fpos,health,healthfirst,healthy,low-income,planing,pregnancy,services,sexual,std,sti,transmitted,wausau,wisconsin,womenfalsefullhttps://www.spreaker.com/episode/e6-healthfirst-what-is-fpos--43828111216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only]]>https://api.spreaker.com/episode/43828111Wed, 10 Mar 2021 16:39:01 +0000Produced by Podcast For HireHealhFirst Network 216 South 3rd Avenue Wausau, WI 54401 (800) 246-5743 Transcription for SEO purposes only216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only]]>325assistance,care,checkups,children,family,first,fpos,health,healthfirst,healthy,infant,low-income,planing,pregnancy,reproductive,services,wausau,wic,wisconsin,womenfalsefullhttps://www.spreaker.com/episode/e2-downtown-main-street-inc-la-crosse-center--43641135DMI
422 Main Street
La Crosse, Wisconsin
54601
(608) 784-0440

Transcription for SEO only.
Art Fahey joins us on this DMI podcast. Downtown has the college area, which is always fun for people to enjoy. I think of such a variety no myself for not being your lacrosse centering at the multiuse building sign in one day we might have a sports vacation shown the remaining efforts. The organic farmers conference and turn around and get high school basketball games coming in or entertainment that comes through so I think the shield of the varieties were small town feel people come in they feel safe will crosses embraces and welcomes all our guests and then realize how important our guest coming to the Aryans are local people coming to the downtown area are so I think is quite a warm reception everybody coming to the area so I think were unique in the beauty that we got as well) features a lot of things that neglect communities would look at art, say, is the director of the La Crosse Center in downtown La Crosse and a lot of things are happening down there, including the remodel of the La Crosse Center. Let's talk a little bit about the remodel to be tells is going on with the lacrosse in her care is the process it's going to take about almost 2 years to get completed. We had a renovation remodel of the arena, so this new seating in their sound system, lighting, HVAC, dressing rooms, locker room concession stands have all been remodeled were to be going in the outer court order that goes around the buildings that people have to go outside to navigate to the building and we put up a new North Hall called a noteholder call and that is ready to go. We are at now is called the punch list time where construction guys are going through. They really have turned the keys over for us for those two particular rooms that we still have construction guys are better available and you will a midway point through the first phase of the construction for part that still continuing as a number of meeting rooms and a volume that overlooks the Riverside that scheduled for the end of November to be completed and that there continuing with that process over the front Street area, which is adjacent to Riverside Park and will assign the building so we move along very well. You know it. If you ever look for a no light in the middle Kovacs and the construction crews that stay healthy throughout last actually progressed very well and very quickly. Overall, no work on time and on budget. It always is all good things there. As far as the overall construction venue absolutely destroys positive things to be on time and on budget. So art what will the impact of the remodel have on the downtown La Crosse area well you know when forecasting this we had economic impacts of increasing but the center could do for the downtown area in the range of $79 million a year that on top of already the 18 million it was doing so already and admit hi $29 per year economic impact for the area here. So now this is something that certainly has a direct impact on hotels and restaurants and shopping locations that are near to us by others sent ripples throughout the county. So it's something that can be beneficial to West Wisconsin because we slowly ramp up and get out of this code. People start meeting again and I will see the effects of this in our success with a lot of things we have here have been and made multiple small events and we see that continuing and we do have a large marquee event that comes through the multiple small vents is obviously the core of our success for the La Crosse Center, how many employees work for the La Crosse and well test test test code is created all kinds of fluctuations in pre-Covid, we had 15 full-time at about 300 part-time. So when we got in the Covid all, unfortunately, all part-timers and all were just the work form and we went from 15 full-time down to seven full-time now that were slowly coming back were starting to make plans and we have an escalating plan to add people back in. Based on the floor business. Now we we will have again somewhere in that 15 to 19 range of full-time people. Once we are considered at full steam and will be in at 250 to 300 part-timers again. Once we have everything back in place in the world stacked some consents and normal art. Let's look forward to the future to pass 2022. When things are back to running normally. What is the future look like for the La Crosse Center while you know what we've got is new meeting space is a different kind of meeting space here and were anticipating know that that will bring a different clientele down to us and always got a lot of floor space to tradeshows and go along with this and breakout space were looking for a lot more regional type of business coming our way, which I think was an area that we hadn't been delivering which certainly can be done now and we could see things coming out based on the Minneapolis are based on the lighting as well as island in Wisconsin to come our way related to some right things and some exciting things that you would be opening up the doors as you go along here and there's certain events that are to be large events that will also come our way here that will take up the entire building with the La Crosse Center expansion and everything art is La Crosse and are still going to be hosting like the big Moses vent that comes every year. Yes, that definitely was going to 2022 there making plans come back and be with us and is a featured event that does come to the building. A lot of people are aware of it and continue to come our way and so were looking for a long-term relationship will continue with the organic farmers organization part which have an impact as the downtown La Crosse area have when you have an event committed. Let's say the WIA basketball tournament was very important that our neighbors in the downtown area and are involved in greeting people just seating for 500 people in relation to the downtown and they're going to go out and have a cocktail and maybe a meal, and maybe do a little shopping you know you really set many people in a downtown you can quickly see where the restaurant that's 50 to 75 tears to be filled out fairly quickly, so they just need to be aware know if what were doing when relation peak, which is great communication between us and the commission has grown the downtown organization and DMI to let these folks know that they're coming to be in town and you will probably feel the effects of sin on hotels or to three days parking all comes into play. So we need to partners in the downtown area know to be able to welcome those folks = insane welcome this organization in the town and given the hospitality La Crosse is known for. Because these people are taking and not just La Crosse, and it is taken whole community. So art how much of a factor is that having a vibrant downtown is trying to sell the center to the prospective new client. I think that's important now. Each community got their own little sales point La Crosse certainly got ours without saying you know this but the back door and get the Mississippi River Riverside Park right here. Not hardly any community in the state of Wisconsin I can talk about the Mississippi River. So your features here that we sell are important to know in comparison to others.
That's why Vince move around taking those different things the city has you know we have things like the DMI what they do is they get the message out to all the membership and those are the ones downtown Main Street. To me those are the people that are wrapped right around this year and what we do and what they do you know are joined at the hip. If you will, and so the value of DMI having a communication and filling storefronts and giving people things to do once they leave our building that's important is if we didn't have a downtown. It was thriving like it is and how it can really make our guests coming to town to go for a little when I go Baptist because it is not much going on but the way our downtown is its active it's lively it's driving snow so DMI is a great job]]>https://api.spreaker.com/episode/43641135Thu, 25 Feb 2021 21:34:16 +0000Produced by Podcast For HireDowntown Main Street DMI 422 Main Street La Crosse, Wisconsin 54601 (608) 784-0440 Transcription for SEO only. Art Fahey joins us on this DMI podcast. Downtown has the college area, which is always fun for people to enjoy. I think of such a variety...DMI
422 Main Street
La Crosse, Wisconsin
54601
(608) 784-0440

Transcription for SEO only.
Art Fahey joins us on this DMI podcast. Downtown has the college area, which is always fun for people to enjoy. I think of such a variety no myself for not being your lacrosse centering at the multiuse building sign in one day we might have a sports vacation shown the remaining efforts. The organic farmers conference and turn around and get high school basketball games coming in or entertainment that comes through so I think the shield of the varieties were small town feel people come in they feel safe will crosses embraces and welcomes all our guests and then realize how important our guest coming to the Aryans are local people coming to the downtown area are so I think is quite a warm reception everybody coming to the area so I think were unique in the beauty that we got as well) features a lot of things that neglect communities would look at art, say, is the director of the La Crosse Center in downtown La Crosse and a lot of things are happening down there, including the remodel of the La Crosse Center. Let's talk a little bit about the remodel to be tells is going on with the lacrosse in her care is the process it's going to take about almost 2 years to get completed. We had a renovation remodel of the arena, so this new seating in their sound system, lighting, HVAC, dressing rooms, locker room concession stands have all been remodeled were to be going in the outer court order that goes around the buildings that people have to go outside to navigate to the building and we put up a new North Hall called a noteholder call and that is ready to go. We are at now is called the punch list time where construction guys are going through. They really have turned the keys over for us for those two particular rooms that we still have construction guys are better available and you will a midway point through the first phase of the construction for part that still continuing as a number of meeting rooms and a volume that overlooks the Riverside that scheduled for the end of November to be completed and that there continuing with that process over the front Street area, which is adjacent to Riverside Park and will assign the building so we move along very well. You know it. If you ever look for a no light in the middle Kovacs and the construction crews that stay healthy throughout last actually progressed very well and very quickly. Overall, no work on time and on budget. It always is all good things there. As far as the overall construction venue absolutely destroys positive things to be on time and on budget. So art what will the impact of the remodel have on the downtown La Crosse area well you know when forecasting this we had economic impacts of increasing but the center could do for the downtown area in the range of $79 million a year that on top of already the 18 million it was doing so already and admit hi $29 per year economic impact for the area here. So now this is something that certainly has a direct impact on hotels and restaurants and shopping locations that are near to us by others sent ripples throughout the county. So it's something that can be beneficial to West Wisconsin because we slowly ramp up and get out of this code. People start meeting again and I will see the effects of this in our success with a lot of things we have here have been and made multiple small events and we see that continuing and we do have a large marquee event that comes through the multiple small vents is obviously the core of our success for the La Crosse Center, how many employees work for the La Crosse and well test test test code is created all kinds of fluctuations in pre-Covid, we had 15 full-time at about 300 part-time. So when we got in the Covid all, unfortunately, all part-timers and all were just the work form and we went from 15 full-time down to seven full-time now that were...]]>459art,business,center,downtown,eat,fahey,historic,investors,lacrosse,live,mainstreet,member,mission,mississippi,parks,play,river,stay,street,wisconsinfalsefullhttps://www.spreaker.com/episode/e5-healthfirst-who-qualifies-for-wic--43188035216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

From expectations to conversations. We offer all the services you would expect health first network provides quality confidential reproductive health care, education, and nutrition counseling this month's health first podcast features Karen Zimmerman service line manager for WIC Karen's work for the WIC program at health first network for 32 years so Karen who qualifies for the WIC program. The qualifying criteria are pregnant moms breast-feeding moms moms who have children under six months of age if you're not breast-feeding, and then kids up to the age of five in those households where those people reside that gross income needs to be under hundred and 85% of poverty which an actual dollar terms. Let's say you have a mom and dad and two kids. Your annual income grows, we need to be roughly under $48,500. So if you think about it. If you're making almost $50,000 a year as a family with two kids. That's a lot of people today that work in positions where that's what their income is that number is the thing that makes us different because we are designed to help those people that make more than would they be eligible for other resources and is a stop off program to write is not a you get your here forever. It's a were helping you to attain the next goal right and the other thing that we do that makes us so that it is that step off once a year everybody that participates in the program needs to come in and do another appointment where we reevaluate all the eligibility criteria roughly every three months where contacting people to do some follow-up education or another way, in a measure on kids to see how everybody's growing and it's an opportunity for us to provide that additional education for parents with young children because as you know they change rapidly and the problems they present change rapidly and we're here to provide that just one-on-one education to help parents do the best they can to help their children grow to be the best we do a health and a diet assessment because all the counselors like is that our dietitian. So that's our focus, so if you think of the well-child visit with the nutrition focus we don't do medicine. We don't do what the doctor does but we also are trained and can identify things that would warrant a hey this is something that you maybe want to give your doctor call about because this doesn't look quite right in the program called with women infant and children know that there's something over some single beds that are rich in kids with his grandparents in a region kids and it always blended families and families now is there a lot different than they used to be part of that work are they able to get help from work yes yes and those are ones to that we really struggled to reach because they don't realize that we're here to help them as well because the child is the one that's eligible for the program. So if the child meets the criteria for eligibility. Whether it's the grandparents raising the child that dad a foster child if they qualified they can qualify for as long as they meet the criteria. If, for example, a child qualifies for badger care. They most likely would qualify income wise, even if the say the child is with grandma and grandpa and they could get the help because the child is meets the criteria so it's all about helping the children helping the children and so we really encourage anybody that is interested in at least checking it out. We can screen them over the phone. That's a simple process with a phone call. There's also some online things that people can go to Whitcomb on strong where you can just fill in your information. Your information gets passed along to us and then we give you a phone call and we can have a conversation. There is another website through the state. That's called Wisconsin well badger which is a really cool website where people who are looking for some assistance in one type of thing or another Wisconsin well badger you can do it online or you can call the number that pops up when you're looking for that is process is easy if you were did come for an appointment. What happens is you get checked in. We do have some documentation that families need to provide like a piece of mail ID check stubs and then have a conversation about where the family wants to do better and set goals in three months they come back to see us or we contact them. Then were checking in and helping them do better whatever they want. For more information visit www.health1network.org or find us on social media at health first network]]>https://api.spreaker.com/episode/43188035Wed, 03 Feb 2021 18:20:02 +0000Produced by Podcast For HireHealhFirst Network 216 South 3rd Avenue Wausau, WI 54401 (800) 246-5743 Transcription for SEO purposes only From expectations to conversations. We offer all the services you would expect health first network provides quality confidential...216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription for SEO purposes only

From expectations to conversations. We offer all the services you would expect health first network provides quality confidential reproductive health care, education, and nutrition counseling this month's health first podcast features Karen Zimmerman service line manager for WIC Karen's work for the WIC program at health first network for 32 years so Karen who qualifies for the WIC program. The qualifying criteria are pregnant moms breast-feeding moms moms who have children under six months of age if you're not breast-feeding, and then kids up to the age of five in those households where those people reside that gross income needs to be under hundred and 85% of poverty which an actual dollar terms. Let's say you have a mom and dad and two kids. Your annual income grows, we need to be roughly under $48,500. So if you think about it. If you're making almost $50,000 a year as a family with two kids. That's a lot of people today that work in positions where that's what their income is that number is the thing that makes us different because we are designed to help those people that make more than would they be eligible for other resources and is a stop off program to write is not a you get your here forever. It's a were helping you to attain the next goal right and the other thing that we do that makes us so that it is that step off once a year everybody that participates in the program needs to come in and do another appointment where we reevaluate all the eligibility criteria roughly every three months where contacting people to do some follow-up education or another way, in a measure on kids to see how everybody's growing and it's an opportunity for us to provide that additional education for parents with young children because as you know they change rapidly and the problems they present change rapidly and we're here to provide that just one-on-one education to help parents do the best they can to help their children grow to be the best we do a health and a diet assessment because all the counselors like is that our dietitian. So that's our focus, so if you think of the well-child visit with the nutrition focus we don't do medicine. We don't do what the doctor does but we also are trained and can identify things that would warrant a hey this is something that you maybe want to give your doctor call about because this doesn't look quite right in the program called with women infant and children know that there's something over some single beds that are rich in kids with his grandparents in a region kids and it always blended families and families now is there a lot different than they used to be part of that work are they able to get help from work yes yes and those are ones to that we really struggled to reach because they don't realize that we're here to help them as well because the child is the one that's eligible for the program. So if the child meets the criteria for eligibility. Whether it's the grandparents raising the child that dad a foster child if they qualified they can qualify for as long as they meet the criteria. If, for example, a child qualifies for badger care. They most likely would qualify income wise, even if the say the child is with grandma and grandpa and they could get the help because the child is meets the criteria so it's all about helping the children helping the children and so we really encourage anybody that is interested in at least checking it out. We can screen them over the phone. That's a simple process with a phone call. There's also some online things that people can go to Whitcomb on strong where you can just fill in your information. Your information gets passed along to us and then we give you a phone call and we can have a conversation. There is another website through the state. That's called Wisconsin well badger which is a really cool...]]>318assistance,care,checkups,children,first,food,health,healthfirst,healthy,infant,low-income,nutrition,pregnancy,reproductive,vegetable,wausau,wic,wisconsin,womenfalsefullhttps://www.spreaker.com/episode/e1-downtown-main-street-inc-what-is-dmi--43227846DMI
422 Main Street
La Crosse, Wisconsin
54601
(608) 784-0440

Transcription for SEO only. A new Location and a new Executive Director DMI a.k.a. downtown MainStreet Inc. lacrosse is moving in the right direction with Terry Bauer the new Executive Director for downtown Main Street, Inc. Terry, what is downtown MainStreet Inc. it's an organization nonprofit concert with the city of La Crosse to ensure ongoing economic development while cultivating a relentless downtown BMIs membership driven organization Terry so one of the benefits of becoming a member of downtown MainStreet Inc. I think all of this is realize that their low storefront filled with businesses that the downtown community is much more vibrant and that works for all businesses solicit selfish interest to be part of downtown because it does build traffic promotions and events that create some vitality in downtown La Crosse and with the election without something like downtown MainStreet personals initiatives forward Terry that's working with the other organizations in the community, absolutely Bob, we have developed a synergy group which includes the explore lacrosse and concert convention and visitors Bureau Chamber of Commerce seven rivers Velasco and ourselves know-how, common theme to improve and enhance the La Crosse area featuring different strengths to the table. I think were better together about working together and working together to the missions kind of overlap with each other enough uniqueness with our missions and our memberships that it does broaden the base of appeal to our members to see my have a vision statement or a mission statement derivations to promote the vibrant downtown… Businesses, braces, history sober sculpture captures the spirit of community while enhancing the vitality of the entire region, which is probably what we are grouped together and that synergy group because we want to include the entire region in our marketing. A lot of our business here is certainly local in the tourist business that we do get this kind of icing on the cake tour businesses. We really need to get people living within 50 miles of lacrosse coming into lacrosse to shop dying and stay in hotels people enjoy walking around historic downtown La Crosse County talk where members Terry talk about investors rather than members and membership why you do that way. Why are they investors rather than members. I think words have meanings and is an investor, you have ownership part of the solution when you put in the downtown MainStreet and my investment is to generate a return for me so that's kind of the challenge that were faced with those following and going that investment return to those people that through our marketing efforts are events or promotions, just creating activity in downtown La Crosse. I want to see all our storefronts don't know the significant growth that have all storefronts don't to drive additional new business in the downtown La Crosse to get a hold of DMI number 608784 0440 784-0440 the website of La Crosse downtown.com ridiculous social media search for downtown MainStreet Inc. and get files on Facebook downtown is a place you want to be when you shop one live, work, play with a lot of unique shots downtown that you'll find anywhere else on the cross. Enjoy]]>https://api.spreaker.com/episode/43227846Mon, 01 Feb 2021 14:23:37 +0000Produced by Podcast For HireDowntown Main Street DMI 422 Main Street La Crosse, Wisconsin 54601 (608) 784-0440 Transcription for SEO only. A new Location and a new Executive Director DMI a.k.a. downtown MainStreet Inc. lacrosse is moving in the right direction with Terry...DMI
422 Main Street
La Crosse, Wisconsin
54601
(608) 784-0440

Transcription for SEO only. A new Location and a new Executive Director DMI a.k.a. downtown MainStreet Inc. lacrosse is moving in the right direction with Terry Bauer the new Executive Director for downtown Main Street, Inc. Terry, what is downtown MainStreet Inc. it's an organization nonprofit concert with the city of La Crosse to ensure ongoing economic development while cultivating a relentless downtown BMIs membership driven organization Terry so one of the benefits of becoming a member of downtown MainStreet Inc. I think all of this is realize that their low storefront filled with businesses that the downtown community is much more vibrant and that works for all businesses solicit selfish interest to be part of downtown because it does build traffic promotions and events that create some vitality in downtown La Crosse and with the election without something like downtown MainStreet personals initiatives forward Terry that's working with the other organizations in the community, absolutely Bob, we have developed a synergy group which includes the explore lacrosse and concert convention and visitors Bureau Chamber of Commerce seven rivers Velasco and ourselves know-how, common theme to improve and enhance the La Crosse area featuring different strengths to the table. I think were better together about working together and working together to the missions kind of overlap with each other enough uniqueness with our missions and our memberships that it does broaden the base of appeal to our members to see my have a vision statement or a mission statement derivations to promote the vibrant downtown… Businesses, braces, history sober sculpture captures the spirit of community while enhancing the vitality of the entire region, which is probably what we are grouped together and that synergy group because we want to include the entire region in our marketing. A lot of our business here is certainly local in the tourist business that we do get this kind of icing on the cake tour businesses. We really need to get people living within 50 miles of lacrosse coming into lacrosse to shop dying and stay in hotels people enjoy walking around historic downtown La Crosse County talk where members Terry talk about investors rather than members and membership why you do that way. Why are they investors rather than members. I think words have meanings and is an investor, you have ownership part of the solution when you put in the downtown MainStreet and my investment is to generate a return for me so that's kind of the challenge that were faced with those following and going that investment return to those people that through our marketing efforts are events or promotions, just creating activity in downtown La Crosse. I want to see all our storefronts don't know the significant growth that have all storefronts don't to drive additional new business in the downtown La Crosse to get a hold of DMI number 608784 0440 784-0440 the website of La Crosse downtown.com ridiculous social media search for downtown MainStreet Inc. and get files on Facebook downtown is a place you want to be when you shop one live, work, play with a lot of unique shots downtown that you'll find anywhere else on the cross. Enjoy]]>226bauer,downtown,eat,historic,investors,lacrosse,live,main,mainstreet,member,mission,mississippi,parks,play,river,stay,street,terry,wisconsin,workfalsefullhttps://www.spreaker.com/episode/e4-healthfirst-effects-of-reproductive-health--42828698216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Jesse Scharfenberg CEO of health first network talking about how reproductive health affects other areas of health and why is health first network essential we provide reproductive health care and there's many people that would probably argue that reproductive health care isn't essential, but your whole body is connected from head to toe. So each system is so important have to jump in analysis of what how can it not be essential. I thought I heard a lot of the bigger hospitals suffered, turn people away from you know testing in birth control and seeing patients when you're at home alone. I'm just to say that what you doing right and that's really interesting. We've heard that we seem kinds of action had an increase in client caseload right now. During the Covid pandemic because individuals are being seen health systems for reproductive healthcare because there was certain subsets of services at health systems that were deemed nonessential and when I heard this and I was thinking unlike how is reproductive healthcare nonessential. It is such an essential part of your body. It controls pregnancy and controls STI there's UTIs. So it is some of the system is known as TI and UTI and STB and all the stuff what it would've yeah sorry I like to use alphabet soup last thing that is lying me out and that STDs were sexually transmitted diseases and then back in 2015 2016 timeframe, the Centers for Disease Control and Prevention changed it to STI which is sexually transmitted so that the same thing the same thing that STD STI is definitely interchangeable. We try to go with the new nomenclature of the STI so that we are in line with what the Centers for Disease Control and Prevention are utilizing UTI is a urinary tract infection. So a lot of individuals may confuse that they have been STI but it could be a UTI or someone may think they have a UTI and is actually nasty so bring those individuals in for testing and treatment is super super important. So infections can travel. So it's really important that we are having and performing STI testing on a normal basis. One of the big things that we do is screenings for cancer health first when you thinking about breast cancer we do clinical breast exams all the time, was sometimes the first line of defense of identifying some sort of nodule that were to refer an individual out for mammogram we do pass in politics after a Pap smear, an individual may have been identified that they have cancer cells of the next things that we can do here is actually doing a cervical biopsy to identify what's going on in referring an individual out. It's really unfortunate that individuals would think reproductive health is essential in that education around reproductive health is not essential because a lot of these things that we see we could prevent there's so many essays that could be prevented if an individual just knew how to prevent it. So let's use a condom. Let's practice safe sacs. We offer the HPV vaccine which is human papilloma virus that something that's in controversy over the past 10 years. I don't understand why Dixon is the only vaccine out there that prevents cancer and at that it prevents nine strains of the most common cancer causing strains of HPV cancer is given to both boys and girls in humans about Boys and Girls Club and which was really really cool last year we actually changed the age range, so it used to be €11-€26 and now 27 to 45-year-olds can receive the vaccine as well so working and continue to prevent cancer in individuals who are already sexually active as well. How can that be nonessential. I don't know. It was really interesting when this came out there was a lot of reproductive health clinics that can put services just on hold. I took an initiative and worked with you to perceive Wisconsin collaborative for reproductive health. The Wisconsin contraceptive access network and then Wisconsin family-planning reproductive health Association, which I serve as president for and said hey we need to put something out there to let individuals know that reproductive healthcare is an essential service. Individuals should have the choice of when they want to become pregnant, they should have the choice to go in for STI testing if they are sexually active. We know during this timeframe. Individuals are not ceasing sexual activity. So let's give them the tools to do it safely. Whether that be condoms and whether that be education or let them choose when they want to become pregnant by letting them properly space pregnancies or just prevent pregnancy with a contraceptive method. One of the things that kind of has his big black cloud over is the word abortion. Abortion is not something we do at health first. My personal mission is that an individual should never be in the position to have to make the choice as to whether they have an abortion or not, because we should be preventing every single pregnancy that wants to be prevented education having conversation with your staff over the last few hours today but I've learned quite a bit. Do offer educational services. We do we accept quite a few different educational services and we continue to look at expanding those we going to schools and give many presentations around, pregnancy prevention, contraception, and then STI prevention so that individuals know what. STI's are. They know that if you can be sexually active, you may become pregnant and how do you prevent that we give community presentations. We've instituted a really awesome curriculum in the Adams Friendship school district. It's called top the teen outreach program and it's really about building self-esteem and then talking about sexual health. On top of that, so we want to give them a good base at the sixth grade level to hopefully prevent some of those unintended pregnancies and STI rates that we are seeing in Adams so we provide a lot of education around that we have individuals that just come in for education and they may not be coming in at all for reproductive hands-on services, but just education. We have another really cool partnership down in Adams Friendship. It's called the diversion program so we know that individuals once they are in the juvenile justice system, they're more likely to be repeat offenders and continue to have charges that become worse and worse and worse. So our goal is to keep individuals out of the juvenile justice system and in that county. We were seeing a lot of young individuals being referred over to the DA for consensual sex acts. So maybe it was 215-year-olds having sex. Maybe they were texting pictures to each other. Our goal is, whether it be the district attorney's social services. The school or local police department identifies that and they actually refer the individual over to us for consequence education. So taking the educational route versus a prosecution route with those individuals and we have the school Health and Human Services local Sheriff's Department local police department. The DA everybody's involved in what we do with this huge prevention aspect of we have these kiddos there identified go over education with them once they refer to us. We have the local women's shelter come in and provide healthy relationship education and then when that charge actually goes across the DA's desk. The DA can see that they actually went through the educational session and most likely are going to pursue charges to put them into the juvenile justice system]]>https://api.spreaker.com/episode/42828698Thu, 07 Jan 2021 15:32:02 +0000Produced by Podcast For HireHealhFirst Network 216 South 3rd Avenue Wausau, WI 54401 (800) 246-5743 Jesse Scharfenberg CEO of health first network talking about how reproductive health affects other areas of health and why is health first network essential we provide...216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Jesse Scharfenberg CEO of health first network talking about how reproductive health affects other areas of health and why is health first network essential we provide reproductive health care and there's many people that would probably argue that reproductive health care isn't essential, but your whole body is connected from head to toe. So each system is so important have to jump in analysis of what how can it not be essential. I thought I heard a lot of the bigger hospitals suffered, turn people away from you know testing in birth control and seeing patients when you're at home alone. I'm just to say that what you doing right and that's really interesting. We've heard that we seem kinds of action had an increase in client caseload right now. During the Covid pandemic because individuals are being seen health systems for reproductive healthcare because there was certain subsets of services at health systems that were deemed nonessential and when I heard this and I was thinking unlike how is reproductive healthcare nonessential. It is such an essential part of your body. It controls pregnancy and controls STI there's UTIs. So it is some of the system is known as TI and UTI and STB and all the stuff what it would've yeah sorry I like to use alphabet soup last thing that is lying me out and that STDs were sexually transmitted diseases and then back in 2015 2016 timeframe, the Centers for Disease Control and Prevention changed it to STI which is sexually transmitted so that the same thing the same thing that STD STI is definitely interchangeable. We try to go with the new nomenclature of the STI so that we are in line with what the Centers for Disease Control and Prevention are utilizing UTI is a urinary tract infection. So a lot of individuals may confuse that they have been STI but it could be a UTI or someone may think they have a UTI and is actually nasty so bring those individuals in for testing and treatment is super super important. So infections can travel. So it's really important that we are having and performing STI testing on a normal basis. One of the big things that we do is screenings for cancer health first when you thinking about breast cancer we do clinical breast exams all the time, was sometimes the first line of defense of identifying some sort of nodule that were to refer an individual out for mammogram we do pass in politics after a Pap smear, an individual may have been identified that they have cancer cells of the next things that we can do here is actually doing a cervical biopsy to identify what's going on in referring an individual out. It's really unfortunate that individuals would think reproductive health is essential in that education around reproductive health is not essential because a lot of these things that we see we could prevent there's so many essays that could be prevented if an individual just knew how to prevent it. So let's use a condom. Let's practice safe sacs. We offer the HPV vaccine which is human papilloma virus that something that's in controversy over the past 10 years. I don't understand why Dixon is the only vaccine out there that prevents cancer and at that it prevents nine strains of the most common cancer causing strains of HPV cancer is given to both boys and girls in humans about Boys and Girls Club and which was really really cool last year we actually changed the age range, so it used to be €11-€26 and now 27 to 45-year-olds can receive the vaccine as well so working and continue to prevent cancer in individuals who are already sexually active as well. How can that be nonessential. I don't know. It was really interesting when this came out there was a lot of reproductive health clinics that can put services just on hold. I took an initiative and worked with you to perceive Wisconsin collaborative for reproductive health. The Wisconsin contraceptive access network and...]]>441assistance,care,checkups,children,health,healthfirst,healthy,low-income,nutrition,options,pill,pregnancy,reproductive,safety,sex,wausau,wisconsin,womenfalsefullhttps://www.spreaker.com/episode/e12-city-of-la-crosse-mayor-kabat--42488555www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

The city vision 2020 podcast we started this thing off back in January 2020 and were already at December 2020. My first guest in this podcast was Mayor Tim Kabat and my final guest in this podcast for city vision 2020 is Mayor Kabat Mayor this year was kind of a cluster and he will challenge great when it was a challenge for all of that and made no looking back on January 2020. That seemed like that was about 10 years ago already like this year's particularly long and particularly challenging in a notary lot of folks that have shared with me that they're happy to see that the next year. All the challenge and in many ways and very, very difficult. I've been pleased and proud of how our community has responded to the most part and just people we can help people receive a lot of shop local efforts to help our merchants and just a lot of giving in and trying to be there for each other so that that part of it is obviously very positive and surprised me because I know that lacrosse community is about stealth and very very difficult in your heart goes out to those that have lost jobs and all that are struggling right now. Mary asking about Covid 19 and then the coronavirus at one time this past year lacrosse was in the national spotlight for being one of the places that had some of the most outbreaks in the in the country. What what was done to stop that spread you right we were in the muddy list of the stars being one of those hotspots in the entire country, and that's not where you want to be that the combination of people returning to school and unfortunately most of that community spread impacted not only the schools but then also our assisted-living and long-term care facilities. That was really a bad thing. There was and there has been really all throughout this especially around that time, you know, ramping up the communication, and context of those institutions that really trying to get people to do the right thing, which is to stay home and to wear a mask if you go out and do the social distancing of the good hygiene, so the collective group between the healthcare providers in the county health department and ourselves and other institutions really increase that level of communication that the universities also increase their level of testing. So they were really trying to identify their their young people and their students that that might be positive and the contact tracing as well that the county has been doing really trying to charge people and let them know if they've been exposed to in close contact with someone so those efforts have been that they set on going but they were really ramped up around the fall and you know those universities that can things were quarantined and and going more virtually their classes which also help being the mayor and then this time of Covid and seeing businesses shutter and shut down for a while and some have gone out of business that way on you man are not taking things personally because we do see a business or or you will find what the pros build and scale up in the storefront really is hard to not take this personally and unfortunately we lost some thing else and long-standing businesses here to this whole thing in, we did respond to the city again in the area were we really did try to do whatever we could resources we have available to provide grants to our local businesses. The program back in April named their we down to through our own efforts on that map to any care spending your federal stimulus but through our own efforts. We distributed close to half $1 million to about 80 businesses to try to help them out. And no, there are many of those that are still in business, but the challenging the committee's frustration is that we receive the businesses we see are our friends and neighbors who might be struggling will make them right off and the health really has to come from the level in that first round of stimulus checks and the Malones and in the PPP support the government provided to businesses again back in April and May was very positive and needed. It's just unfortunate that that will get you know there wasn't anything there hasn't been anything else sense and that really where needed it throughout the summer and fall now into winter to think that people can survive on all $1200 support back in April and make that last year or sketch that out to the whole year is that's just not possible in the same goes for the business support site we've been working hard to not only try to support our local and also to reach out to our federal and state partners to encourage them to morning were still hopeful that maybe will be something done to you in the next month or so that can help people in O'Mara looking back this year there hasn't been any playbook or anything in history that we could've compared this to Rosalie thing on the front lines being in a part of the decision-making to help out. The city will we be treated this as an you still treating it as a community emergency so we established our emergency management protocols back in late March, which is really a different way he goes about communicating and organizing itself so the organization you know being able to respond to not only to continue to provide our services. So we spent the year still doing all of the essential things, providing safe water and taking care of people's waste and garbage and recycling and having our public safety be a priority in an emergency response and no still fixed in the streets until you those things so be modified somewhat the approach and how we communicating within the department. You can think of been very positive because I don't believe are residents of the really missed a beat and how we have provided those services and then then the other part of that was the partnering and will work with those I mentioned earlier healthcare providers are county health department are businesses to really try to encourage and support them and slowing the spread of Covid 19 some cases the notes and positive and successful. In other cases, as you mentioned earlier will now number one in the country hotspot and still continue to have high case numbers not gone as well so you know that, coupled with trying to provide grants for businesses to keep them going in and partnering with our nonprofit provide assistance in trying to prevent conviction. It has been below the there's been challenges almost on every front and we have responded pretty well, but it'll be interesting to see take a step back a year or two from now and really analyze what worked and what didn't do that to care for the Mexican community emergency that might come along in O'Mara's we have this last conversation for the 2020 vision podcast. I want to bring up some of the nice things and some of the good things the city is done like the fixing up of a lot of the roads there's a lot of stuff that happened at the different parks there's been you know the movement downtown with the La Crosse Center. I mean there's a lot of great things that happen this year as well and I think we have been all in all considered. We still maintain are those services and need to get that close libraries and we closed parks and beaches in our swimming pools and some of those things which were a disappointment to our our residents that we also expanded and added more miles of trails this year so people have the opportunity to get out more areas of the city on our trail network which I think is really phenomenal and like you mentioned are very significant renovation and expansion of La Crosse in the downtown is moving forward to be a beautiful addition that this guy lying in and we connection to the park and the river is spectacular and people are very excited to see that any of the other the other projects in an effort to will working on just again taking care of the business. The I will be breaking ground in the new fire station on the north side early next year on the road work in trying to just be the thing that people expect you know what their hard earned dollars in the pot contact that they pay trying to meet those expectations and I think no, all things considered, to get a good job this year, give or take away or get good memory. Good thought about 2027 or later or lead to an earlier that's just how people in our area have come together and there's been a number of separate to raise money for local businesses before you can about the marketing of topping local and just reinforcing how important it is that our our dollars stay here in the community have been very pleased and impressed with how many people I see on social media and no talking and communicating with people around around the city just that Patrick is been really pleasing to you and and and am hopeful that some businesses going during this very difficult times. I think that's probably the biggest thing is yes. 2020 think for everyone. Probably not on their top 10 list of favorite gears, but I think that the community response and somebody is trying to get through a shows how how resilient crosses and in the meanwhile look forward to brighter days ahead to share you know when we started this podcast were talking about looking at 2020 is that it is a great year. What did you want to get accomplished this year. That didn't happen. I would question that there's probably a few of the of the projects that just get longer you will be will delayed a little bit because of the need to respond to Covid I think about the Riverpoint district that still moving forward. I think that was delayed a little bit because of Covid]]>https://api.spreaker.com/episode/42488555Tue, 15 Dec 2020 18:00:11 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com The city vision 2020 podcast we started...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

The city vision 2020 podcast we started this thing off back in January 2020 and were already at December 2020. My first guest in this podcast was Mayor Tim Kabat and my final guest in this podcast for city vision 2020 is Mayor Kabat Mayor this year was kind of a cluster and he will challenge great when it was a challenge for all of that and made no looking back on January 2020. That seemed like that was about 10 years ago already like this year's particularly long and particularly challenging in a notary lot of folks that have shared with me that they're happy to see that the next year. All the challenge and in many ways and very, very difficult. I've been pleased and proud of how our community has responded to the most part and just people we can help people receive a lot of shop local efforts to help our merchants and just a lot of giving in and trying to be there for each other so that that part of it is obviously very positive and surprised me because I know that lacrosse community is about stealth and very very difficult in your heart goes out to those that have lost jobs and all that are struggling right now. Mary asking about Covid 19 and then the coronavirus at one time this past year lacrosse was in the national spotlight for being one of the places that had some of the most outbreaks in the in the country. What what was done to stop that spread you right we were in the muddy list of the stars being one of those hotspots in the entire country, and that's not where you want to be that the combination of people returning to school and unfortunately most of that community spread impacted not only the schools but then also our assisted-living and long-term care facilities. That was really a bad thing. There was and there has been really all throughout this especially around that time, you know, ramping up the communication, and context of those institutions that really trying to get people to do the right thing, which is to stay home and to wear a mask if you go out and do the social distancing of the good hygiene, so the collective group between the healthcare providers in the county health department and ourselves and other institutions really increase that level of communication that the universities also increase their level of testing. So they were really trying to identify their their young people and their students that that might be positive and the contact tracing as well that the county has been doing really trying to charge people and let them know if they've been exposed to in close contact with someone so those efforts have been that they set on going but they were really ramped up around the fall and you know those universities that can things were quarantined and and going more virtually their classes which also help being the mayor and then this time of Covid and seeing businesses shutter and shut down for a while and some have gone out of business that way on you man are not taking things personally because we do see a business or or you will find what the pros build and scale up in the storefront really is hard to not take this personally and unfortunately we lost some thing else and long-standing businesses here to this whole thing in, we did respond to the city again in the area were we really did try to do whatever we could resources we have available to provide grants to our local businesses. The program back in April named their we down to through our own efforts on that map to any care spending your federal stimulus but through our own efforts. We distributed close to half $1 million to about 80 businesses to try to help them out. And no, there are many of those that are still in business, but the challenging the...]]>8372020,2021,budget,business,city,cityvision,covid,covid-19,infomation,kabat,lacrosse,lacrossewisconsin,mayor,podcast,safety,shelter,tim,virus,vision,wisconsinfalsefullhttps://www.spreaker.com/episode/e3-healthfirst-what-is-wic--42280893216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription is for SEO purposes only

From expectations to conversations. We offer all the services you would expect health first network provides quality confidential reproductive health care, education, and nutrition counseling care and what made you decide you want to get into WIC just like public health, public health nutrition is really where I as a dietitian because all the counselors are dietitians, public health nutrition is something where you can really see the impact of what you do, didn't even realize there is any motion on that note to school. One of the cool things about the WIC program is that you get to see kids grow and develop over the course of time as a dietitian in the hospital or clinic settings you see people one or two times and you don't get to develop that relationship with the families like we do here WIC stands for women infant and children and WIC is a supplemental food and nutrition program for pregnant moms new moms and young children where families meet certain qualifying criteria to be eligible for the program once they're determined to be eligible, besides getting a lot of nutrition education and support we provide supplemental food, healthy supplemental foods like juice, cereal, eggs, peanut butter, milk and assortment of things and a lot of nutrition education and breast-feeding support as well as referrals and information about other resources within the community that might benefit that family. I know the education side of it is pretty amazing. I don't usually show this but when my twins are born, we participated in work we were able to live and stay in her house and you know because you we are twins and having twins on top of two other children, you know it was it was a big expense and to have WIC there to help out was a godsend was life saving your example is in exactly the kind of family that we really really want to try to help the difference between WIC and some of the other supplemental programs like food share is that our income cut off goes quite a bit higher then the other programs that are out there and so were really designed to help those struggling young families where you working but maybe child care expenses has exceeded what it's worth, and so you choose to have one parent stay home will then how do you get groceries and how do you pay your bills and the benefit that the families receive per person. It's roughly right around $70 for a child durum woman that they received. If you were to purchase all the foods that you're able to for a babysitter getting formula that's over $100 a month per child. It's a supplemental program but it adds up. And if we can help families get their basics then their resources can go to pay for other bills like diapers or gas in the car or electric bills or things like that that don't go away just because you'd one parent decided to stay home and what kind of items does WIC provide two-family good question. If you're a pregnant woman. Let's use that as an example, you would receive a quantity of food per month or you would be able to purchase that in the grocery store you would get 5 1/2 gallons of milk, a dozen eggs three containers of juice, a jar of peanut butter, a pound of dried beans or four cans of the dried beans that are cooked a loaf of bread 36 ounces of cereal now. We can also provide for people that want we can substitute out. We can provide some yogurt in place of some of the milk and cheese is another choice. If you're a child you get the same types of foods only a little different quantities babies are able to get those that are not breast-fed, or those that are getting supplemental formula. So say a mom is breast-feeding but she works out and is enabled to save enough of her milk that her baby is able to get enough to eat. Then we can be flexible and we provide some Formula One amount still get some benefits after the baby turns six months they're able to get some baby foods and then infant cereals as well. The foods that families are allowed to purchase from us. What happens is we have a very strict guideline that the USDA has set for us to provide nutrients for our families and every three years. All the foods that are available in the grocery store get looked at to see if they would qualify to meet our standards. Like for example the cereals that you can get from us are cereals that have to have a lot of iron in them. Not much sugar in them and be whole-grain if you think about examples of that. That would be something not like Lucky charms or Froot Loops. We also are able to provide fruits and vegetables for families. We give the dollar amount per month per individual. So if you're a child you get nine dollars worth of fruits and vegetables a month and women get $11 worth of fruits and vegetables a month so you can get any in the fruits and vegetables can be fresh but as you know how are growing season is so short in the middle of winter. You may not want to buy all fresh because they just don't taste so good then but so you can get fresh frozen or canned plain fruits and vegetables with your WIC benefit, and that's on the standard WIC now in the summer we do something really cool. We are able to provide farmer market checks for our families and what that is is in the summer, we provide per family $30 worth of the special farmer market checks. They take those to the local farmers market and purchase Wisconsin room fruits and vegetables get our organization on Monday afternoons in our parking lot. We have a farmers market, so it's a really neat connection where families can come if they happen to come on Monday afternoon to pick up the farmer market checks they can go right into our parking lot and purchase fruits that are grown here in Wisconsin that's instant gratification. Fiber is so cool. It is just so cool that we have this going now and families they that utilize the farmer market checks just love them so that age group for workers from birth to five till five. The history behind the five-year-old cut off is kinda interesting in that WIC program was designed in the late 60s early 70s when our country had a surplus of commodities and we had people who were hungry and there was a neat thought, where if you combine the commodities the farm commodities so flower dairy products things like that that the government was paying to help farmers produce and get them into the bellies of people who were hungry and coordinate that with some nutrition education. The thought was that we would provide these foods until kids were five and it five years old. Kids would go to kindergarten and through the school lunch program. They would then also be provided with the healthy food combinations through the school program. So that's why the five-year-old cut off was implemented. When does the client begin with WIC as soon as a mom finds out she's pregnant they can enroll with us. We want to help them throughout their pregnancy. So we see moms every three months throughout the pregnancy and help them deal with whatever the pregnancy presents for them whether they are they have morning sickness real bad there again and not to wait or not enough helping them figure out how to eat is best they can, even their life circumstances. Another thing that we do is help moms with stop smoking referrals to other programs within our community that help them eliminate barriers to being healthy through different resources that are available in the community to talk a little bit about the fact that WIC offers help to families to go out and purchase things what about families who choose to breast-feed. You have programs or do you help new moms to families without yes yes, that is one of our primary emphasis is to help moms be successful with that. So when we see moms when they're pregnant were helping them answer questions they have about how to feed your baby no matter what way they choose to feed their baby, their options galore today. We want moms to be successful with their breast-feeding efforts and so all of the counselors have extra training in breast-feeding support. We continually go for extra trainings to help us be better at that because we want moms to be successfully. For more information visit www.health1network.org or find us on social media health first network]]>https://api.spreaker.com/episode/42280893Wed, 02 Dec 2020 16:50:09 +0000Produced by Podcast For HireHealhFirst Network 216 South 3rd Avenue Wausau, WI 54401 (800) 246-5743 Transcription is for SEO purposes only From expectations to conversations. We offer all the services you would expect health first network provides quality confidential...216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription is for SEO purposes only

From expectations to conversations. We offer all the services you would expect health first network provides quality confidential reproductive health care, education, and nutrition counseling care and what made you decide you want to get into WIC just like public health, public health nutrition is really where I as a dietitian because all the counselors are dietitians, public health nutrition is something where you can really see the impact of what you do, didn't even realize there is any motion on that note to school. One of the cool things about the WIC program is that you get to see kids grow and develop over the course of time as a dietitian in the hospital or clinic settings you see people one or two times and you don't get to develop that relationship with the families like we do here WIC stands for women infant and children and WIC is a supplemental food and nutrition program for pregnant moms new moms and young children where families meet certain qualifying criteria to be eligible for the program once they're determined to be eligible, besides getting a lot of nutrition education and support we provide supplemental food, healthy supplemental foods like juice, cereal, eggs, peanut butter, milk and assortment of things and a lot of nutrition education and breast-feeding support as well as referrals and information about other resources within the community that might benefit that family. I know the education side of it is pretty amazing. I don't usually show this but when my twins are born, we participated in work we were able to live and stay in her house and you know because you we are twins and having twins on top of two other children, you know it was it was a big expense and to have WIC there to help out was a godsend was life saving your example is in exactly the kind of family that we really really want to try to help the difference between WIC and some of the other supplemental programs like food share is that our income cut off goes quite a bit higher then the other programs that are out there and so were really designed to help those struggling young families where you working but maybe child care expenses has exceeded what it's worth, and so you choose to have one parent stay home will then how do you get groceries and how do you pay your bills and the benefit that the families receive per person. It's roughly right around $70 for a child durum woman that they received. If you were to purchase all the foods that you're able to for a babysitter getting formula that's over $100 a month per child. It's a supplemental program but it adds up. And if we can help families get their basics then their resources can go to pay for other bills like diapers or gas in the car or electric bills or things like that that don't go away just because you'd one parent decided to stay home and what kind of items does WIC provide two-family good question. If you're a pregnant woman. Let's use that as an example, you would receive a quantity of food per month or you would be able to purchase that in the grocery store you would get 5 1/2 gallons of milk, a dozen eggs three containers of juice, a jar of peanut butter, a pound of dried beans or four cans of the dried beans that are cooked a loaf of bread 36 ounces of cereal now. We can also provide for people that want we can substitute out. We can provide some yogurt in place of some of the milk and cheese is another choice. If you're a child you get the same types of foods only a little different quantities babies are able to get those that are not breast-fed, or those that are getting supplemental formula. So say a mom is breast-feeding but she works out and is enabled to save enough of her milk that her baby is able to get enough to eat. Then we can be flexible and we provide some Formula One amount still get some benefits after the...]]>575assistance,care,checkups,children,first,food,health,healthfirst,healthy,infant,low-income,nutrition,pregnancy,reproductive,vegetable,wausau,wic,wisconsin,womenfalsefullhttps://www.spreaker.com/episode/e21-chris-jones-1-word-fatherhood-covid--42039304https://api.spreaker.com/episode/42039304Wed, 18 Nov 2020 15:56:40 +0000Produced by Podcast For HireChris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The...6421word,baby,bswithbob,chris,communication,covid,dad,daughter,dontdropthebaby,fatherhood,hypnotist,jones,justtalking,listening,lives,microcast,oneword,staywoke,zoomfalsefullhttps://www.spreaker.com/episode/e11-city-of-la-crosse-jared-flick-park-rec-forestery--41975642www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

La Crosse Wisconsin is a great place to live, work and play the city vision 2020 podcast this month featuring Jared Flick recreation specialist from La Crosse Park recreation forestry Jared a lot of things stopped this year because of Covid-19. Let's talk a little bit about Covid-19 and will can move on to some other things. How did the city of La Crosse Park and rec deal with Covid-19 and what are things moving forward when it comes to dealing with Covid-19 why things happen. We had outright programming it canceled. We lost our aquatics needs and we also thought how important parts are the people we saw a flurry of flooded people into the park this summer, which is great but short of a weakness that showed a lot of positive things that are out there really help the singles out there. The programming people is very difficult just because things start off with some restrictions as far as you want people to get together and we tried programming some things and we tried many baseball program. We had to cancel it now or try to be proactive with things that were doing as far as they could fall we ran track and soccer program athletic that is easy to social distance is less contact with you. Turn out that that never going to get you turn the page to winter here in Wisconsin. What are some of the things that the La Crosse Park and rec is going to be working on are doing in the winter season. Yet some of them are hoping that we would do would be like our basketball program for kids and that is something that we can't do this because access to facilities around the school district. Right now schools are closed so that way. So will try to focus on things that we can kind of control would get people outside correctly starting hiking program for kids highly structured setting go out and move around as an exercise in kind of time to help improve their overall really doing that we have a figure skating program or another were doing over the Green Island ice arena and then we can focus on more stuff that we can outside the work we were working with thought about running with you from Bali over a Copeland something to get people out and move around and motivated your dimension Green Island in early Green Island was a big in the news at the beginning of the year that staying open now right and there's new facilities happening there as well. It is yes, that the arena itself is open, the River city youth hockey organization that didn't do a six-month use agreement with the city, with operation of the facility. So it is often worse over up and out and they're doing everything they do a great job in there to get a lot of use over there right now a lot of construction happening in that area. Tennis courts happening. As a matter fact and that the and in that specific location right there. As we entered into agreement with UBL Aquinas and the tenants Association of La Crosse to build three of 13 brand-new outdoor tennis courts and the construction was completed in red on Labor Day so we did have a few months of having been opened and they then they been popular at the outset of our first phase to the construction out there with the tennis courts in phase 2 was in becoming an looking at some whites to the seven of the court. So we kind of expand the community access to the courts in the spring and fall file phase. Phase 3 would be coming probably in the next you know one to two years would be indoor course, that's all you to be raised privately we know about the organized groups of the tennis Association. There is a lot of like little sob popular groups about playing there's a lot of people and I was actually surprised because this last summer, especially Covid-19 and everything being shut down. My kids took up tennis and they're playing a wagon park at the tennis courts there. Yeah, all of the courts this summer got slammed whether they were the tennis courts and what we saw the really really heavy to be at Invesco court over a call and that things that Joseph is been bombarded with people everything a lot of people. It was an improvement over the Erickson festival course over a block you as well to that people are just think they need something to do and that's it. As her going sledding coming up in the upper Midwest. As always, you know that the thrill of going sledding. Is there any places in La Crosse to go sledding German poor so that is a very popular place. This led last year we started doing the pop-up letting nights where we bring lights out and people can play that night with hot chocolate fires like that were do more of that this year just trying to keep people out motivated sledding very popular. Where do something that we also got some other kind of ideas out there that were to try to do with letting actually learn to skate his or so learned skating times as well are now is that part of the hockey is a hockey Association on Valencia program now, so if you want to do the initiate programs I received. Hockey is doing that late summer early fall. There is some construction over depending on what happened over there yet we cannot restructure the parking lot you never really have like a road intersecting a parking lot to destinations is create a problem. We redesigned it will replace the parking lot up to the bathhouse and the beach and then we move the road behind it. That kind of our Facebook first phase of construction at tableware next year will actually raise the S. Table Dr., Road where you go from the bathhouse to the boat club. It tends to flood a lot back there and it floods that low level as well. Square way that the defendant just enhance that state and a lot of people put their kayaks in right there in front of were you rented out the kayaks and panel boards. Is that still going to be an option. We actually just finished some construction of that. Do we put a new paved walking way for people to feel user kayaks and a little better approach space to. So what are some flaws and blinking lights and some stuff to get others in your road that kind of intersect that but it should be a lot safer for people he saw that your was extremely busy for people to be watching kayaks and canoes and stuff over. They don't let it cool things happening with La Crosse Park recreation enforcer department chair and how we find out more information about all the fun things in all the excitement that's going on with the park and rec department can add to our Facebook page city La Crosse Park Receration for streamlining that to our website city La Crosse.org and that's/Park, telephone number area code 608-789-7533 their number 608-789-7533 the your vision 2020 conversations with department heads from the city of La Crosse is a podcastforhire.com production. For more information about the cross, visit the website city of La Crosse to work]]>https://api.spreaker.com/episode/41975642Sun, 15 Nov 2020 18:00:21 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com La Crosse Wisconsin is a great place to...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

La Crosse Wisconsin is a great place to live, work and play the city vision 2020 podcast this month featuring Jared Flick recreation specialist from La Crosse Park recreation forestry Jared a lot of things stopped this year because of Covid-19. Let's talk a little bit about Covid-19 and will can move on to some other things. How did the city of La Crosse Park and rec deal with Covid-19 and what are things moving forward when it comes to dealing with Covid-19 why things happen. We had outright programming it canceled. We lost our aquatics needs and we also thought how important parts are the people we saw a flurry of flooded people into the park this summer, which is great but short of a weakness that showed a lot of positive things that are out there really help the singles out there. The programming people is very difficult just because things start off with some restrictions as far as you want people to get together and we tried programming some things and we tried many baseball program. We had to cancel it now or try to be proactive with things that were doing as far as they could fall we ran track and soccer program athletic that is easy to social distance is less contact with you. Turn out that that never going to get you turn the page to winter here in Wisconsin. What are some of the things that the La Crosse Park and rec is going to be working on are doing in the winter season. Yet some of them are hoping that we would do would be like our basketball program for kids and that is something that we can't do this because access to facilities around the school district. Right now schools are closed so that way. So will try to focus on things that we can kind of control would get people outside correctly starting hiking program for kids highly structured setting go out and move around as an exercise in kind of time to help improve their overall really doing that we have a figure skating program or another were doing over the Green Island ice arena and then we can focus on more stuff that we can outside the work we were working with thought about running with you from Bali over a Copeland something to get people out and move around and motivated your dimension Green Island in early Green Island was a big in the news at the beginning of the year that staying open now right and there's new facilities happening there as well. It is yes, that the arena itself is open, the River city youth hockey organization that didn't do a six-month use agreement with the city, with operation of the facility. So it is often worse over up and out and they're doing everything they do a great job in there to get a lot of use over there right now a lot of construction happening in that area. Tennis courts happening. As a matter fact and that the and in that specific location right there. As we entered into agreement with UBL Aquinas and the tenants Association of La Crosse to build three of 13 brand-new outdoor tennis courts and the construction was completed in red on Labor Day so we did have a few months of having been opened and they then they been popular at the outset of our first phase to the construction out there with the tennis courts in phase 2 was in becoming an looking at some whites to the seven of the court. So we kind of expand the community access to the courts in the spring and fall file phase. Phase 3 would be coming probably in the next you know one to two years would be indoor course, that's all you to be raised privately we know about the organized groups of the tennis Association. There is a lot of like little sob popular groups about playing there's a lot of people and I was actually surprised because this last summer, especially Covid-19 and...]]>3672020,basketball,city,cityvision,forestry,hiking,ice,infomation,lacrosse,lacrossewisconsin,outdoor,park,podcast,public,rec,skating,sleding,tennis,vision,wisconsinfalsefullhttps://www.spreaker.com/episode/e2-healthfirst-what-are-the-services-at-healthfirst-network--41810924216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription is for seo purposes only

There are a lot of services that are provided at health first network Jesse, what are some of the things that you do we have the WIC program which is women, infants and children went to the nutrition education program and provide supplemental food benefits for moms that are pregnant, postpartum, and then children 0 to 5 years of age. We have the breast-feeding peer counseling program we have the for families program, which is an obesity prevention program for preschoolers. Then we the farmers market program within the WIC program so families who are on the WIC program are also qualified to receive a $30 fruit and vegetable voucher that can be used at local farmers markets during the summer and fall months so that they can go and get fresh fruits and that's both then if we change course and go into the reproductive health program the reproductive health program offers several services from annual exams FTI or STD testing for STI testing a sexually transmitted infection testing. It used to be called FTD, sexually-transmitted diseases, but that nomenclature has recently changed. We do, pregnancy testing, we do referrals for individuals who are pregnant to any resources that they may need, including the WIC program we provide contraceptive methods or birth control to individuals that come in with provide colposcopy's which are biopsies that the service for individual had abnormal paps. We also provide just general labs that an individual may want and then a lot of education around sexual health. Health versus the confidential reproductive health clinic that means individuals who come in, have confidential services, and that's not being shared anywhere else that we serve adults, but we also search for teenagers within the clinic and do some pretty great programming with teenagers outside of the clinic as well just interrogate you're in charge of the teams program yes so we do the teen outreach program, and we recently implemented that down in Adams friendship. So within the Adams Friendship school district. We work specifically with sixth-grade students implementing that program so teen outreach program is an evidence-based program that has a holistic approach to education. So it does focus on reproductive health, but also focuses on things such as decision-making, goalsetting, setting boundaries, healthy relationships, things of that nature. So really encompasses a lot more than just the reproductive health side, but were happy to be able to include that in there as well know it. With this education piece that you bring out of the schools and Adams friendship. Does that encompass both Boys and Girls Club yes we serve the entire sixth-grade class. So unless someone chooses to opt out our parent would choose to opt their child out of that that is just part of their curriculum. Now that we are implemented into the school day. When we serve those to finishing which success in the program yes so will last year was our first year implementing it. We saw really great success. The students are really engaged in that and there is a community service learning component to that as well so they get to be engaged within their community, which is a huge piece of that. We were caught a little bit short due to COBIT. 19. In talking with our funder is that when we met at the end of our first program year they had relayed to us that they thought really great results. We have a previous survey and post-survey that goes along with that were able to kind of track anonymously how the students have progressed, or what is change throughout the course of the year and then just being able to meet the criteria to make sure that were implementing the program correctly and we were on track with all of that to have a really successful year so I still talk that up as a success, even though we didn't get to see it quite through all the way to the end. Due to those unforeseen circumstances, any other type of outreach programs that you do. Yes. So we do a lot of education within the schools as well so we serve eight different counties and we actually have been in at least one school in each of those counties that we serve. So we go mostly into high schools. We do a little bit of education in some middle schools as well, but we are able to provide education. STI's are sexy transmitted infections and prevention of that and then we also discuss birth control methods and just kind of safer sex practices. We touch on consent some independent overall message of getting a comprehensive look at reproductive health education along with that, we did serve on the committee for human growth and development for the Wasit school district just to help kind of sure that their education again was not only comprehensive but to make sure that it's evidence-based and accurate information that's being provided to those students as well. And of course we make sure that we're providing that sort of education regardless of what school district were in or were serving. Have you thought about taking your curriculum that you're using for sixth-graders and taking that to some of the other counties that you cover yet so that is a potential in the future and we are hoping to do that down the road when there is the opportunity to do so. Currently, as if it were just in that Adams friendship school district at this point in time, but we do hope to spread that again in the future. There is a beginner and intermediate and advanced level to each of the lessons you can really tailor it to make sure that it's going to make sense for those students that you're serving at that point in time. Just it seems as though health first network is doing a ton of things. Is there anything that health first network doesn't do someone a large misconceptions and that communities that we serve is that where an abortion provider and that is not a service that we provide is not even the service that we refer for it something and that we are aiming to prevent through access to easy contraceptive services for individuals]]>https://api.spreaker.com/episode/41810924Thu, 05 Nov 2020 16:45:28 +0000Produced by Podcast For HireHealhFirst Network 216 South 3rd Avenue Wausau, WI 54401 (800) 246-5743 Transcription is for seo purposes only There are a lot of services that are provided at health first network Jesse, what are some of the things that you do we have the WIC...216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription is for seo purposes only

There are a lot of services that are provided at health first network Jesse, what are some of the things that you do we have the WIC program which is women, infants and children went to the nutrition education program and provide supplemental food benefits for moms that are pregnant, postpartum, and then children 0 to 5 years of age. We have the breast-feeding peer counseling program we have the for families program, which is an obesity prevention program for preschoolers. Then we the farmers market program within the WIC program so families who are on the WIC program are also qualified to receive a $30 fruit and vegetable voucher that can be used at local farmers markets during the summer and fall months so that they can go and get fresh fruits and that's both then if we change course and go into the reproductive health program the reproductive health program offers several services from annual exams FTI or STD testing for STI testing a sexually transmitted infection testing. It used to be called FTD, sexually-transmitted diseases, but that nomenclature has recently changed. We do, pregnancy testing, we do referrals for individuals who are pregnant to any resources that they may need, including the WIC program we provide contraceptive methods or birth control to individuals that come in with provide colposcopy's which are biopsies that the service for individual had abnormal paps. We also provide just general labs that an individual may want and then a lot of education around sexual health. Health versus the confidential reproductive health clinic that means individuals who come in, have confidential services, and that's not being shared anywhere else that we serve adults, but we also search for teenagers within the clinic and do some pretty great programming with teenagers outside of the clinic as well just interrogate you're in charge of the teams program yes so we do the teen outreach program, and we recently implemented that down in Adams friendship. So within the Adams Friendship school district. We work specifically with sixth-grade students implementing that program so teen outreach program is an evidence-based program that has a holistic approach to education. So it does focus on reproductive health, but also focuses on things such as decision-making, goalsetting, setting boundaries, healthy relationships, things of that nature. So really encompasses a lot more than just the reproductive health side, but were happy to be able to include that in there as well know it. With this education piece that you bring out of the schools and Adams friendship. Does that encompass both Boys and Girls Club yes we serve the entire sixth-grade class. So unless someone chooses to opt out our parent would choose to opt their child out of that that is just part of their curriculum. Now that we are implemented into the school day. When we serve those to finishing which success in the program yes so will last year was our first year implementing it. We saw really great success. The students are really engaged in that and there is a community service learning component to that as well so they get to be engaged within their community, which is a huge piece of that. We were caught a little bit short due to COBIT. 19. In talking with our funder is that when we met at the end of our first program year they had relayed to us that they thought really great results. We have a previous survey and post-survey that goes along with that were able to kind of track anonymously how the students have progressed, or what is change throughout the course of the year and then just being able to meet the criteria to make sure that were implementing the program correctly and we were on track with all of that to have a really successful year so I still talk that up as a success, even though we didn't get to see...]]>367assistance,care,checkups,first,health,healthfirst,healthy,income,low,network,pap,pregnancy,reproductive,schools,sti,testing,vaginal,wausau,wic,wisconsinfalsefullhttps://www.spreaker.com/episode/e10-city-of-la-crosse-adam-lorentz-mtu--41475808www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

The city vision 2020 podcasts this month featuring Adam Lorentz from the MTU Adam thanks for joining us again a lot of things happening with the MTU this year. I think with any department a lot of things happening. There's been some big impact to our services and then how we operate, but there's also some really good things happening. Well, let's talk about was positive with the MTU. We are actually awarded to additional buttons those buses came as part of the round two of the VW settlement which was a settlement that VW settled with the government for falsifying emission records and we were awarded to hybrid buses. The purpose of the VW mitigation was to take some old boxes that produce a lot of that carbon footprint. Heavy levels of fumes out the bus replace more efficient buses were really thankful that we were one of the year that were awarded to buses and after put our fleet up to 10 new buses by the end of next year. So 10 new buses coming in 2021 Adam what is that mean for the average writer in the city of La Crosse wanted just to be an easy riding on somebody's bus that we had were mundane back from 2001, 2002 and to get those off the road obviously anything new is better. Things like needed a ride can always send this now that the fumes that come from the box you know what the lowly mission titles uniting only minutes about anything with Erica on 1015 20 years ago where you know the joke was that there is a cloud of smoke coming out of the back of the buses, so it's really just user-friendliness of the buses you know some of our new buses are equipped with charging stations for USB charging all the buses now are equipped with an anti-out monitoring system. So the riders can see where the buses are in real time so that they know exactly if the buses can be there in one minute to answer the next buses need and 21 of the things I noticed in the last few years as more and more people are using the bike racks in the front of the buses are the new buses going to be equipped with those, absolutely. Yeah, you know we work with a lot of the local bike advocate groups around the Supercross and they always call us are. That last mile they call it where you know the bike rider you want the life of these great trails throughout the La Crosse but they can get from point a to point B to utilize them variable to use the MTU to get the last mile that the nation absolutely will be bike rack and all the people at diminished abilities to get on and off the buses there any help for that all the buses are ADA equipped so buses can lower light to the curb right to the ground and all the buses are equipped with the motorized ramp. So anybody has something mobility device. We can get them in their we also have securement stations and answer new buses are equipped with more efficient and safer securement stations are people that have such a motorized scooter or wheelchair ramp this your kid against the front of the box so I don't have to worry just not getting on the bus to one third line on the box. They can feel safe and now with their time. The nation think the speaking of safety and a lot of protocols in 2020. That is that in common and I see the bus drivers using them all the time with the masks and stuff do the riders have to wear masks as well when they're on the buses yeah yeah so as to before the government order. We were putting in. Where everybody had to wear a mask on the box and obviously are bus operators are required to the that's really just the tip of the iceberg of what was done here from faculty protocol we spoke last time. The kind of getting started with some of the items but you know me have a fog or any Mr. machine that each sanitize the buses every single day. We have new chemicals that are proven to kill not only the culprit but also the common fluid other types of viruses that our cleaning staff relentlessly goes over the buses. We have used utilize the back door as much as we can to try to stop that close proximity with the bus operators the passengers and talk about positive the vessel on the positives is that we were actually awarded there's money directly to us. The federal government, which allowed us now spent care for the rest the year. So what that does is two things. One is obviously not the interaction with the bus operators that keep that up for something also was handling of cash bears and passes that you don't want to do right now but really certainly it's allowing people that are maybe have been impacted by COBIT feel financially that they know that they don't have to worry about the bus pass at the bus there for that day and month and on all the midst of all the negativity I think that's one positive that's really set out that the MTU for their people in the now obviously there's a cost to a lot of the stuff. How to cite in the getting paid for was funded federally and through the state, then also there's some local share. So on the city La Crosse is a portion that's running contact communities of the Crescent Campbell and I'll have to double that goes into it, but that, but the main course of action are capital purchases such as the buses are equipped for the buses, really. The majority of our purchases are coming gently from federal or state ranked very little amount that is actually charged by PDW and the grant fees tend to buses all or part of a grant and out of our ABL system was part of it to what's the name of the city La Crosse MTU okay so I just researched city of La Crosse and to you one last question. I have Adam's work we find out about what's happening right now, so we really try to make a good effort to keep our website up-to-date kind of right to the city La Crosse not working right on the front page of the transit was also really had an increase on enter Facebook on so we do daily updates there in daily posting to find out that is across the MTU Facebook and then also our app so I talked about a mobile app which is free download for Apple or play or through iTunes and we do updated information on there as well. Really trying to make sure that people have that information. Right then and there is a post that you know back in a row had a newspaper posting now. People That the content and then lastly people that don't have access to those items that can give us a call here rally staff year can visit the fourth, Monday through Friday minutes, occasionally on Saturday morning so that you want to call it that 608-7973 50 will be something in the morning to get more]]>https://api.spreaker.com/episode/41475808Thu, 15 Oct 2020 14:03:29 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com The city vision 2020 podcasts this month...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

The city vision 2020 podcasts this month featuring Adam Lorentz from the MTU Adam thanks for joining us again a lot of things happening with the MTU this year. I think with any department a lot of things happening. There's been some big impact to our services and then how we operate, but there's also some really good things happening. Well, let's talk about was positive with the MTU. We are actually awarded to additional buttons those buses came as part of the round two of the VW settlement which was a settlement that VW settled with the government for falsifying emission records and we were awarded to hybrid buses. The purpose of the VW mitigation was to take some old boxes that produce a lot of that carbon footprint. Heavy levels of fumes out the bus replace more efficient buses were really thankful that we were one of the year that were awarded to buses and after put our fleet up to 10 new buses by the end of next year. So 10 new buses coming in 2021 Adam what is that mean for the average writer in the city of La Crosse wanted just to be an easy riding on somebody's bus that we had were mundane back from 2001, 2002 and to get those off the road obviously anything new is better. Things like needed a ride can always send this now that the fumes that come from the box you know what the lowly mission titles uniting only minutes about anything with Erica on 1015 20 years ago where you know the joke was that there is a cloud of smoke coming out of the back of the buses, so it's really just user-friendliness of the buses you know some of our new buses are equipped with charging stations for USB charging all the buses now are equipped with an anti-out monitoring system. So the riders can see where the buses are in real time so that they know exactly if the buses can be there in one minute to answer the next buses need and 21 of the things I noticed in the last few years as more and more people are using the bike racks in the front of the buses are the new buses going to be equipped with those, absolutely. Yeah, you know we work with a lot of the local bike advocate groups around the Supercross and they always call us are. That last mile they call it where you know the bike rider you want the life of these great trails throughout the La Crosse but they can get from point a to point B to utilize them variable to use the MTU to get the last mile that the nation absolutely will be bike rack and all the people at diminished abilities to get on and off the buses there any help for that all the buses are ADA equipped so buses can lower light to the curb right to the ground and all the buses are equipped with the motorized ramp. So anybody has something mobility device. We can get them in their we also have securement stations and answer new buses are equipped with more efficient and safer securement stations are people that have such a motorized scooter or wheelchair ramp this your kid against the front of the box so I don't have to worry just not getting on the bus to one third line on the box. They can feel safe and now with their time. The nation think the speaking of safety and a lot of protocols in 2020. That is that in common and I see the bus drivers using them all the time with the masks and stuff do the riders have to wear masks as well when they're on the buses yeah yeah so as to before the government order. We were putting in. Where everybody had to wear a mask on the box and obviously are bus operators are required to the that's really just the tip of the iceberg of what was done here from faculty protocol we spoke last time. The kind of getting started with some of the items but you know me have a fog or any Mr. machine that each sanitize the buses...]]>3632020,bus,business,city,cityvision,grant,infomation,lacrosse,lacrossewisconsin,mtu,podcast,public,ride,rider,ridership,safety,shelter,transportation,vision,wisconsinfalsefullhttps://www.spreaker.com/episode/e1-healthfirst-what-is-healthfirst-network--41263660216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription is for seo purposes only

Jesse Scharfenberg, the CEO of HealthFirst Network. Let's begin with what is health first network. We are a network of clinics throughout north-central Wisconsin that serves individuals usually have lower income with reproductive health services and then with services such as the women infant and children program is about first network for a long time hasn't so we are actually at 47 years old now, so we are created back in 1973 as family-planning health services of Marathon County and as the organization has grown. We went to just family-planning health services and then back in 2016. After I was hired part of my mission and part of coming to health first with developing them new mission bring us forward. So what health services were provided through reproductive health, 40 some years ago. It looks completely different than what healthcare looks like today. The goal is really to move us forward family-planning health services had a lot of negative connotation because some individuals don't like reproductive health services are family-planning services. So going with a more generic name such as health first. Also included are with programs so we were so focused individuals would call and that receptionist is a payment plan health services and some of that. Oh, I thought I was calling the WIC program now is this an individual calls and the answer HealthFirst Network. They understand that we are network of clinics and services that offer many different services, so it's not just reproductive health is not just wickets several service so why was family-planning health services of Marathon County started 40 years ago there was a need for reproductive health services that were affordable for individuals. I know what we charge for services compared to other health care entities in our area and I know what we charge for the specific services is way less than other healthcare entities charge were you see health first network in 510 years from now growing on that part of our strategic plan is to find areas that are deserts for reproductive health care and let's fill in those gaps. That's really what we do is fill gaps and provide access to individuals who don't have access to. So we are looking at the map and figuring out where contraceptive deserts are. That was a term that was new to me when I started 4 1/2 years ago, but there's criteria that considered a contraceptive desert that individuals don't have access to birth control. So how can we help fill those gaps. How can we put clinic locations strategically in areas that don't have access or partner with individuals who are already there to provide better access to the individuals who need services which are typical client depends on the program really so far reproductive health program individuals between 18 and 24 years of age. Usually females that are coming in. They don't have health insurance so we help set them up with health insurance and lower income when looking at the WIC program. I would say we have a wide range of age anywhere from them to 14 up to 45 years of age. Individuals coming in pregnancy or with children that are really struggling to feed their catalysts, and that's one of the great benefits of the WIC program. It is not only do we get by nutrition education for that we also get to provide supplemental food benefits to them on a monthly basis to help feed the kiddos. One of the really cool things about the WIC program compared to that say snapper the food stamps program is we only provide healthy foods so we know that the individuals that are leaving are going to get adequate amounts of calcium and protein in their diet versus just giving them a check and they can buy whatever they want you mission, but there's a different clinics do they have different focuses order. They all basically running the same type program yes. So they different clinics have pretty much the same focus, so our WIC program is only in three of our clinics which would be our Wausau laying late and Tomahawk clinics, and then in all eight of our clinics is reproductive health and the really cool thing about being a network of reproductive health clinics. It doesn't matter which clinic you go to you getting the same set of services. We have the same model of services you can contact in the same way. The nurse practitioners. That is, serve you in the same way is very prescriptive so that if an individual moves throughout the states which we do see a lot of individuals bouncing between clinics to getting the same services and is delivered in the same way. So when you say reproductive services. What is that mean to somebody that just wouldn't go so reproductive health is a conglomeration of different services. Whether it's annual exams. STI testing and treatments, pregnancy testing, contraceptive methods of birth control methods for individuals. One of the big focuses after I came was shifting a little bit from just reproductive health services to more of a preventative focused so, ensuring that individuals come in for those annual exams that they're having some of those general baseline labs drawn every year. The majority of our population doesn't go anywhere else for services. So if were only focusing on reproductive health. There is a pretty large percent of the person that were missing out on so really looking at the whole person care as well as the focus knows of something that's been part of the mission since you been here in the last four years. Results of this but the whole time knows that was part of the changes that were made after I came was to really look at the whole person versus just the very small focus of the reproductive health services only. So we've really looked at making sure that were having individuals come in for those annual exams. We seen a huge increase in male clients, which is great. Our men are coming in quite as frequently for the annual exams has we would like to see them by offering the services to both men and women is extremely important to the services. Are you offering to most of our men are only coming in for STI testing and treatment, but any man can come in for consult. We can do different labs for them. We can do an annual exam for them if they would like to come in, but our main population that we see or serve the 18 to 25 year old. We don't see a lot of men in general. Outside of even health first that are going in for those annual exams between 18 and 25 years and yet be within a certain guideline of income in order to come in now that's one of the best things as there is no income qualifications for the reproductive health program. Anyone with any insurance that they can't pay. If they don't have health insurance. Anyone can walk to the door and were going to serve them with a lot of different opportunities within the reproductive health program for an individual to come in, say, is an undocumented citizen and they don't have any source of income. We can put them on our sliding fee scale and if health is your pain. They don't have to pay for their services, but they can still get those super important services we have that group of individuals that are Wisconsin residents that make less than $20 an hour and we can sign them up for F because it is the family-planning only services waiver program. Part of Medicaid. It covers all of their services that 100%, but we can say have a doctor walk in from a different location and that wants confidential STI testing, but also has private health insurance. We can build that private health insurance as well so we have so many options for individuals of whether they have health insurance. They don't but we can sign them up for something or they just don't have a payer source at all and they don't have to pay for the services that they have]]>https://api.spreaker.com/episode/41263660Fri, 02 Oct 2020 17:07:11 +0000Produced by Podcast For HireHealhFirst Network 216 South 3rd Avenue Wausau, WI 54401 (800) 246-5743 Transcription is for seo purposes only Jesse Scharfenberg, the CEO of HealthFirst Network. Let's begin with what is health first network. We are a network of clinics throughout...216 South 3rd Avenue
Wausau, WI 54401
(800) 246-5743

Transcription is for seo purposes only

Jesse Scharfenberg, the CEO of HealthFirst Network. Let's begin with what is health first network. We are a network of clinics throughout north-central Wisconsin that serves individuals usually have lower income with reproductive health services and then with services such as the women infant and children program is about first network for a long time hasn't so we are actually at 47 years old now, so we are created back in 1973 as family-planning health services of Marathon County and as the organization has grown. We went to just family-planning health services and then back in 2016. After I was hired part of my mission and part of coming to health first with developing them new mission bring us forward. So what health services were provided through reproductive health, 40 some years ago. It looks completely different than what healthcare looks like today. The goal is really to move us forward family-planning health services had a lot of negative connotation because some individuals don't like reproductive health services are family-planning services. So going with a more generic name such as health first. Also included are with programs so we were so focused individuals would call and that receptionist is a payment plan health services and some of that. Oh, I thought I was calling the WIC program now is this an individual calls and the answer HealthFirst Network. They understand that we are network of clinics and services that offer many different services, so it's not just reproductive health is not just wickets several service so why was family-planning health services of Marathon County started 40 years ago there was a need for reproductive health services that were affordable for individuals. I know what we charge for services compared to other health care entities in our area and I know what we charge for the specific services is way less than other healthcare entities charge were you see health first network in 510 years from now growing on that part of our strategic plan is to find areas that are deserts for reproductive health care and let's fill in those gaps. That's really what we do is fill gaps and provide access to individuals who don't have access to. So we are looking at the map and figuring out where contraceptive deserts are. That was a term that was new to me when I started 4 1/2 years ago, but there's criteria that considered a contraceptive desert that individuals don't have access to birth control. So how can we help fill those gaps. How can we put clinic locations strategically in areas that don't have access or partner with individuals who are already there to provide better access to the individuals who need services which are typical client depends on the program really so far reproductive health program individuals between 18 and 24 years of age. Usually females that are coming in. They don't have health insurance so we help set them up with health insurance and lower income when looking at the WIC program. I would say we have a wide range of age anywhere from them to 14 up to 45 years of age. Individuals coming in pregnancy or with children that are really struggling to feed their catalysts, and that's one of the great benefits of the WIC program. It is not only do we get by nutrition education for that we also get to provide supplemental food benefits to them on a monthly basis to help feed the kiddos. One of the really cool things about the WIC program compared to that say snapper the food stamps program is we only provide healthy foods so we know that the individuals that are leaving are going to get adequate amounts of calcium and protein in their diet versus just giving them a check and they can buy whatever they want you mission, but there's a different clinics do they have different focuses order. They all basically running the same type...]]>443assistance,care,checkups,first,health,healthfirst,healthy,income,insurance,low,network,pap,pregnancy,reproductive,sti,testing,vaginal,wausau,wic,wisconsinfalsefullhttps://www.spreaker.com/episode/e9-city-of-la-crosse-art-fahey-la-crosse-center--40867660www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

La Crosse Wisconsin is a great place to work and play lacrosse. Vision 2020 podcast this month featuring Art Fahey from the La Crosse Center.]]>https://api.spreaker.com/episode/40867660Tue, 15 Sep 2020 17:00:03 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com La Crosse Wisconsin is a great place to...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

La Crosse Wisconsin is a great place to work and play lacrosse. Vision 2020 podcast this month featuring Art Fahey from the La Crosse Center.]]>299business,center,city,cityvision,concerts,confrence,conventions,lacrosse,lacrossecenter,lacrossewisconsin,laxcenter,maryesawyer,mississippi,moses,public,tourism,vacation,venue,vision,wisconsinfalsefullhttps://www.spreaker.com/episode/e20-chris-jones-1-word-pot-malort-stay-woke-kombucha--40613837https://api.spreaker.com/episode/40613837Mon, 31 Aug 2020 17:30:53 +0000Produced by Podcast For HireChris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The...16251word,black,blm,bswithbob,chris,communication,dad,hypnotist,jones,justtalking,kombucha,listening,lives,malort,matter,microcast,oneword,pot,staywoke,weektruefullhttps://www.spreaker.com/episode/e8-city-of-la-crosse-ian-turner-la-crosse-airport--40276790www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

La Crosse Wisconsin is a great place to work and play lacrosse. Vision 2020 podcast this month featuring Ian Turner from the La Crosse Regional Airport]]>https://api.spreaker.com/episode/40276790Sat, 15 Aug 2020 17:00:09 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com La Crosse Wisconsin is a great place to...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

La Crosse Wisconsin is a great place to work and play lacrosse. Vision 2020 podcast this month featuring Ian Turner from the La Crosse Regional Airport]]>329airlines,airport,business,city,cityvision,delta,flight,fly,lacrosse,lacrossewisconsin,lse,mississippi,public,regional,safety,trip,united,vacation,vision,wisconsinfalsefullhttps://www.spreaker.com/episode/e7-city-of-la-crosse-char-wegner-city-recycling--36482181www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

La Crosse Wisconsin is a great place to work and play lacrosse. Vision 2020 podcast this month featuring Char Wegner from the La Crosse recycling department. I first met Char nine years ago, eight, nine years ago when the city of La Crosse first started talking about bringing the garbage carts out and bring the recycling carts out and I thought to myself there's no way that these things can be great, Char. You told me when he came in to talk to me my radio show that these things can be fantastic and I won't regret it. Just what Char you are absolutely 100% right. I love them. I really like them AI with a nonbeliever off and he actually may bring one surprise and I went from having six garbage cans a week to one garbage spin and one recycle bin and honestly my recycle bin fills up just as fast or faster than the garbage men. So let's talk about the recycling. So how are we supposed recycle etc. people say you're supposed to put everything into a bag and dump it in there that I've heard that you're not supposed to do that. What's the true city of La Crosse rules Char when it comes to recycling bins should be loose in your car to be cleaned lead and cart carrying out that is collected get transferred to tears. They stepped out that's not really like about that were putting in. It goes through a variety of different ways and Then that separate that then also that they were putting including the bank that we get to like the Walmart whenever they get entangled in the equipment that sets down the equipment we supposed to do with those bags because we all have a ton of them take them, is to have them or Walmart usually have somewhere that you can have them recycle based on them somebody I know that when we got a fact that the pain is there that says make a part. So whenever we go to the grocery store. My husband always said grab the bag they need to make crackdowns. Char Wegner's are just this month, the recycling coordinator for the city of La Crosse was talk about the bins because those bins are fantastic but how do you know that the bin that's in front of my garage is the bin that was assigned to me that question. We have been very busy making sure that everyone has the correct part did you know that when the cards were delivered. They were and find herself number on the front of your cart that identifies your personal let's say over your house. You call me and say carts missing or my carts not the right one. It's a smaller cart or like a car you can ask us what your current numbers are and will give it to you and is not right. Well, I sent letters out to the neighborhood sure how to get hold of the recycling office so that we can check her cards to make sure it right once you can contact us at 608 7897508 people getting new beds all the time when we supposed to do with her old mattresses because I know that we had our large pickup a couple of months ago and I saw a bunch of beds out there then but what are you supposed to do during the rest of the year recycling, which is part of seven rivers, recycling, recycle the mattresses so what you need to do is take them out to the county rank fell and Connie ran so that you want it to be recycled and not land so they will have a specific spot that you can have that taken care of three dollars cheaper than landfilling on wait wait wait wait wait so stupid recycle that it is a throw away a lot of people don't know that Char know they don't. It is so interesting to see how there is Michael they have staff that go in and tear the bedding and they reuse and screensaver use the word that matches had most of those items I got bailed. And then there's that recycle your vision 2020 conversations with department heads from the city of La Crosse is a podcast for hire.com production. For more information about La crosse, visit the website city of La Crosse website www.cityoflacrosse.org]]>https://api.spreaker.com/episode/36482181Wed, 15 Jul 2020 17:00:14 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com La Crosse Wisconsin is a great place to...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

La Crosse Wisconsin is a great place to work and play lacrosse. Vision 2020 podcast this month featuring Char Wegner from the La Crosse recycling department. I first met Char nine years ago, eight, nine years ago when the city of La Crosse first started talking about bringing the garbage carts out and bring the recycling carts out and I thought to myself there's no way that these things can be great, Char. You told me when he came in to talk to me my radio show that these things can be fantastic and I won't regret it. Just what Char you are absolutely 100% right. I love them. I really like them AI with a nonbeliever off and he actually may bring one surprise and I went from having six garbage cans a week to one garbage spin and one recycle bin and honestly my recycle bin fills up just as fast or faster than the garbage men. So let's talk about the recycling. So how are we supposed recycle etc. people say you're supposed to put everything into a bag and dump it in there that I've heard that you're not supposed to do that. What's the true city of La Crosse rules Char when it comes to recycling bins should be loose in your car to be cleaned lead and cart carrying out that is collected get transferred to tears. They stepped out that's not really like about that were putting in. It goes through a variety of different ways and Then that separate that then also that they were putting including the bank that we get to like the Walmart whenever they get entangled in the equipment that sets down the equipment we supposed to do with those bags because we all have a ton of them take them, is to have them or Walmart usually have somewhere that you can have them recycle based on them somebody I know that when we got a fact that the pain is there that says make a part. So whenever we go to the grocery store. My husband always said grab the bag they need to make crackdowns. Char Wegner's are just this month, the recycling coordinator for the city of La Crosse was talk about the bins because those bins are fantastic but how do you know that the bin that's in front of my garage is the bin that was assigned to me that question. We have been very busy making sure that everyone has the correct part did you know that when the cards were delivered. They were and find herself number on the front of your cart that identifies your personal let's say over your house. You call me and say carts missing or my carts not the right one. It's a smaller cart or like a car you can ask us what your current numbers are and will give it to you and is not right. Well, I sent letters out to the neighborhood sure how to get hold of the recycling office so that we can check her cards to make sure it right once you can contact us at 608 7897508 people getting new beds all the time when we supposed to do with her old mattresses because I know that we had our large pickup a couple of months ago and I saw a bunch of beds out there then but what are you supposed to do during the rest of the year recycling, which is part of seven rivers, recycling, recycle the mattresses so what you need to do is take them out to the county rank fell and Connie ran so that you want it to be recycled and not land so they will have a specific spot that you can have that taken care of three dollars cheaper than landfilling on wait wait wait wait wait so stupid recycle that it is a throw away a lot of people don't know that Char know they don't. It is so interesting to see how there is Michael they have staff that go in and tear the bedding and they reuse and screensaver use the word that matches had most of those items I got bailed. And then there's that recycle your vision 2020 conversations with department heads...]]>2842020,bins,business,cans,city,cityvision,collection,garbage,garbagecans,harter,lacrosse,lacrossewisconsin,mississippi,pickup,public,recycling,safety,trash,vision,wisconsinfalsefullhttps://www.spreaker.com/episode/e19-chris-jones-1-word-drones-and-virtual-shows--36474957https://api.spreaker.com/episode/36474957Mon, 06 Jul 2020 21:57:16 +0000Produced by Podcast For HireChris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The...4251word,baby,black,blm,bswithbob,chris,communication,dad,floyd,george,hypnotist,jones,justtalking,listening,lives,matter,microcast,oneword,patience,talkingfalsefullhttps://www.spreaker.com/episode/e7-randy-nelson-extra-innings-what-things-will-be-different--31664765807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

37 years in the education business and the lasting a last dozen or so into working in administration probably didn't see this coming at all. At the at the end of your career for sure. As we look at this and we look at the on the pandemic of a look at the school closings that we've had what you think. You think will be different in the future. Randy because of this I wish I knew. I wish I could provide everyone with a really clear description of what this is going to be like I can't and I think that one thing is really it's becoming clear to me though is that it's never to be the same it. If this is our education and the way we do education the way we see education is never going to be the same essay that the most simple way because I do believe that even though our work in remote learning. We jumped into that and at times may be haphazard and not at the same level of quality. Perhaps others of face-to-face classroom. We also know that we've got. We have some some students out there. We have some families out there that like that stay like that method of delivery and usually we leave kind of remote learning and online learning as an option that we think about after everything else has failed. Well, you could try reading on that strontium online and I think it's time for us to make sure as we talk about us being the school district of choice to make sure that a remote learning opportunity is considered a viable part of education. When I extrapolate that out into the future. Just a little bit. Part of the immediate future is you don't goodness. What we do in July we got summer school and we have two schools that are on your own calendars and what's going to happen with them in July. Are we gonna be able to start school with them in July so that's one of the that's one of the upcoming questions that were having to answer were just waiting for the next kinds we want to know more about okay, what's after this current safer at home, executive order, there's gotta be something there, since you gotta be some sort of a statement that says okay here's the pattern that were in now until further notice, or until a particular date summer, waiting for that shoe to drop, so that we know better how is this can impact you live in summer school on your own calendars. I have to tell you I also think that even when we get to September. Not so certain that schools can be the same way in September is that as it was last September. To be honest with you, and I think we have to prepare ourselves for that and you know there's a whole process of gotta go through the grieving process when you realize that it's knocking to be the same, but I think once you get through that process. You also then can quickly move in the process of a gate what you can be and what's our opportunity where are we and what how can we make this great because I still think inside of a really huge challenge that were in right now. There's always opportunity our administrative team is been meeting virtually three times per week. I'd be lying if I told you that I love these virtual meetings in my face-to-face guy myself, but I'm getting really tired of these virtual meetings, but else I will be got a good group of folks and what were talking about is Chris trying to extrapolate out to the fall what you know what could this mean so were actually starting to run some scenarios, what would it be like for instance if we had to do school in the fall and we had to do social distancing can we even do it so we been exploring models. For instance, and the models of you in exploring that might be. We arty have a six day cycle ABC DEF you help and so on may be. As it turns out just so that we can only have 1/3 of the students in the school buildings at any one time that students come to school maybe two out of the six days and then their home for out of the six days. Now think about the ramifications for that home, especially if parents are starting themselves if they haven't been working to get themselves back in the workplace and trying to stabilize their homes financially and now 4/6 days. Their children are still going home want to know what is that look like and how how does that work and how do we guarantee which I don't know that we can. How do we guarantee that the parents who do send their children to school in the fall. What will be social distancing. When you've got so many things that are if common need, whether it's general going on the hall are going to use the restroom or it's the media center, or it's the the cafeteria and we would have to re-teach and help think about our kindergarten, first and second graders. Many of them who you know I think we can teach them. Certainly, here's how to do social distancing, and here's all works but since it's a whole new world that we can have to get into if we were to decide that we can even deliver school that way in the fall. I could not imagine having your job at this moment. One of the biggest challenges I think that has come about as a result of all this. Our work in equity to try to bring it together and give every student equal chance equal footing as much as we can. That really took a huge step backwards when we were required to do this now. I think that doing a remote learning situation is better than doing nothing at all, so building the relationships think connected to students is really important. I can imagine the discussion at the state level because at the state level know the guidance that we were given is okay. We need to shut down our schools by whatever date and so school is out will put in the place a lot of contingencies so that you can don't have to worry about the hours and minutes in meeting those but bargain-hunting over to shut this down what you realize that when we shut it down. Think about statewide. The number of school districts who were not able to do anything when it comes to remote learning. Maybe they're able to do some connecting and just some relationship building, but because of their circumstances or because they don't have the robust technology supports that we do here in the cross the Internet. For instance, just think about how all of a sudden students don't have access and so I think that what one of the things that has happened. State level and it translates into local level is you really see even clearer the discrepancies and also the inequities that are there. If we don't have school face-to-face if we don't have school to gather everyone coming together somehow because they're there and every home has a different learning environment. Some homes have environment that are really plush with books and supports in moms and dads that are there to help and others don't. That's no fault of the parents as much as it is a circumstance that makes it really sometimes more difficult for a child to have the resources at his or her fingertips to be able to do the homework and support the homework]]>https://api.spreaker.com/episode/31664765Thu, 18 Jun 2020 12:57:54 +0000Produced by Podcast For HireContact School District of La Crosse 807 East Avenue South La Crosse, Wisconsin 54601 (608) 789-7600 https://www.lacrosseschools.org/ Transcription is for SEO only 37 years in the education business and the lasting a last dozen or so into working in...807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

37 years in the education business and the lasting a last dozen or so into working in administration probably didn't see this coming at all. At the at the end of your career for sure. As we look at this and we look at the on the pandemic of a look at the school closings that we've had what you think. You think will be different in the future. Randy because of this I wish I knew. I wish I could provide everyone with a really clear description of what this is going to be like I can't and I think that one thing is really it's becoming clear to me though is that it's never to be the same it. If this is our education and the way we do education the way we see education is never going to be the same essay that the most simple way because I do believe that even though our work in remote learning. We jumped into that and at times may be haphazard and not at the same level of quality. Perhaps others of face-to-face classroom. We also know that we've got. We have some some students out there. We have some families out there that like that stay like that method of delivery and usually we leave kind of remote learning and online learning as an option that we think about after everything else has failed. Well, you could try reading on that strontium online and I think it's time for us to make sure as we talk about us being the school district of choice to make sure that a remote learning opportunity is considered a viable part of education. When I extrapolate that out into the future. Just a little bit. Part of the immediate future is you don't goodness. What we do in July we got summer school and we have two schools that are on your own calendars and what's going to happen with them in July. Are we gonna be able to start school with them in July so that's one of the that's one of the upcoming questions that were having to answer were just waiting for the next kinds we want to know more about okay, what's after this current safer at home, executive order, there's gotta be something there, since you gotta be some sort of a statement that says okay here's the pattern that were in now until further notice, or until a particular date summer, waiting for that shoe to drop, so that we know better how is this can impact you live in summer school on your own calendars. I have to tell you I also think that even when we get to September. Not so certain that schools can be the same way in September is that as it was last September. To be honest with you, and I think we have to prepare ourselves for that and you know there's a whole process of gotta go through the grieving process when you realize that it's knocking to be the same, but I think once you get through that process. You also then can quickly move in the process of a gate what you can be and what's our opportunity where are we and what how can we make this great because I still think inside of a really huge challenge that were in right now. There's always opportunity our administrative team is been meeting virtually three times per week. I'd be lying if I told you that I love these virtual meetings in my face-to-face guy myself, but I'm getting really tired of these virtual meetings, but else I will be got a good group of folks and what were talking about is Chris trying to extrapolate out to the fall what you know what could this mean so were actually starting to run some scenarios, what would it be like for instance if we had to do school in the fall and we had to do social distancing can we even do it so we been exploring models. For instance, and the models of you in exploring that might be. We arty have a six day cycle ABC DEF you help and so on may be. As it turns out just so that we can only have 1/3 of the students...]]>417classroom,community,different,education,lacrosse,lax,nelson,public,randy,retiring,safety,school,schools,schoolsafety,superintendent,support,teachers,teaching,wisconsinfalsefullhttps://www.spreaker.com/episode/e6-randy-nelson-extra-innings-march-school-closings--31660891807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

Thanks Randy, you know the challenges of the kids and the families are dealing with nowadays is a lot different than what I had to deal with with my other children as they were getting close to graduation. I got twins are graduating this year and is still, it's been different. I feel bad for the seniors in high school this year and I feel bad for the underclassmen as well because they don't have the opportunity to kinda learn from the older kids as their wrapping up the school year and I'm sure that you're probably seeing that throughout the entire school district in Trenton throughout the entire state throughout the entire country right now as we as kids are getting ready to ramp up for their next piece of life, but they haven't really had the chance to turn the pages of the last few chapters of this part of their life. Think this is one of the big challenges that were that everyone is having a not just here in our district but all over the place now and then that really is a lot about how do we come to closure. But how do we help our students come to closure. How do we get them poised and ready for the coming school year and there's a so many questions that go alongside of that. But what were looking at so many different perspectives to end the school year and in this, the graduation piece is one of the one that they were taking a look at now I we've Artie decided this. That's the best closing of summer school for June. That was rather easy to do because we were pretty much required to do that based on the last ordered that Gov. universe of made it doesn't require us to completely close school, but it does require us not to have face-to-face school through June 30. And so we will continue to support learners in this remote learning environment which some learners are finding really good works well for them and others are thinking. Boy that's not that's not gonna work well for me. So some of the face-to-face and small group things in the enrichment kinds of opportunities that we've typically had for June are not going to happen this year as a result of summer school and I were taking a look at July and getting into the July piece and we have not made any decisions in July and July happens to be our most prolific month when it comes to summer school about 80 different courses were running in July. Many of them good hands-on face-to-face kinds of classes and so we don't know the full disposition of that were moving forward and asking people to register as they have always registered for summer school, but it's very possible that summer school in July could be in jeopardy, as well. As we move forward. Read over were waiting for, the next shoe to drop on the state level or the county level or someone is okay, here's what's going to work. Now here's what we do love now here's of the, here's when the numbers are hears of the metrics are and so now here's what we can do next and so come to closure. I think has been a challenge for us. We are doing some adjusting with our curriculum as our teachers made this change from the classroom into the online environment they really had to step back our curriculum folks. We took the time to step back and say okay probably in this environment. This remote learning environment. The coverage of curriculum is not gonna be as broad as it would've been if we would've had you in classroom so actually what they did is they started working on what we would call power standards. No these are the tested standards. The most important standards that we have at the state level in each one of our content areas. Each grade level and support and have a focus on these and then what were trying to do is to make sure that we have a good degree of communication in place for the teachers for the students in the upcoming year so that they can catch up and they can they can pick up with some of the contents of the just a lot of pieces in this closure piece that need to happen, we see the school you're kind of ending now, but the kids that are finishing up the school year is here finishing up six grade now and the moving into seventh grade. There's probably going to be more of a ramp at the beginning of the school year next year to get the kids back into being in a classroom. I think we be kidding ourselves if we said that there wasn't going to be a lag but we certainly anticipate that the students who were sixth-graders this year are going to go on to grade 7 next year. We also know that due to this gap that we have in April and May of this year there's going to be a little bit a lag of the content and that's what were trying to make sure that we establish and that we document and communicate so that our teachers next year. Have a good chance to move this forward. I think our biggest challenge here along the way as we bring closure to this is there are some students who, despite our best of intentions have not reconnected with us since since March and so in a work and have to be talking a little bit there about what what and how. How do we help you reconnect and how does June look for you because we may have to do some online things in some remote things in June and maybe even July for you to be as ready as other students for our next fall]]>https://api.spreaker.com/episode/31660891Thu, 18 Jun 2020 12:49:38 +0000Produced by Podcast For HireContact School District of La Crosse 807 East Avenue South La Crosse, Wisconsin 54601 (608) 789-7600 https://www.lacrosseschools.org/ Transcription is for SEO only Thanks Randy, you know the challenges of the kids and the families are dealing with...807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

Thanks Randy, you know the challenges of the kids and the families are dealing with nowadays is a lot different than what I had to deal with with my other children as they were getting close to graduation. I got twins are graduating this year and is still, it's been different. I feel bad for the seniors in high school this year and I feel bad for the underclassmen as well because they don't have the opportunity to kinda learn from the older kids as their wrapping up the school year and I'm sure that you're probably seeing that throughout the entire school district in Trenton throughout the entire state throughout the entire country right now as we as kids are getting ready to ramp up for their next piece of life, but they haven't really had the chance to turn the pages of the last few chapters of this part of their life. Think this is one of the big challenges that were that everyone is having a not just here in our district but all over the place now and then that really is a lot about how do we come to closure. But how do we help our students come to closure. How do we get them poised and ready for the coming school year and there's a so many questions that go alongside of that. But what were looking at so many different perspectives to end the school year and in this, the graduation piece is one of the one that they were taking a look at now I we've Artie decided this. That's the best closing of summer school for June. That was rather easy to do because we were pretty much required to do that based on the last ordered that Gov. universe of made it doesn't require us to completely close school, but it does require us not to have face-to-face school through June 30. And so we will continue to support learners in this remote learning environment which some learners are finding really good works well for them and others are thinking. Boy that's not that's not gonna work well for me. So some of the face-to-face and small group things in the enrichment kinds of opportunities that we've typically had for June are not going to happen this year as a result of summer school and I were taking a look at July and getting into the July piece and we have not made any decisions in July and July happens to be our most prolific month when it comes to summer school about 80 different courses were running in July. Many of them good hands-on face-to-face kinds of classes and so we don't know the full disposition of that were moving forward and asking people to register as they have always registered for summer school, but it's very possible that summer school in July could be in jeopardy, as well. As we move forward. Read over were waiting for, the next shoe to drop on the state level or the county level or someone is okay, here's what's going to work. Now here's what we do love now here's of the, here's when the numbers are hears of the metrics are and so now here's what we can do next and so come to closure. I think has been a challenge for us. We are doing some adjusting with our curriculum as our teachers made this change from the classroom into the online environment they really had to step back our curriculum folks. We took the time to step back and say okay probably in this environment. This remote learning environment. The coverage of curriculum is not gonna be as broad as it would've been if we would've had you in classroom so actually what they did is they started working on what we would call power standards. No these are the tested standards. The most important standards that we have at the state level in each one of our content areas. Each grade level and support and have a focus on these and then what were trying to do is to make sure that we have a good degree of...]]>323closings,community,covid,covid19,education,lacrosse,march,nelson,public,randy,remote,retiring,safety,school,schools,schoolsafety,superintendent,support,teachers,wisconsinfalsefullhttps://www.spreaker.com/episode/e5-randy-nelson-extra-innings-academies--31660091807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

Thanks, Randy and his podcast and hoping you can give me your thoughts on academies. We talked about that in the past but exactly what makes an academy on a particular school district. We been working on academies mostly for grades 11 and 12. Probably her most prolific Academy. There is the health science Academy that's in its 10th year and I really started with conversations with folks at Gunderson and also with folks at mail and quickly turned into follow-up conversations with our higher end partners including UW well the turbo and Western what we did as we pulled together and experience for students in grades 11 and 12. It provides an opportunity for them to really good practical hands-on experience in the areas of the health science but we also have a construction academy and we also have an engineering Academy this year for the first times are really excited about these opportunities for students a couple of critical things that really need to happen inside of an Academy model forest. First some sort of a career focus. It's really helping our students get themselves immersed in a career or careers and help them sort out a little bit in their heads. Okay, I've experienced this enough. I don't want to do this or I love this and this is exactly what I want to do for it to be interdisciplinary is also important. We don't want them to take a class on health science just to take a class in health science we really want there to be some connections with other areas, whether it be mathematics or social studies or English language arts or science if it makes sense or physics, so we always want there to be some ways that the teachers who are involved in the program can collaborate with one another and they can provide lessons from several different perspectives of the children they go through the academies. They get all their regular classes even though they gone the Academy they still can graduate with the kids. They started kindergarten with absolutely. So what we've done is we've taken our English 11 English 12 classes to get brought right into an Academy situation. The teachers are given the opportunity that make changes to that curriculum to make it work inside of that particular Academy. So if the students are still getting their English credit there still getting a math credit and they might be getting this career in tech and credit that they're involved with, as well. Salted brings all the pieces together keeps a student on track to graduate but it brings a flavor of that work inside of it so it mathematics. For instance, think of all the mathematics you might find in a construction academy, especially in geometry, so the students are getting credit for that mathematics and while at the same time they're getting credit for understanding of the construction side of it and the safety side of it and how to build things, etc. maybe the physics out of it. There are a lot of components that all come together and students are getting multiple credit for doing this one thing inside of the Academy, which is typically two and half hours or so every morning is part of the schedule a couple of my children have gone to the construction academy at Central High School will now as a union carpenter. The other one graduates in 2020 and is interested in getting into construction as well because of the love of construction that they both learn through going to school. While this is what's really cool I think about the academies because not only is it about pulling together these content areas in math and science, and English language arts with something that's connected to a career, but it also allows some of our staff who really love these kinds of opportunities I can think of our teacher in the construction academy. I get tired. He loves this work and he loves being out at a site in working with the city to acquire this property in a build a house on this property and make this happen. P is in his element. When that happens. And even though sometimes he's got 16, 18 or 20 students walking around overexcited one time and people are using saws and power to other power tools. It's amazing what he gets done and he's in his element and he loves it so it's not just about the students having a good experience in connecting all these pieces it's about a teacher and teachers connected to this were also saying I love doing this. This is my passion. This is what I love to do regular talk about the success of these academies. We've had with school District of La Crosse. What kind of proof. Have you had that that these are working but you, especially in our health science Academy where we have most of our documented success. It's just about every single student when they graduate out of that health science Academy. They are pursuing some sort of a health related career and just about every student also receives some sort of a scholarship to help pursue that career moving forward if we use that is at least one of the litmus tests we really are burring the interest of students were helping them sort through opportunities and then helping them get on a path and bolt up the experience that they can get from the beginning to the end of a career pathway inside of that area sweetheart what engineering we talked about health science. We talked about construction academy any types of academies going forward. Really what we been doing is exploring some sort of a future teacher Academy. This is an area that we see is a challenge for us in education is having teachers ready to go, especially in some areas of licensure. Teachers are really difficult to find and so this could really make for us a chance to connect with students to tap a student on his shoulder see what kind of interest they may have when it comes to teaching and encourage those students with our own mentors to be able to have them be teachers anything amiss and I would say that another really important part when we put together academies to make sure that there are off-site learning experiences. We want to make sure that students are getting a chance to actually experience this kind of work hands-on outside of their high schools and someplace embedded inside of our community and in order to do that it brings on another part of our elements and that is to mature, that we have community business partners along the way. That's where students are getting the most hands-on experience sometimes is connecting and working with people who are doing these things for a living on a day in day out basis]]>https://api.spreaker.com/episode/31660091Thu, 18 Jun 2020 12:44:59 +0000Produced by Podcast For HireContact School District of La Crosse 807 East Avenue South La Crosse, Wisconsin 54601 (608) 789-7600 https://www.lacrosseschools.org/ Transcription is for SEO only Thanks, Randy and his podcast and hoping you can give me your thoughts on academies....807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

Thanks, Randy and his podcast and hoping you can give me your thoughts on academies. We talked about that in the past but exactly what makes an academy on a particular school district. We been working on academies mostly for grades 11 and 12. Probably her most prolific Academy. There is the health science Academy that's in its 10th year and I really started with conversations with folks at Gunderson and also with folks at mail and quickly turned into follow-up conversations with our higher end partners including UW well the turbo and Western what we did as we pulled together and experience for students in grades 11 and 12. It provides an opportunity for them to really good practical hands-on experience in the areas of the health science but we also have a construction academy and we also have an engineering Academy this year for the first times are really excited about these opportunities for students a couple of critical things that really need to happen inside of an Academy model forest. First some sort of a career focus. It's really helping our students get themselves immersed in a career or careers and help them sort out a little bit in their heads. Okay, I've experienced this enough. I don't want to do this or I love this and this is exactly what I want to do for it to be interdisciplinary is also important. We don't want them to take a class on health science just to take a class in health science we really want there to be some connections with other areas, whether it be mathematics or social studies or English language arts or science if it makes sense or physics, so we always want there to be some ways that the teachers who are involved in the program can collaborate with one another and they can provide lessons from several different perspectives of the children they go through the academies. They get all their regular classes even though they gone the Academy they still can graduate with the kids. They started kindergarten with absolutely. So what we've done is we've taken our English 11 English 12 classes to get brought right into an Academy situation. The teachers are given the opportunity that make changes to that curriculum to make it work inside of that particular Academy. So if the students are still getting their English credit there still getting a math credit and they might be getting this career in tech and credit that they're involved with, as well. Salted brings all the pieces together keeps a student on track to graduate but it brings a flavor of that work inside of it so it mathematics. For instance, think of all the mathematics you might find in a construction academy, especially in geometry, so the students are getting credit for that mathematics and while at the same time they're getting credit for understanding of the construction side of it and the safety side of it and how to build things, etc. maybe the physics out of it. There are a lot of components that all come together and students are getting multiple credit for doing this one thing inside of the Academy, which is typically two and half hours or so every morning is part of the schedule a couple of my children have gone to the construction academy at Central High School will now as a union carpenter. The other one graduates in 2020 and is interested in getting into construction as well because of the love of construction that they both learn through going to school. While this is what's really cool I think about the academies because not only is it about pulling together these content areas in math and science, and English language arts with something that's connected to a career, but it also allows some of our staff who really love these kinds of opportunities I can think...]]>374academies,academy,community,education,lacrosse,lax,nelson,podcast,public,randy,retiring,safety,school,schools,schoolsafety,superintendent,support,teachers,wisconsinfalsefullhttps://www.spreaker.com/episode/e4-randy-nelson-extra-innings-community-partnerships--31659814807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

Had conversations on and off for the last 12 years and I really enjoyed that I really enjoyed watching you bridge the schools with the community I mean just watching how somehow things work as might my cavities, my kids is an example to my four children went to the construction academy at Central High School and had the opportunity to build a garage build a house. My middle son who is enjoying a career now as a as a union carpenter. My youngest son is taking this class at Central High School minutes. Cool to see how to getting kids real life skills that they're going to use after they graduate. Well I think it's I think this is an important part of schools. Fact of the matter is your schools or your community in your community are really your schools. It's a symbiotic relationship and so we really take pride in building strong relationships but also making sure that were were helping students navigate for themselves, their interests, what they might be interested in. We do several skill surveys to help students, determine get some ideas about what they may want to do as they get older and what they may want to consider that nothing locks that under stone your children may be used as some of those who said I always wanted to be a coward. They watched you and the work that you do. Or maybe they took a skill servant said carpenter is one of something I want to get into. They look at what I do. Others, like I want to be in radio's path of a hole in the school District of La Crosse. We have been working diligently to establish opportunities for students and so along the way. Not only have we established the construction academy. We have also have a health science Academy that it's in. Since 10th 10th year we've had a few hundred kids move through this health science Academy grades 11 and 12 and it's really the epitome of I think strong partnerships and that we have for instance as partners. We have male health systems with Gunderson health systems we have UW well in the turbo and we have Western all involved in kids getting credit there getting opportunities inside of that and the getting opportunities off of our campus. It's an important part. We try to do our academies is a get kids off the campus is the most authentic opportunities they can find and we can provide for them inside of the community and those those entities. Those organizations that are working with us are are all about it at the same time they're also looking for a future employees lets us put that on the table. Of course, what were trying to do is to try to find connections. Our health science Academy. For instance, one of the things that our students are required to do is to still watch a surgery. Sometimes you find out the student finds out quickly that the sight of blood. It is not for them and so the sale Decided I am knocking to be a nurse or I'm not cyanotic of this, but I might want to look at something else in the health field really help students start to understand what they are really excited about by actually trying some of those things out and it also saves parents the money and tuition because it helps the students don't maybe go down up a better path maybe what their thing because they've experienced a little bit in their understanding they're talking to adults there talking to mentors and the mentor saying here's what we have to do and we do this, and here's how this happens and so I think that these community connections, the academies, the partnerships that we been running are so important. So why is a sense of community important in schools, but I think that community means everything inside the heart of the community as a strong relationships and so we whether talking about a neighborhood you're talking about a school being at the heart of the neighborhood and or vice versa. It's the relationships in the positive relationships that we bring to school every single day, student to student adults and students and families and other adults. Parents working side-by-side. This community building pieces all based on relationships in the good strong heavy webs that we create on relationships of a metaphor that I use sometimes when we talk about some of our programming and many times people will say well we need to have a strong safety net on our community. Absolutely I get that but I think of Safetynet. I'm thinking of the people in the flying trapeze at the way top of some sort of circus tent and now they're going back and forth and then got a safety net below them so they don't get hurt if and when they fall, and for our students. I think that a safety net is not the right thing. I think that what we need is a trampoline and needs to be so tightly woven that when a student does fall when a student misses the grab from that adult way up there. The top that they fall hit the trampoline, but they come right back up and someone grabs onto them again because it's to let him have a safety net just cushions the false they don't hit the floor, but hardly ever get back up again except starting at the very thing I climbing a ladder all the way back up to the top again I will make sure that we've got a good Safetynet that's really tight like a Leica, you know like the trampoline so student can bounce and get right back into it again. Were all in this together and we all need to be working together, we need to be supporting our children. They are the commodity that we have in front of us is so important for the future and well-being. Everyone one of us. We need to acknowledge that we need to support them]]>https://api.spreaker.com/episode/31659814Thu, 18 Jun 2020 12:40:45 +0000Produced by Podcast For HireContact School District of La Crosse 807 East Avenue South La Crosse, Wisconsin 54601 (608) 789-7600 https://www.lacrosseschools.org/ Transcription is for SEO only Had conversations on and off for the last 12 years and I really enjoyed that I really...807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

Had conversations on and off for the last 12 years and I really enjoyed that I really enjoyed watching you bridge the schools with the community I mean just watching how somehow things work as might my cavities, my kids is an example to my four children went to the construction academy at Central High School and had the opportunity to build a garage build a house. My middle son who is enjoying a career now as a as a union carpenter. My youngest son is taking this class at Central High School minutes. Cool to see how to getting kids real life skills that they're going to use after they graduate. Well I think it's I think this is an important part of schools. Fact of the matter is your schools or your community in your community are really your schools. It's a symbiotic relationship and so we really take pride in building strong relationships but also making sure that were were helping students navigate for themselves, their interests, what they might be interested in. We do several skill surveys to help students, determine get some ideas about what they may want to do as they get older and what they may want to consider that nothing locks that under stone your children may be used as some of those who said I always wanted to be a coward. They watched you and the work that you do. Or maybe they took a skill servant said carpenter is one of something I want to get into. They look at what I do. Others, like I want to be in radio's path of a hole in the school District of La Crosse. We have been working diligently to establish opportunities for students and so along the way. Not only have we established the construction academy. We have also have a health science Academy that it's in. Since 10th 10th year we've had a few hundred kids move through this health science Academy grades 11 and 12 and it's really the epitome of I think strong partnerships and that we have for instance as partners. We have male health systems with Gunderson health systems we have UW well in the turbo and we have Western all involved in kids getting credit there getting opportunities inside of that and the getting opportunities off of our campus. It's an important part. We try to do our academies is a get kids off the campus is the most authentic opportunities they can find and we can provide for them inside of the community and those those entities. Those organizations that are working with us are are all about it at the same time they're also looking for a future employees lets us put that on the table. Of course, what were trying to do is to try to find connections. Our health science Academy. For instance, one of the things that our students are required to do is to still watch a surgery. Sometimes you find out the student finds out quickly that the sight of blood. It is not for them and so the sale Decided I am knocking to be a nurse or I'm not cyanotic of this, but I might want to look at something else in the health field really help students start to understand what they are really excited about by actually trying some of those things out and it also saves parents the money and tuition because it helps the students don't maybe go down up a better path maybe what their thing because they've experienced a little bit in their understanding they're talking to adults there talking to mentors and the mentor saying here's what we have to do and we do this, and here's how this happens and so I think that these community connections, the academies, the partnerships that we been running are so important. So why is a sense of community important in schools, but I think that community means everything inside the heart of the community as a strong relationships and so we whether talking about a...]]>338community,education,lacrosse,lax,nelson,partnerships,public,randy,retiring,safety,school,schools,schoolsafety,superintendent,support,teachers,wisconsinfalsefullhttps://www.spreaker.com/episode/e3-randy-nelson-extra-innings-rebuilding-for-learning--31658045807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

I had the opportunity to be a part of your rebuilding for learning and it's in an initiative that I know that the school District of La Crosse had for quite a few years. A chance for teachers to get together and explain some of the things they're doing to some of the other teachers. That way the teachers can all can learn from each other exactly. So we really established a connection between the school District of La Crosse and employees from the county employees from the city and what we were really trying to accomplish with that the organization was once really happening. How can we best support our students, our families, what we've seen. I think over the last few years is that we do have more and more of our students living in crisis. Actually, sometimes at home for various reasons, very complicated reason sometimes and sometimes in navigating those crises really involves a lot of different individuals including social workers, including child protective services, etc. and so what we really try to do in the first few years of rebuilding for learning was to bring together individuals we've had about 100 2025 people at our first one and it really was to bring together individuals from the city and the County and the school district and just have face-to-face meetings and build relationships with one another so that when it is time for us to have a discussion about a certain situation that we all should be involved with and supporting a family and supporting a child that is not the first time we've had a discussion with each other. We recognize faces. We recognize voices and we can get past those sub pleasantries and really get into the challenges that might be existing so that we can best help a child and get that child back on the right track again and so it started as a small group about 120 people last year. I think it was 1400 and we are a La Crosse Center and so we had our staff there several concurrent sessions about a myriad of different issues and challenges that were experiencing center classrooms in our community. All of these things are so intertwined and just having a good opportunity to visit with one another about that and also to gain knowledge from others. Send some experts in the field so that we can do our jobs better and I'm wondering Randy if a lot of community members don't realize we do have a group of kids that are homeless in a group of kids that are maybe writing a couch and are at a friend's house rather than having a home to go to because it that they're not getting along with their families or that their living in the car somewhere because they don't have a place to go. Actually, we've talked about school safety a little bit before Bob and I think that what's unfortunate is that for many of our students. School is the safest place in the life it's the place for them to be is the place were they feel safest all the time because outside of school, they're not always sure sure about their own safety. Sometimes whether it's a difficult living situation that their involvement or whether it's of friends who really aren't so much friends along the way and so these are some of the things we try better to understand. We really have been working hard to better understand the cultural pieces that come alongside of the solid instruction and making sure that everyone is welcome everyone has a role of the inclusive practices that are teachers are really trying to also better understand how do we work to make sure every single child is valued every child who somehow is marginalized in our community. Our job in public education is to un-marginalize it goes deeper than just while here, let's take another test store here. Let's do this intervention on reading or mathematics, let's address some of these challenges here so that you can do better but common theme has been a trauma informed care trauma informed understanding what it means to help a kid what it means to be a teacher who is better understanding of trauma informed of what it means for us ourselves as educators along the way. That's been a common theme just about through every one of these except we ask a different nuances each time we understand better how culture tolerates how socioeconomics impacts that particular piece and so these are important things for us as educators and now is the time for our schools also for our parents to be together and how we support our children how we build the character how we ensure that our students are better understanding the challenges that they own face that they face right now because of more we do that now, the better we understand each other. Right now, the better chance a child has somewhere down the road to really be a productive citizen that they really stand out to be already. This is help the child to be an individual no interest to be okay for some students, not to be successful when it comes time to take tests and/or other ways that we measure success along the way but some is not okay anymore. It has to be 100% of our students in order to do that we have to work with students at that individual level lesson mathematics and reading once more and other factors that are going on though in the life of the child and how we might be able to support or mitigate the edits to these partnerships and are rebuilding for learning efforts in connecting dots with several different entities and educators that we have a much better chance to focus on the individual child as opposed to depending on a system of standardization that has never met the needs of every child]]>https://api.spreaker.com/episode/31658045Thu, 18 Jun 2020 12:37:28 +0000Produced by Podcast For HireContact School District of La Crosse 807 East Avenue South La Crosse, Wisconsin 54601 (608) 789-7600 https://www.lacrosseschools.org/ Transcription is for SEO only I had the opportunity to be a part of your rebuilding for learning and it's in an...807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

I had the opportunity to be a part of your rebuilding for learning and it's in an initiative that I know that the school District of La Crosse had for quite a few years. A chance for teachers to get together and explain some of the things they're doing to some of the other teachers. That way the teachers can all can learn from each other exactly. So we really established a connection between the school District of La Crosse and employees from the county employees from the city and what we were really trying to accomplish with that the organization was once really happening. How can we best support our students, our families, what we've seen. I think over the last few years is that we do have more and more of our students living in crisis. Actually, sometimes at home for various reasons, very complicated reason sometimes and sometimes in navigating those crises really involves a lot of different individuals including social workers, including child protective services, etc. and so what we really try to do in the first few years of rebuilding for learning was to bring together individuals we've had about 100 2025 people at our first one and it really was to bring together individuals from the city and the County and the school district and just have face-to-face meetings and build relationships with one another so that when it is time for us to have a discussion about a certain situation that we all should be involved with and supporting a family and supporting a child that is not the first time we've had a discussion with each other. We recognize faces. We recognize voices and we can get past those sub pleasantries and really get into the challenges that might be existing so that we can best help a child and get that child back on the right track again and so it started as a small group about 120 people last year. I think it was 1400 and we are a La Crosse Center and so we had our staff there several concurrent sessions about a myriad of different issues and challenges that were experiencing center classrooms in our community. All of these things are so intertwined and just having a good opportunity to visit with one another about that and also to gain knowledge from others. Send some experts in the field so that we can do our jobs better and I'm wondering Randy if a lot of community members don't realize we do have a group of kids that are homeless in a group of kids that are maybe writing a couch and are at a friend's house rather than having a home to go to because it that they're not getting along with their families or that their living in the car somewhere because they don't have a place to go. Actually, we've talked about school safety a little bit before Bob and I think that what's unfortunate is that for many of our students. School is the safest place in the life it's the place for them to be is the place were they feel safest all the time because outside of school, they're not always sure sure about their own safety. Sometimes whether it's a difficult living situation that their involvement or whether it's of friends who really aren't so much friends along the way and so these are some of the things we try better to understand. We really have been working hard to better understand the cultural pieces that come alongside of the solid instruction and making sure that everyone is welcome everyone has a role of the inclusive practices that are teachers are really trying to also better understand how do we work to make sure every single child is valued every child who somehow is marginalized in our community. Our job in public education is to un-marginalize it goes deeper than just while here, let's take another test store here. Let's do this intervention...]]>344community,education,lacrosse,nelson,public,randy,retiring,safety,school,schools,schoolsafety,superintendent,support,teachers,wisconsinfalsefullhttps://www.spreaker.com/episode/e6-city-of-la-crosse-jay-odergaurd-park-rec-forestery--30813353www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

The city vision 2020 podcasts this month featuring Jay oderguard he's got the longest business card in the city of La Crosse is a park rec forestry building and grounds director that I miss anything, to do it with the world as it is not. It's the whole co-fed and all that stuff is a city of La Crosse Park and wrecked department do anything different because of the colder times we try to revolve with recommendation stricture walls are cool. We have been able to keep our part (and we had the playground cold for a while the folder open backup really were just being with all of the culture of the facility were seeing our huge upswing in our and all landing and trail you about the boat landings. Is there some new stuff this year with the bulimics this year we've gone to computerized registration system so people don't have to show up with three but the little yellow and bolts anymore. It's just a lot cleaner people. Bella Vita passes online, which is really helpful for guys that want to go location at 5 o'clock Saturday morning I want to do the annual past year, they can buy that mine done with no said kid per person or per vehicle per vehicle that's a slight change where we used to register the trailer. Now we register the vehicle depending on how you are set up. It can be good and bad but you know technology is constantly moving forward. My staff yell at me all the time because I still like paper calendars and in all stuff like that but they got me convinced on this one for talking thoughts. Let's talk a little bit about life vests in the past, the city has had a loaner program for life fast. Is that something that's continuing this year have a warrant program for life. The and are less Copeland landing and their seventh Street bowl landing, but with everything going on in the pool school. We are actually targeting came program beaches and so that way people can call me next. Don't feel comfortable in the water kid can get a light that has to go swim and it's something that we think will be beneficial to the community and really dealing with the tough situation all around. One of the things that I really enjoy doing the last couple years is kayaking and I know that I got a penny on Park and put my own kayak and thereby noticing as a supplemental's. There are those available for anybody to use RDF to be a city resident to rent the house. Although there are available with anybody, and quite honestly, they're very affordable. Not only do we have kayak was paddleboard and with everything going on. We are sanitizing admin between the different uses and it's just a great way especially for people that don't have a lot of experience they can hop in one, then paddle around in the pool in which is the current free area that really works well for beginners is any special programming because of 19th yeah so our traditional summer programs were all canceled about a month or so ago, but staff has been diligently working to Kino after some of those program logistics so we can match up with recommendations as far as social distancing and whatnot were really looking by the end of June to get going on and offering some programs that we understand parents with kids right now that are really in need of finding different opportunities for those that do participate in order to be offering some of our camp programs. All of our tiny tot program playground type programs we are gonna be looking at getting tennis for kids up and running, along with some of our 12 and under 14 and under. And, number programs, eliminating tournaments, reducing side of the T practice location but I'll let you know again we see the importance of having something for kids and community anticipated in]]>https://api.spreaker.com/episode/30813353Mon, 15 Jun 2020 17:12:13 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com The city vision 2020 podcasts this month...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

The city vision 2020 podcasts this month featuring Jay oderguard he's got the longest business card in the city of La Crosse is a park rec forestry building and grounds director that I miss anything, to do it with the world as it is not. It's the whole co-fed and all that stuff is a city of La Crosse Park and wrecked department do anything different because of the colder times we try to revolve with recommendation stricture walls are cool. We have been able to keep our part (and we had the playground cold for a while the folder open backup really were just being with all of the culture of the facility were seeing our huge upswing in our and all landing and trail you about the boat landings. Is there some new stuff this year with the bulimics this year we've gone to computerized registration system so people don't have to show up with three but the little yellow and bolts anymore. It's just a lot cleaner people. Bella Vita passes online, which is really helpful for guys that want to go location at 5 o'clock Saturday morning I want to do the annual past year, they can buy that mine done with no said kid per person or per vehicle per vehicle that's a slight change where we used to register the trailer. Now we register the vehicle depending on how you are set up. It can be good and bad but you know technology is constantly moving forward. My staff yell at me all the time because I still like paper calendars and in all stuff like that but they got me convinced on this one for talking thoughts. Let's talk a little bit about life vests in the past, the city has had a loaner program for life fast. Is that something that's continuing this year have a warrant program for life. The and are less Copeland landing and their seventh Street bowl landing, but with everything going on in the pool school. We are actually targeting came program beaches and so that way people can call me next. Don't feel comfortable in the water kid can get a light that has to go swim and it's something that we think will be beneficial to the community and really dealing with the tough situation all around. One of the things that I really enjoy doing the last couple years is kayaking and I know that I got a penny on Park and put my own kayak and thereby noticing as a supplemental's. There are those available for anybody to use RDF to be a city resident to rent the house. Although there are available with anybody, and quite honestly, they're very affordable. Not only do we have kayak was paddleboard and with everything going on. We are sanitizing admin between the different uses and it's just a great way especially for people that don't have a lot of experience they can hop in one, then paddle around in the pool in which is the current free area that really works well for beginners is any special programming because of 19th yeah so our traditional summer programs were all canceled about a month or so ago, but staff has been diligently working to Kino after some of those program logistics so we can match up with recommendations as far as social distancing and whatnot were really looking by the end of June to get going on and offering some programs that we understand parents with kids right now that are really in need of finding different opportunities for those that do participate in order to be offering some of our camp programs. All of our tiny tot program playground type programs we are gonna be looking at getting tennis for kids up and running, along with some of our 12 and under 14 and under. And, number programs, eliminating tournaments, reducing side of the T practice location but I'll let you know again we see the importance of having something for kids and community anticipated in]]>2832020,business,city,cityvision,covid,covid-19,forestry,infomation,kayak,lacrosse,lacrossewisconsin,mississippi,park,public,rec,recreation,safety,shelter,vision,wisconsinfalsefullhttps://www.spreaker.com/episode/e7-referral-staffing-solutions-what-to-expect-after-pandemic--28939076https://www.referralstaffingsolutions.com/
200 Mason St STE 18, Onalaska, WI 54650
608-790-9075

Transcription is for seo purposes only.

How important is it to keep on a schedule and a regular schedule when you're working important great format so that the first thing that you all can do to make it start at the local dump on the call will pop up gratefulness. You probably know, to purchase a new car right you know seen it a few times the lot on the way home you feel 20 of the incarnate brightly colored thing is here safe every time, but you also got everybody else is the same car right but it's the same thing with the grateful that you will start her day out with listing 3 to 5 things that were grateful for. And the reason behind that is because you know if you're looking for it. You're going to help that you know something that's really challenging the club think you're grateful for somebody that literally is the simplest coffee is another day the deep and meaningful to help us stay connected number one of the team and then number two just kinda makes us focus on what was grateful for and make that, you know, things were grateful for because Of mind that how we start our day and will go through. We have a we call the top five and five really loose term wear a loose number and the three really major important thing didn't become today's the 27 major things that need to be done for the day that we have a list of what were going to you yesterday so we can keep with one another and talk about what happened yesterday when I got going on today allows for some potential redirecting to redirect the team forget them handling focus on this area, but generally the team is really very self-directed and data kind of debate on what needs to be done and Elizabeth up for success for the for the day and then it allows for like when you have those affection and then when your dog to go out whatever it is like to give you something to come back to home base say okay my right and figure out what to do next help you focus you from the people are lacking focus during this quarantine time notice the difference that we have a system that can attract the things that are being done and noticed that a couple of my reporters and numbers have decreased and I noticed the numbers increased with with a couple of other one had noticed that the numbers that have decreased are the one to have children at home now like their workload and what they're actually accomplishing. I think it stayed consistent. I think it's done really well with that but I think sometimes it's the little things and making sure that things are noted in the system has been lacking. I guess a little bit a little bit more than normal. You normally they're very great detail and I think now like you have some kind of taking the extra time to make sure it put in the system and that effort is put into educating our children or taking care of our animals, but overall and are still very, very productive throughout the day and it just the work style the work habits had to change a little bit not noticeable from a numbers perspective as far as how much a video showing the system, but overall there accomplishing what they need to so show me how you think that the workforce is going to change once everybody does get back to work and how is that going to affect morale around the offices. That's a great question. I think it's going to depend on industry, I can tell you just from speaking from our industry that there are going to be some changes there some things that you know it's it's much easier that I racked my brain trying to figure out we've been relatively flexible with people in my working home once a month or if there's a snowstorm, things of that nature that I think will probably change it. Where is the employees that really thrive working from home can work from home more knowingly make a regular thing where a couple days a week that working from home on a regular basis. You know, interviewing and things of that nature we done video interviewing or but we always select that as a last resort. I suppose you know somebody was a long distance away or will have a scheduling issue because the person working full-time always been kind of a last resort, and I think we might change that. Where the first resort and the internal interview as a last resort. Time will tell. You think that that personal connection is is important, but thinking of just from like a public safety perspective, it may make sense to have the video interviews that are first resort is that backup you always mention the word we women talking are the employees that work for referral staff and employees overflowing staffing solutions or they employees of businesses that you help get hired. Technically their employees on referral English and payroll, we take care of sending Imperial taxes. We cover the workers comp insurance and employment insurance. So technically their employees of reprocessing pollution being supervised by our clients and were talking about temporary employees and then of course that internal employees are]]>https://api.spreaker.com/episode/28939076Thu, 11 Jun 2020 17:00:02 +0000Produced by Podcast For HireFor more information on Referral Staffing Solutions visit our website at https://www.referralstaffingsolutions.com/ 200 Mason St STE 18, Onalaska, WI 54650 608-790-9075 Transcription is for seo purposes only. How important is it to keep on a...https://www.referralstaffingsolutions.com/
200 Mason St STE 18, Onalaska, WI 54650
608-790-9075

Transcription is for seo purposes only.

How important is it to keep on a schedule and a regular schedule when you're working important great format so that the first thing that you all can do to make it start at the local dump on the call will pop up gratefulness. You probably know, to purchase a new car right you know seen it a few times the lot on the way home you feel 20 of the incarnate brightly colored thing is here safe every time, but you also got everybody else is the same car right but it's the same thing with the grateful that you will start her day out with listing 3 to 5 things that were grateful for. And the reason behind that is because you know if you're looking for it. You're going to help that you know something that's really challenging the club think you're grateful for somebody that literally is the simplest coffee is another day the deep and meaningful to help us stay connected number one of the team and then number two just kinda makes us focus on what was grateful for and make that, you know, things were grateful for because Of mind that how we start our day and will go through. We have a we call the top five and five really loose term wear a loose number and the three really major important thing didn't become today's the 27 major things that need to be done for the day that we have a list of what were going to you yesterday so we can keep with one another and talk about what happened yesterday when I got going on today allows for some potential redirecting to redirect the team forget them handling focus on this area, but generally the team is really very self-directed and data kind of debate on what needs to be done and Elizabeth up for success for the for the day and then it allows for like when you have those affection and then when your dog to go out whatever it is like to give you something to come back to home base say okay my right and figure out what to do next help you focus you from the people are lacking focus during this quarantine time notice the difference that we have a system that can attract the things that are being done and noticed that a couple of my reporters and numbers have decreased and I noticed the numbers increased with with a couple of other one had noticed that the numbers that have decreased are the one to have children at home now like their workload and what they're actually accomplishing. I think it stayed consistent. I think it's done really well with that but I think sometimes it's the little things and making sure that things are noted in the system has been lacking. I guess a little bit a little bit more than normal. You normally they're very great detail and I think now like you have some kind of taking the extra time to make sure it put in the system and that effort is put into educating our children or taking care of our animals, but overall and are still very, very productive throughout the day and it just the work style the work habits had to change a little bit not noticeable from a numbers perspective as far as how much a video showing the system, but overall there accomplishing what they need to so show me how you think that the workforce is going to change once everybody does get back to work and how is that going to affect morale around the offices. That's a great question. I think it's going to depend on industry, I can tell you just from speaking from our industry that there are going to be some changes there some things that you know it's it's much easier that I racked my brain trying to figure out we've been relatively flexible with people in my working home once a month or if there's a snowstorm, things of that nature that I think will probably change it. Where is the employees...]]>342candidate,covid,hire,hiring,hr,interview,jobs,jobseeker,jobservice,lacrosse,onlalaska,opportunity,payroll,referral,resume,service,solutions,staff,staffing,trainingfalsefullhttps://www.spreaker.com/episode/e18-chris-jones-1-word-george-floyd-riots-and-blm--29064473Transcription for seo purposes only.

One word Chris Jones podcast talking with Chris this month about how how is it bringing a child in to the world. Now when we're dealing with everything that were dealing with with you know that the riots around the country and around the world the pandemic that we've all been basically quarantined from everybody else. Is it scary to be a new dad or a dad to be in this time. I'm so excited. So excited. I have a little bit of perspective because I got into his three books and over so you know you if you have been an argument in 1920 and I just want to read the case, you can look back and take a minute there will be done in the past to get the interesting thing is that my twins were born in 2001. In November 2001 after the attack on the on our country and on the 9/11 attack is and at that time I was scared to death like what are we doing bringing children into this world at this time but you know they've done really well and then they graduate this year when everything's kinda shut down so I mean they had a couple of trying times. I think that'll push them to be that much better in the future, and my hope is that's the case for baby Jones as well. Very good perspectives that motivate 18 years old. Yeah. Like the young kids like your kids age can't fight a war that noted they are going to happen if there were any evildoers and therapist to be a fast war were just getting it the dominant he's been dead for a while now, when you see the world doing now that you know you had the riots happening around the country and you know I heard this morning on the radio that there happening around the world that there's some writing happening around the world for George Floyd. Do you think that this will end up being something or changing for something like that when Rodney King when that happened. I thought that that was going to change the world and I don't think it did gas and try to change the world as I try to make the world stop spending anything like this change of enactment of Jackson, but we've been with the world. We spend together. You know that the long way. I still have hope because I'm not going to be salt." I was reading very light misinformation going around saying that George Floyd didn't die that the priest and actor and stirring up some conversations that should not be a conversation at all. So who comes up with this conspiracy BS that's what I want to know this thing is true for Sandy Hook people so there's to get your gun Nazis had PR people ban public relations that even the client had public relations people they work on their image, and someone said no when and if he created this happened, yes, let's push that story and the accident happened. That's why I love journalism even more now. One of the first things he suddenly started talking today is that you are reading in the history books and that this kind of stuff is happened forever, and I believe that what you just I believe that I think that nowadays we're more aware of it hyper. Where is it now because of the fact that we have everything at the palm of her hands who can speak and get information immediately if not sooner. Assess happening and things in the past weren't always that way because I mean in a think about when when our parents were children that they went to the movie theater and theirs in Israel at the beginning of the about of a show. Oh yeah, that was under comedy side think that the bank robbers back in the day. Yeah, they rob a bank. Maybe have gone and shoot their initials into the side of the wall. I get it with copper and the boy. No police and then you know that when I was because I'm 20 years older than you. When I was a kid we'd find about it on you know in the newspaper because it came in. No sooner when you were a kid. It was things are on television immediately when it happened because they had to come up with, you know, ways to do that and then you know when my kids is Internet and by the time your child is older, who it might just be like thought processed into their heads. I know that so that's a weird way of thinking about things, but immediately look at how how things have changed and how we get our news now compared to the way that we got it in the past and it's just really right. I get that physical paper to my house delivery, five days a week. So many things you have so much technology like the CCX to watch the weather channel and she's like, how come we can't stop hurting we can on their we can't stop 20th is running the family's home. The more things change, Chris the morning to say the same minute identity feel their status in other states. I think the date that I got the answers and then something happens that I have no idea what the hell's going on anywhere you have control of my own life. What about something else you know is right. It's crazy. So let me you know I hate to but I hate to bring race into our conversation, we doing so being a black man now with what's going what's going on you know with with the everything in the in the world right now. I mean, is it different than it was two weeks ago, all without a doubt to his guy went running and running and now I go running and I don't want to wait a police car, but I feel obligated to live in a neighborhood that has a lot of police officer next to me. I don't want to leave. It's not right away when walking the dog. Like to go running my running too fast, and still something. How do I look like I'm clearly a runner and not losing someone's home to me that is me being sensitive remember an Georgia man was shot by civilian for running or jogging and in that man was are you are you more aware of it because it because you're black I'm aware of that I did not say that I would be oh you mean when you came to Chicago in your talk about when he got pulled over and that there are some black people and excellent. He told the story we were laughing at what she said a little bit of you being naïve in your my wonderful friend said I was very quiet and I have the little things are opposite and we were like yeah like that's where it starts to get pulled over like we asked permission on the department let them know my wallet in my pocket. Can I get it, like we get super scared we get pulled over when I was told the story and then you do, you mentioned that to me I was you know at the time is 2019 or 2018 and whenever was no surprise that happens, you know, in those days, and now all this is 2020 and the PS it happened in Minneapolis is unacceptable. I mean it's it it's hard to believe that that kind of crap happens in 2020 and then I'm embarrassed to say I don't member the name of the way I think it was Breanna. She was in bed with her boyfriend or husband and police Louisville first in the home without a warrant would identify and complete the her boyfriend was in the house was a burglar hired a couple shot fire multiple shots and they killed her and she was the first to find out if we can't find her and she is gone now but it wasn't on camera and the man who shot the burglar was brought up on trials tempted and drop now but Stacy she argued. Why is it that when a black man shot killed by police was unarmed. Get national attention and was a black woman don't hear about it. That's it. That's a legitimate question Chris. I don't know if you think I don't. Do you think a lot of what we have or having now is caused by media. I wouldn't say that I wouldn't say that that's wrong. If we unpacked some ugly stuff he always gives more prestige and power to men. And so when something is fighting against the powers that be. A man is usually attacked track down what happened to unpacked it further and be very ugly if a black man, was accused of raping a white woman went to kill him. I would show up in 2020 oh nine in the okay okay okay you get accused of like Emmett till was a Chicago kitty went out and allegedly whistled at a white woman and a light knock showed up or he was staying his cousin, and held them for a few days… I just tortured and then the men were later acquitted, and then wrote a book saying and I was one of the great awareness about all this to say we don't protect women fighting to get married and got to that happens to woman when I will be doing in their claim that the boat when it's on camera. I would like okay now I see what I believe are all the facts and opinions and then people hate it is semi final thoughts they Chris last night I couldn't sleep too well that I kept thinking about all lives matter. One of the suburbs of Chicago. There was a black watch another project in all lives just across the street and if you're going to say all live in that I'm saying you would like an angry person you are going that I don't love arguing all lives matter, my life matter as a white person on each putting down my value as a white person I would say you don't believe all lives matter because it is separate from the parent right now and intentions you don't believe in ice member life matters. You don't believe that some across the border illegally matters you don't believe that kids have the right to grow up and not get shot in our own American schools are. You don't believe all my it's a fine argument to last about two seconds really truly heart wanted to be an advocate for all lives matter worth you wouldn't be angry in the way that you are.]]>https://api.spreaker.com/episode/29064473Wed, 03 Jun 2020 18:19:39 +0000Produced by Podcast For HireChris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The...Transcription for seo purposes only.

One word Chris Jones podcast talking with Chris this month about how how is it bringing a child in to the world. Now when we're dealing with everything that were dealing with with you know that the riots around the country and around the world the pandemic that we've all been basically quarantined from everybody else. Is it scary to be a new dad or a dad to be in this time. I'm so excited. So excited. I have a little bit of perspective because I got into his three books and over so you know you if you have been an argument in 1920 and I just want to read the case, you can look back and take a minute there will be done in the past to get the interesting thing is that my twins were born in 2001. In November 2001 after the attack on the on our country and on the 9/11 attack is and at that time I was scared to death like what are we doing bringing children into this world at this time but you know they've done really well and then they graduate this year when everything's kinda shut down so I mean they had a couple of trying times. I think that'll push them to be that much better in the future, and my hope is that's the case for baby Jones as well. Very good perspectives that motivate 18 years old. Yeah. Like the young kids like your kids age can't fight a war that noted they are going to happen if there were any evildoers and therapist to be a fast war were just getting it the dominant he's been dead for a while now, when you see the world doing now that you know you had the riots happening around the country and you know I heard this morning on the radio that there happening around the world that there's some writing happening around the world for George Floyd. Do you think that this will end up being something or changing for something like that when Rodney King when that happened. I thought that that was going to change the world and I don't think it did gas and try to change the world as I try to make the world stop spending anything like this change of enactment of Jackson, but we've been with the world. We spend together. You know that the long way. I still have hope because I'm not going to be salt." I was reading very light misinformation going around saying that George Floyd didn't die that the priest and actor and stirring up some conversations that should not be a conversation at all. So who comes up with this conspiracy BS that's what I want to know this thing is true for Sandy Hook people so there's to get your gun Nazis had PR people ban public relations that even the client had public relations people they work on their image, and someone said no when and if he created this happened, yes, let's push that story and the accident happened. That's why I love journalism even more now. One of the first things he suddenly started talking today is that you are reading in the history books and that this kind of stuff is happened forever, and I believe that what you just I believe that I think that nowadays we're more aware of it hyper. Where is it now because of the fact that we have everything at the palm of her hands who can speak and get information immediately if not sooner. Assess happening and things in the past weren't always that way because I mean in a think about when when our parents were children that they went to the movie theater and theirs in Israel at the beginning of the about of a show. Oh yeah, that was under comedy side think that the bank robbers back in the day. Yeah, they rob a bank. Maybe have gone and shoot their initials into the side of the wall. I get it with copper and the boy. No...]]>7461word,baby,black,blm,bswithbob,chris,communication,dad,floyd,george,hypnotist,jones,justtalking,listening,lives,matter,microcast,oneword,patience,talkingfalsefullhttps://www.spreaker.com/episode/e6-referral-staffing-solutions-what-makes-the-perfect-candidate--28437815https://www.referralstaffingsolutions.com/
200 Mason St STE 18, Onalaska, WI 54650
608-790-9075

Transcription is for seo purposes only.
So what makes a successful candidate for referral staffing solutions? Want to work important in being open and being correct in talking about what is really important. What is really important person's life. We don't know what's important, not right in and around the very open about what this schedule is the most important thing to me. If a certain thing to me what the most important. We have candidate topic I can work any billing expecting that answer which I did and that we will pay okay while in no peanut hypothetical world, we can offer you alteration you tell me what order you pick those just said it really help them think about it and get back there. Some people get back threat when people are like I couldn't get anyone tomorrow. They're willing to work any ship they're willing to work for any pay. They're willing to jump in and help out, but it going Band-Aid going to be something where they they work at Intel, an opportunity that really fit for them from the launch is important to a divan in identify what the long-term fed or looking for. We have a temporary or finer command effect. But if were trying to quite higher. We don't want to put a Band-Aid person in attempt to hire Christian because our client is expecting a long-term permanent candidate we want to make sure really drilling and in understanding what works long-term for that candidate and work so the world filled with so much uncertainty now how does going through a staffing solutions company like referral staffing. How about a business felt right now. As the economy starts to open back. There is much uncertainty you know we we don't really know what it done to our business that we don't know what next month is going to bring can be very nerve-racking to the point where you need to hire people need to have been gone but you don't know if you're going to need them for two months or three months or six months working with referral Was a great opportunity to bring people in the water because the employees are technically referral Inclusions employee therapy by actually handle the unemployment with all of that. Great way to open it without opening up the floodgates to the waters in and get your work done me cathartic for the Dakotas at the college that you need me without bringing out all that rest on your own. Something where we can have take that risk off of your shoulders you think they'll work toward becoming fully open again]]>https://api.spreaker.com/episode/28437815Mon, 01 Jun 2020 17:00:21 +0000Produced by Podcast For HireFor more information on Referral Staffing Solutions visit our website at https://www.referralstaffingsolutions.com/ 200 Mason St STE 18, Onalaska, WI 54650 608-790-9075 Transcription is for seo purposes only. So what makes a successful candidate for...https://www.referralstaffingsolutions.com/
200 Mason St STE 18, Onalaska, WI 54650
608-790-9075

Transcription is for seo purposes only.
So what makes a successful candidate for referral staffing solutions? Want to work important in being open and being correct in talking about what is really important. What is really important person's life. We don't know what's important, not right in and around the very open about what this schedule is the most important thing to me. If a certain thing to me what the most important. We have candidate topic I can work any billing expecting that answer which I did and that we will pay okay while in no peanut hypothetical world, we can offer you alteration you tell me what order you pick those just said it really help them think about it and get back there. Some people get back threat when people are like I couldn't get anyone tomorrow. They're willing to work any ship they're willing to work for any pay. They're willing to jump in and help out, but it going Band-Aid going to be something where they they work at Intel, an opportunity that really fit for them from the launch is important to a divan in identify what the long-term fed or looking for. We have a temporary or finer command effect. But if were trying to quite higher. We don't want to put a Band-Aid person in attempt to hire Christian because our client is expecting a long-term permanent candidate we want to make sure really drilling and in understanding what works long-term for that candidate and work so the world filled with so much uncertainty now how does going through a staffing solutions company like referral staffing. How about a business felt right now. As the economy starts to open back. There is much uncertainty you know we we don't really know what it done to our business that we don't know what next month is going to bring can be very nerve-racking to the point where you need to hire people need to have been gone but you don't know if you're going to need them for two months or three months or six months working with referral Was a great opportunity to bring people in the water because the employees are technically referral Inclusions employee therapy by actually handle the unemployment with all of that. Great way to open it without opening up the floodgates to the waters in and get your work done me cathartic for the Dakotas at the college that you need me without bringing out all that rest on your own. Something where we can have take that risk off of your shoulders you think they'll work toward becoming fully open again]]>211candidate,hire,hiring,hr,interview,jobs,jobseeker,jobservice,lacrosse,onlalaska,opportunity,payroll,referral,resume,service,shobi,solutions,staff,staffing,trainingfalsefullhttps://www.spreaker.com/episode/e5-referral-staffing-solutions-what-is-the-shobi-story--28296593https://www.referralstaffingsolutions.com/
200 Mason St STE 18, Onalaska, WI 54650
608-790-9075

Transcription is for seo purposes only.

You know, having a business and everything people probably think that you know you are probably born into that and have the opportunities because you know your folks your folks had a business so you got a business and now your kids can have businesses. It is that they shall be sorry Marie L Eric fraction living will not long boring it was that right down 20 we were baby and there was a tornado warning Neshoba County met me and felt actually made me mesh yoga all name requiring we can move my father actually gathered all the friends for life friend went out and I would cut down trees and built a lot. What's cool, right like dry that outside of the wall is great when you went right back but I mean we had a garden hose that was the only source of water cold water. We had a quick well always have a cup of water on the L about how we got warm water. We went out and I went back. Started building a new house that we get a new house new house, but water that was exciting elect with pilot don't work tying care of all that comfortable and nine. It was not my Grandparents worked so hard. They were a huge huge part of my childhood and found a huge part of showing how you work hard, but all will love hard to make grand plan theory can see which of the shirt off his back to help someone in need. He would just die always volunteering community always getting more than they probably should have and they also taught that the story about working felt my grandparents but now I can't help it, always in the following gallon of cold water to wash that we were paid 1/4 an hour to start when you were correct like a dollar an hour but granting the need sure that you work and if you are an extra long bathroom break. I think of that nature out and started working at really, a lot of work ethic and work ethics you like. We are here right work for about eight hours for our cars but it actually works in the real world] if you're working for me. They were huge part in non-Inc. she can't shout you work for what we want, how the story because I tried really means a lot stronger. Only through organic balls were expected to work. We were expected to go out in the garden, we wrap that we are expected to be every really grew on. We were really close block of our daily throughout also work hard growing up during one, hundred growing up like that help you to reach your full potential as the owner of referral staff have not reach my full potential but it I learned that when you fall down any thing that really caught me up there with a lot of report from how you all think and also how to read all of that had really been perfect storm help cushioning direction inflation in 2014 Eagle Bank really come from every wound but there were not a lot of money really came from nothing and fell even now it made me nervous for they knew that I was before fall from my childhood, how I grew up in a like you a lot and I'll tell me I think it so important Galapagos dream bag. If you're not going to bring that. You're not thinking that report. I think the ability to allot very little amount cash flow like a big thing. I started really been able to push me forward and being nation and running have been helpful]]>https://api.spreaker.com/episode/28296593Mon, 25 May 2020 19:07:48 +0000Produced by Podcast For HireFor more information on Referral Staffing Solutions visit our website at https://www.referralstaffingsolutions.com/ 200 Mason St STE 18, Onalaska, WI 54650 608-790-9075 Transcription is for seo purposes only. You know, having a business and...https://www.referralstaffingsolutions.com/
200 Mason St STE 18, Onalaska, WI 54650
608-790-9075

Transcription is for seo purposes only.

You know, having a business and everything people probably think that you know you are probably born into that and have the opportunities because you know your folks your folks had a business so you got a business and now your kids can have businesses. It is that they shall be sorry Marie L Eric fraction living will not long boring it was that right down 20 we were baby and there was a tornado warning Neshoba County met me and felt actually made me mesh yoga all name requiring we can move my father actually gathered all the friends for life friend went out and I would cut down trees and built a lot. What's cool, right like dry that outside of the wall is great when you went right back but I mean we had a garden hose that was the only source of water cold water. We had a quick well always have a cup of water on the L about how we got warm water. We went out and I went back. Started building a new house that we get a new house new house, but water that was exciting elect with pilot don't work tying care of all that comfortable and nine. It was not my Grandparents worked so hard. They were a huge huge part of my childhood and found a huge part of showing how you work hard, but all will love hard to make grand plan theory can see which of the shirt off his back to help someone in need. He would just die always volunteering community always getting more than they probably should have and they also taught that the story about working felt my grandparents but now I can't help it, always in the following gallon of cold water to wash that we were paid 1/4 an hour to start when you were correct like a dollar an hour but granting the need sure that you work and if you are an extra long bathroom break. I think of that nature out and started working at really, a lot of work ethic and work ethics you like. We are here right work for about eight hours for our cars but it actually works in the real world] if you're working for me. They were huge part in non-Inc. she can't shout you work for what we want, how the story because I tried really means a lot stronger. Only through organic balls were expected to work. We were expected to go out in the garden, we wrap that we are expected to be every really grew on. We were really close block of our daily throughout also work hard growing up during one, hundred growing up like that help you to reach your full potential as the owner of referral staff have not reach my full potential but it I learned that when you fall down any thing that really caught me up there with a lot of report from how you all think and also how to read all of that had really been perfect storm help cushioning direction inflation in 2014 Eagle Bank really come from every wound but there were not a lot of money really came from nothing and fell even now it made me nervous for they knew that I was before fall from my childhood, how I grew up in a like you a lot and I'll tell me I think it so important Galapagos dream bag. If you're not going to bring that. You're not thinking that report. I think the ability to allot very little amount cash flow like a big thing. I started really been able to push me forward and being nation and running have been helpful]]>417business,hire,hiring,hr,interview,jobs,jobseeker,jobservice,lacrosse,onlalaska,opportunity,payroll,referral,resume,service,shobi,solutions,staff,staffing,trainingfalsefullhttps://www.spreaker.com/episode/e4-referral-staffing-solutions-what-is-the-best-way-to-find-a-job--27709401https://www.referralstaffingsolutions.com/
200 Mason St STE 18, Onalaska, WI 54650
608-790-9075
Transcription is for seo purposes only.

What's the best way to go about finding a job. First thing is it correct that together and making sure that resume showcases the skill set that you got that great. You know what you done and I'll share what you're looking for Gail to slipstream a good resume and a bad resume about recognizing one of the things that further harm my contact there are people that will send out resumes that don't have contact information. We cannot contact you if we don't have anti-Catholic information also add contact information for sometime people with numbers that are no longer active. Make sure that that is relevant. Additionally, email addresses, very important that your Enoch drafted appropriate. There are evil addresses that come through that are fun for example, my son has a email address that was like teddy bear one to three years like that you 16 now created a more grown-up email address you during his job searching social be how far back should somebody go when it comes to putting down the jobs they've had for a great question and it's not necessarily a one-size-fits-all answer. It really depends. I would say the more entry-level role that you are applying for. The less information it will roll five years of experience is great on it is more specific and more our role that show your progression in your career. They are an accountant. For example, you have an entry-level office position in the name of the company except you want to show that progression I you recommend if you are an older employee. Yet there are laws out there where people Emanate against older individual I would highly recommend leaving position at each you wrote I wouldn't go back. Probably more than 10 years because we don't want resumes to be discarded because they assume that your older employers can on leave from litigants individuals at the resume had one job or one type of career because I know a lot of people that have started off in you know XYZ business and they carried their entire career through their 25 years later there all the sudden quote right sized and looking for a job how to go about doing that. If there is with the same company their entire career that point. Look at that people will be with the organization and work their way up with an organization definitely highlight that you you have working the company and you stayed in the same condition throughout that period of time I would make sure that the resume is going in on the guilt that you really mastered during that time, depending on what level you're at or showing the progression that you had with another organization and goal]]>https://api.spreaker.com/episode/27709401Mon, 18 May 2020 22:44:55 +0000Produced by Podcast For HireFor more information on Referral Staffing Solutions visit our website at https://www.referralstaffingsolutions.com/ 200 Mason St STE 18, Onalaska, WI 54650 608-790-9075 Transcription is for seo purposes only. What's the best way to go about finding a...https://www.referralstaffingsolutions.com/
200 Mason St STE 18, Onalaska, WI 54650
608-790-9075
Transcription is for seo purposes only.

What's the best way to go about finding a job. First thing is it correct that together and making sure that resume showcases the skill set that you got that great. You know what you done and I'll share what you're looking for Gail to slipstream a good resume and a bad resume about recognizing one of the things that further harm my contact there are people that will send out resumes that don't have contact information. We cannot contact you if we don't have anti-Catholic information also add contact information for sometime people with numbers that are no longer active. Make sure that that is relevant. Additionally, email addresses, very important that your Enoch drafted appropriate. There are evil addresses that come through that are fun for example, my son has a email address that was like teddy bear one to three years like that you 16 now created a more grown-up email address you during his job searching social be how far back should somebody go when it comes to putting down the jobs they've had for a great question and it's not necessarily a one-size-fits-all answer. It really depends. I would say the more entry-level role that you are applying for. The less information it will roll five years of experience is great on it is more specific and more our role that show your progression in your career. They are an accountant. For example, you have an entry-level office position in the name of the company except you want to show that progression I you recommend if you are an older employee. Yet there are laws out there where people Emanate against older individual I would highly recommend leaving position at each you wrote I wouldn't go back. Probably more than 10 years because we don't want resumes to be discarded because they assume that your older employers can on leave from litigants individuals at the resume had one job or one type of career because I know a lot of people that have started off in you know XYZ business and they carried their entire career through their 25 years later there all the sudden quote right sized and looking for a job how to go about doing that. If there is with the same company their entire career that point. Look at that people will be with the organization and work their way up with an organization definitely highlight that you you have working the company and you stayed in the same condition throughout that period of time I would make sure that the resume is going in on the guilt that you really mastered during that time, depending on what level you're at or showing the progression that you had with another organization and goal]]>214business,hire,hiring,hr,interview,jobs,jobseeker,jobservice,lacrosse,onlalaska,opportunity,payroll,referral,resume,service,shobi,solutions,staff,staffing,trainingfalsefullhttps://www.spreaker.com/episode/e5a-city-of-la-crosse-adam-lorentz-mtu-covid--27414103www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

Adam Lorentz is the director of the MTU for the city of La Crosse was covered by team to come to the forefront of his mind right now housing to you dealing with safety for the drivers and the passengers going to stop everybody in a changing process for us but you it started off in March will be when it benefits going on at looking at intake and offer guidance from the TNR locale official couple things on it. Please keep the 6 foot barrier, but the distance herself of this opinion, we did is we actually stop using the front door. The bus somebody needed for mobility device and that there is a protected interaction with the copper and the driver well.And you know which is a tough thing to do, but with all the cash handling and Handling thought that was that. That we are really good handstand kind on the buses on the front and the back and then just really trying to educate the public and post signs and just go along the same guidelines in the CDC about making sure people wash their hands and about writing cover your mouth and and am yet to get everybody webmaster. They can obviously safety is the most important thing for our operators in the public and I would really increase our cleaning rotation. If you want to call upgrading that are chemical to use something executive trying to kill the cold virus we had just installed UV wand. The driver area to help sanitize that and I really to our dreams that night after night they conjured our boxes are playing so yeah it's a lot of a lot of things. A lot of people are doing, but is negatively doing right and about ridership is an up down or about the same as it always has been well is the first time in over time. The only directors say that they're happy to write a check the town on the way down anywhere from on Sunday 50 to 70% in infant that is due to what information put out there no one ago that you resorted to stay home, order, and wanted people to only 12% so neatly put that out there that are bus service for keeping and service, reduce some of our our time that we run, but we kept it out there for events with only so you on a day that we had in all 2500 people for the box you know that someday. Down at 700 that the only time you hear me say that for the ridership down but that was the intent of the of the information on the buses that says essential travel only what is essential travel that while there's a lot of people in the healthcare field. There's a lot of people that work in the grocery stores. A lot of the work and are on long facilities and so forth that you depend on the MTU for transportation enough so I think it's pretty new to talk about the medical field and and help them consult and I'm just that help get them to plan point B. We had a feeder for that and also the large population that have asked the young food, medical appointments and in the MTU provide that far off for the city La Crosse and we just had to make sure that we are there for those people, even though in the lot going on the world right now. People still knee-deep people feel silly to get to their medical appointment. So that's why I'm waiting to essential service and that means I have since arrived on so I don't want everything opens up our schedule is going to open back up to what they were prior to the coronavirus in October 19 yeah will really plan what kind of dog the last 30 hours, been pretty chaotic and down with a lot of new information results and analyze all that but that that the plan has been in the plan so far as the report is to do a small open where right now where you live finale service on the 30 there is a member that 30 minutes or so hourly looking to put that back to our our every 30 minutes and most run all morning, and Sunday back here. Eventually I will probably still keep some of those initial safety factors in there like you only according to the door and as of right now were not to be accepted and he cares only for the month you to keep that interaction with minimal thoughtful, but long story short is that is in the area started to open up more convenient you and make additional changes back to normal as well]]>https://api.spreaker.com/episode/27414103Fri, 15 May 2020 14:26:24 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com Adam Lorentz is the director of the MTU for...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

Adam Lorentz is the director of the MTU for the city of La Crosse was covered by team to come to the forefront of his mind right now housing to you dealing with safety for the drivers and the passengers going to stop everybody in a changing process for us but you it started off in March will be when it benefits going on at looking at intake and offer guidance from the TNR locale official couple things on it. Please keep the 6 foot barrier, but the distance herself of this opinion, we did is we actually stop using the front door. The bus somebody needed for mobility device and that there is a protected interaction with the copper and the driver well.And you know which is a tough thing to do, but with all the cash handling and Handling thought that was that. That we are really good handstand kind on the buses on the front and the back and then just really trying to educate the public and post signs and just go along the same guidelines in the CDC about making sure people wash their hands and about writing cover your mouth and and am yet to get everybody webmaster. They can obviously safety is the most important thing for our operators in the public and I would really increase our cleaning rotation. If you want to call upgrading that are chemical to use something executive trying to kill the cold virus we had just installed UV wand. The driver area to help sanitize that and I really to our dreams that night after night they conjured our boxes are playing so yeah it's a lot of a lot of things. A lot of people are doing, but is negatively doing right and about ridership is an up down or about the same as it always has been well is the first time in over time. The only directors say that they're happy to write a check the town on the way down anywhere from on Sunday 50 to 70% in infant that is due to what information put out there no one ago that you resorted to stay home, order, and wanted people to only 12% so neatly put that out there that are bus service for keeping and service, reduce some of our our time that we run, but we kept it out there for events with only so you on a day that we had in all 2500 people for the box you know that someday. Down at 700 that the only time you hear me say that for the ridership down but that was the intent of the of the information on the buses that says essential travel only what is essential travel that while there's a lot of people in the healthcare field. There's a lot of people that work in the grocery stores. A lot of the work and are on long facilities and so forth that you depend on the MTU for transportation enough so I think it's pretty new to talk about the medical field and and help them consult and I'm just that help get them to plan point B. We had a feeder for that and also the large population that have asked the young food, medical appointments and in the MTU provide that far off for the city La Crosse and we just had to make sure that we are there for those people, even though in the lot going on the world right now. People still knee-deep people feel silly to get to their medical appointment. So that's why I'm waiting to essential service and that means I have since arrived on so I don't want everything opens up our schedule is going to open back up to what they were prior to the coronavirus in October 19 yeah will really plan what kind of dog the last 30 hours, been pretty chaotic and down with a lot of new information results and analyze all that but that that the plan has been in the plan so far as the report is to do a small open where right now where you live finale service on the 30 there is a member that 30 minutes or so hourly looking to put that back to our our every 30 minutes and most run...]]>2672020,bus,business,city,cityvision,corona,covid,covid-19,infomation,lacrosse,lacrossewisconsin,mtu,podcast,public,ride,safety,shelter,transportation,vision,wisconsinfalsefullhttps://www.spreaker.com/episode/e5-city-of-la-crosse-adam-lorentz-mtu--27414052www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com


Adam Lorentz is the director of the MTU for the city of La Crosse and I read a while back that the MTU was going to be getting some new buses house that process going. You good to buses that are coming out now all across now is that there could be some delays now that everyone is going on but we do have two full electric buses that made the news about a year or two ago and were in the process of looking at that any 235 foot pole electric buses with charging stations on Morgan upgrade our infrastructure here at the bus barn connection can handle that. And not only handled but they're getting back try to start innovating for the future electric, but the way that we can ago who want to make sure that we have the capacity now and I think that that I think the best use of money at the plan for now I'm putting that in the short term here. I will plan on extricating five new 35 foot clean, eco-buses, and that's a mixture of different some grandpa came through the state, and also we received one bus and that should be the VW mitigation on that was a settlement that VW had a settlement that actually think that the country and around the state would allocate a certain amount of money we are able to get a bucket that felt deathly needed to be at Fort about this last year but we still have about 15 buses that did replace the useful life and the five that are coming next year can come not good enough. So with the new electric buses. How is that going to help with the fuel costs in the overall budget of the city you know there's still a lot to learn about electric buses were falling very closely with other agencies that actually it will minimize any in the state of Wisconsin Madison probably Madison walked into the bigger ones that are starting the process on the next block. If you have this on the street right now a lot of the things you know the names Coccinellidae Sophos right now were looking at them, reducing the cost per bottle just by having doubt not having that that gas and oil pump through their it's really time will tell. A lot of people feel down, but were really looking at him, the money aspect itself so that you can gauge the environment you're reducing our carbon footprint. So it's kind of a twofold situation of the benefit electric buses and tell me about the technology on some of the newer buses that is obviously anything new is better administrator for the drivers and better for the riders. Right now it is implemented. We have our fleshly and pulmonary ABL system and the ethos of the book of the GPS now and was really convenient for that is that any user can install a free app on their phone and they can see where the buses are in real time and what that does you know we do a little Wisconsin so you know when it's the portable low-end to get snow on the ground. It's nice to know where your buses in real time with the general condition of the table the, you know, standing there in the box where stand in home until the bucket there also. Just about plaintiff from his new dairy and not sure what talk to get on a lot of things that give us a call here and read the old-fashioned map, but the biblical proponent that to look this your buses around and just tap on that stop in for the next buses in their it's really revolutionize that's really set at the head of getting new riders on the box that's more like big city stuff really if you think about it. Yeah, absolutely a you know where were trying to change the culture of transit in the city La Crosse obviously never arrived in the depend on it. Not right as an Indian unit for many years but now we want to break the door and get a lot of those first-time writers and often in order to do that we have to get some of the technologies and some luxuries. No new bus luxury not able to write a new box so all those pieces on panic that is up to have the new ridership and tell me about some of the projects that the MTU is coming up well on this for A product that talked about the infrastructure of spinal route that electric grid not only to how the two buses but also the plan for the future. I'm just for plaintiff and money savings were in a plan for now. If you want to keep digging up the ground and put a new conduit new stations and every time you want to get electric buses, but for the community projects. We had a couple really great ones lined up this year. And of course they got postponed for next year but really trying to branch out and and and and get our faith out there and one only had a really cool project. The school district with your teachers, where family picnic in the community-based Damon that we had students from every one of the Wilson artwork and I plan to wrap a 35 foot box and have them going billboard of the kids our growth of the city and it's just that I really care product showcase the talent that we have here in La Crosse but also to have some mom find transportation system that I can't understand Latino politicians taking call about but feel that the large-scale project for really the last 12 to 18 months and really put a lot of emphasis on local community events. Local media picnics. We do a lot of outreach with him a lot of daycare and school. Korea: a parent is somewhat like a field trip on property but to get rid of the and honk the horn and just learn more about writing and then I will actually do a lot without working through different businesses in the area and will take a bath into a private poster with the their employees and their business just to get people to feel the box and understand about writing about kind of want to think environment where they have somebody looking at that object can do it together and just to show him that the foxes are really viable and efficient, and safe optical]]>https://api.spreaker.com/episode/27414052Fri, 15 May 2020 14:22:29 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com Adam Lorentz is the director of the MTU...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com


Adam Lorentz is the director of the MTU for the city of La Crosse and I read a while back that the MTU was going to be getting some new buses house that process going. You good to buses that are coming out now all across now is that there could be some delays now that everyone is going on but we do have two full electric buses that made the news about a year or two ago and were in the process of looking at that any 235 foot pole electric buses with charging stations on Morgan upgrade our infrastructure here at the bus barn connection can handle that. And not only handled but they're getting back try to start innovating for the future electric, but the way that we can ago who want to make sure that we have the capacity now and I think that that I think the best use of money at the plan for now I'm putting that in the short term here. I will plan on extricating five new 35 foot clean, eco-buses, and that's a mixture of different some grandpa came through the state, and also we received one bus and that should be the VW mitigation on that was a settlement that VW had a settlement that actually think that the country and around the state would allocate a certain amount of money we are able to get a bucket that felt deathly needed to be at Fort about this last year but we still have about 15 buses that did replace the useful life and the five that are coming next year can come not good enough. So with the new electric buses. How is that going to help with the fuel costs in the overall budget of the city you know there's still a lot to learn about electric buses were falling very closely with other agencies that actually it will minimize any in the state of Wisconsin Madison probably Madison walked into the bigger ones that are starting the process on the next block. If you have this on the street right now a lot of the things you know the names Coccinellidae Sophos right now were looking at them, reducing the cost per bottle just by having doubt not having that that gas and oil pump through their it's really time will tell. A lot of people feel down, but were really looking at him, the money aspect itself so that you can gauge the environment you're reducing our carbon footprint. So it's kind of a twofold situation of the benefit electric buses and tell me about the technology on some of the newer buses that is obviously anything new is better administrator for the drivers and better for the riders. Right now it is implemented. We have our fleshly and pulmonary ABL system and the ethos of the book of the GPS now and was really convenient for that is that any user can install a free app on their phone and they can see where the buses are in real time and what that does you know we do a little Wisconsin so you know when it's the portable low-end to get snow on the ground. It's nice to know where your buses in real time with the general condition of the table the, you know, standing there in the box where stand in home until the bucket there also. Just about plaintiff from his new dairy and not sure what talk to get on a lot of things that give us a call here and read the old-fashioned map, but the biblical proponent that to look this your buses around and just tap on that stop in for the next buses in their it's really revolutionize that's really set at the head of getting new riders on the box that's more like big city stuff really if you think about it. Yeah, absolutely a you know where were trying to change the culture of transit in the city La Crosse obviously never arrived in the depend on it. Not right as an Indian unit for many years but now we want to break the door and get a lot of those first-time writers and often in order to do that we...]]>3322020,bus,business,city,cityvision,infomation,lacrosse,lacrossewisconsin,mtu,podcast,public,ride,rider,safety,shelter,transportation,vision,wisconsinfalsefullhttps://www.spreaker.com/episode/e2-randy-nelson-extra-innings-community-schools--26797461807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

This is Randy Nelson and this is an edition of extra innings as a retiring superintendent of schools. Many things run across my mind when I reflect on 37 years of education, what's happened in those 37 years. What we been doing in our schools and even what's on the horizon to help facilitate the discussion. I've enlisted the assistance of Mr. Bob Schmidt past radio talkshow host a parent and a friend. Take one of the things that is change. I think a lot since my kids were little to now is is community schools. We tend to have more community schools than we did 15 years ago. One could argue that our community schools have always been committed to schools in that they serve neighborhoods. We believe that neighborhood schools are really important part of who we are but a community school model intensifies what it means to be a neighborhood school and that neighborhood school really sees that's this is where we bring our children love our school whatever staff we love everything that happens inside of our school for involving the PTO, etc. but the community school model is one that actually intensifies it by creating more connections, not just with parents and not just of students but with organizations in that particular neighborhood whether those would be churches or where they would be be businesses creating opportunities for many mentorships resources to come in to play bring them thinking in a place where, especially parents of children who maybe don't feel either welcome or comfortable in other settings can come to their local community school and they can be welcome there, and there are resources there for that to support them, etc. so this is the notion of community school. I'm real proud that how I think were in our third year of community school operations, both at Northside elementary school and also at Hamilton elementary school. So, explain the difference between a neighborhood school and community school that so that the neighborhood school is really about geographic location right, but a community school takes the geographic location and says what does this neighborhood have to offer the school and how can we bring it into the school. For instance, in one of the things we talked about before is in a community school model perhaps partnering with a laundromat or perhaps in bringing in for instance a washer and dryer so that the student a who may not have had an opportunity to have their clothes washed for several days. They can be washed at school. We can take care that we can support that we can support the parent we can support the students. We also talked about making sure that in a community school that we have. For instance, classroom space for adult learning so that parents who, for instance, would like to have a class running there that me know maybe through a partnership with one of our higher Ed agencies Western or Viterbo or UW well that actually in an adult course can be run right there make minutes parenting course. Maybe it's a course on marketing. Maybe it's a corrupt business course we want to turn out to be a hub where that particular parent or any parent can send this is my school and on a drop in here. Both of those schools have a pretty significant opportunity to support a lot of the families in the schools and on the weekends it's that's not unusual for students to be filling up bags of groceries for some of the students in their schools to I need some food over the weekend and so this hub. This opportunity really expands on that particular model. And of course one of the things we want to make sure someplace is an opportunity for our local medical agencies to have an exam room or have a place where students if necessary, and/or parents and people from the neighborhood might be able to once a week be able to see a doctor and come in and see a doctor if they are not feeling well and or an opportunity for a dental chair to be there so that a student could have a quick exam. I'm guessing eyeglasses hearing all that stuff probably titrated. I can totally see great advantage of having community schools. I don't know if our community knows that we have this here know that they really been developing and so couple of years ago we brought the programs and we actually hired about what's called a community schools coordinator and it's really been that person's job over the last couple of years to start cultivating relationships and start making know some of these things happen. I think what's really cool about the community schools model is that we've got Hamilton and we have Northside right now is our community schools. There could be more in the future, but we have those two schools and a well they are community schools there community school programming does not have to look the same. It's not the standardized approach to this. It really is intended to be one that's reflective of what the community in the neighborhood largest thing. For instance at Hamilton we went through the process there of having several meetings with community members and with members in that particular neighborhood what's needed here at the Hamilton school. How can the schools serve to support you better in some of the needs that you have as parents, we received a treasure trove of ideas that actually were starting to bring into play and part of it was to make it a community school provides someone there to provide supports that person who's there is typically one that has other connections in the community. It doesn't need to be a social worker, but is able to support a family who might need a year this family. You might need something else and it's just it's another touching point for families and for parents who need supports along the way. This is part of the role of the community, school, community school is to make sure that we're doing things that the tenant level is much as we can. The playing field so that when that student comes to school. That student knows my mom my dad my guardians however are welcome in this particular school. I'm welcome in this particular school. This is my place. I love this place. I'm learning these things and were backfilling with experiences along the way. So it's a very complex thing that goes on with these and were just in the starting phases of our community schools, but I am really excited about what the future holds for the committee to schools and how they can really really become the hubs of those neighborhoods and go further than that. Thanks, Randy. I'm looking forward to our next extraneous conversation retiring superintendent of schools Randy Nelson is excavating time as a podcast for hire.com]]>https://api.spreaker.com/episode/26797461Wed, 13 May 2020 23:22:55 +0000Produced by Podcast For HireContact School District of La Crosse 807 East Avenue South La Crosse, Wisconsin 54601 (608) 789-7600 https://www.lacrosseschools.org/ Transcription is for SEO only This is Randy Nelson and this is an edition of extra innings as a retiring...807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

This is Randy Nelson and this is an edition of extra innings as a retiring superintendent of schools. Many things run across my mind when I reflect on 37 years of education, what's happened in those 37 years. What we been doing in our schools and even what's on the horizon to help facilitate the discussion. I've enlisted the assistance of Mr. Bob Schmidt past radio talkshow host a parent and a friend. Take one of the things that is change. I think a lot since my kids were little to now is is community schools. We tend to have more community schools than we did 15 years ago. One could argue that our community schools have always been committed to schools in that they serve neighborhoods. We believe that neighborhood schools are really important part of who we are but a community school model intensifies what it means to be a neighborhood school and that neighborhood school really sees that's this is where we bring our children love our school whatever staff we love everything that happens inside of our school for involving the PTO, etc. but the community school model is one that actually intensifies it by creating more connections, not just with parents and not just of students but with organizations in that particular neighborhood whether those would be churches or where they would be be businesses creating opportunities for many mentorships resources to come in to play bring them thinking in a place where, especially parents of children who maybe don't feel either welcome or comfortable in other settings can come to their local community school and they can be welcome there, and there are resources there for that to support them, etc. so this is the notion of community school. I'm real proud that how I think were in our third year of community school operations, both at Northside elementary school and also at Hamilton elementary school. So, explain the difference between a neighborhood school and community school that so that the neighborhood school is really about geographic location right, but a community school takes the geographic location and says what does this neighborhood have to offer the school and how can we bring it into the school. For instance, in one of the things we talked about before is in a community school model perhaps partnering with a laundromat or perhaps in bringing in for instance a washer and dryer so that the student a who may not have had an opportunity to have their clothes washed for several days. They can be washed at school. We can take care that we can support that we can support the parent we can support the students. We also talked about making sure that in a community school that we have. For instance, classroom space for adult learning so that parents who, for instance, would like to have a class running there that me know maybe through a partnership with one of our higher Ed agencies Western or Viterbo or UW well that actually in an adult course can be run right there make minutes parenting course. Maybe it's a course on marketing. Maybe it's a corrupt business course we want to turn out to be a hub where that particular parent or any parent can send this is my school and on a drop in here. Both of those schools have a pretty significant opportunity to support a lot of the families in the schools and on the weekends it's that's not unusual for students to be filling up bags of groceries for some of the students in their schools to I need some food over the weekend and so this hub. This opportunity really expands on that particular model. And of course one of the things we want to make sure someplace is an opportunity for our local medical agencies to have an exam room or have a place where students if necessary, and/or...]]>368community,education,lacrosse,nelson,public,randy,retiring,safety,school,schools,schoolsafety,superintendent,support,teachers,wisconsinfalsefullhttps://www.spreaker.com/episode/e3-referral-staffing-solutions-what-is-the-first-step-to-finding-the-right-job--27088234https://www.referralstaffingsolutions.com/
200 Mason St STE 18, Onalaska, WI 54650
608-790-9075
Transcription is for seo purposes only.

What is the first step to finding the right job. The first of the finite upper really identifying what's important is incredibly important to look at, like water, the dealbreaker and what the ideal one other thing that we talk to you with prospective employees is what works with your life. You know what schedule are you looking for what okay what echolocation all that stuff sounds kind of no-brainer – but we can have a perfect job but you have to drive our everyday and not just not doable. It's important to identify the items that are not going to work for you and those items that are really really important you and they are done will will look at the ideal list and left me ideal to make sure never cutting any corners and not looking at any position that Joan match the dealbreaker in their idealist decide what organization, for that matter shall be how important this is to have a good resume having a good resume is very important. Many companies use artificial intelligence to cancer resume before a person ever sees them at referral English and we do look at resumes regardless if they're good or not. We do know that people are not professional resume writer. Generally, it is very important to make sure that you're still Butler clearly identified on your resume so that what you are missing great opportunities with those organizations that do use artificial intelligence to rescan resumes prior to having conversation so there are a lot of different choices out there for finding a job and for finding employees. Why did you start referral staffing referral for English and because I noticed with the other agencies I've worked with that. It was becoming more of a cookie-cutter black-and-white option for for all companies and I didn't feel that that was the best approach. I felt like the best part is really a customized approach for each client. Because each client has different needs in the area of the biggest area that I know that room for improvement and is often vilified a thing of the artificial intelligence that I had mentioned can really break down those hard skills and break down the basic skills are needed. But if there's a personality conflict a personality issue that something that artificial housing will not identify. And that's really where we come in. We can understand the culture understand that the person that employees will be working with and for in your very best to find the right person is going to match not only from the Hartfield standpoint but also from the Fox guilty and flaky and the culture you mention hard skills and soft skills. What does that mean so hard skills is basically the skill set that could be working with Microsoft office that could be working with a caliper or Nick micrometer. It could be programming against the machine, the Hartfield are the black and white, math, reading, writing that type of thing. The soft skills are more of the personality side more of the conflict resolution more of the emotional intelligent lady bid the way that you respond to different situations different scenario. We all had a revised or updated literary someone in our life that we just did not see eye to eye with it doesn't necessarily mean that the applicant is wrong or you're wrong just the way that you guys handle situations with your thoughts skills. Many doesn't mesh with that person is important that both off don't line up the when there are challenging situations that happen in the workplace. It will be handled appropriately and everybody go home feeling good about their day]]>https://api.spreaker.com/episode/27088234Mon, 11 May 2020 17:00:17 +0000Produced by Podcast For HireFor more information on Referral Staffing Solutions visit our website at https://www.referralstaffingsolutions.com/ 200 Mason St STE 18, Onalaska, WI 54650 608-790-9075 Transcription is for seo purposes only. What is the first step to finding the...https://www.referralstaffingsolutions.com/
200 Mason St STE 18, Onalaska, WI 54650
608-790-9075
Transcription is for seo purposes only.

What is the first step to finding the right job. The first of the finite upper really identifying what's important is incredibly important to look at, like water, the dealbreaker and what the ideal one other thing that we talk to you with prospective employees is what works with your life. You know what schedule are you looking for what okay what echolocation all that stuff sounds kind of no-brainer – but we can have a perfect job but you have to drive our everyday and not just not doable. It's important to identify the items that are not going to work for you and those items that are really really important you and they are done will will look at the ideal list and left me ideal to make sure never cutting any corners and not looking at any position that Joan match the dealbreaker in their idealist decide what organization, for that matter shall be how important this is to have a good resume having a good resume is very important. Many companies use artificial intelligence to cancer resume before a person ever sees them at referral English and we do look at resumes regardless if they're good or not. We do know that people are not professional resume writer. Generally, it is very important to make sure that you're still Butler clearly identified on your resume so that what you are missing great opportunities with those organizations that do use artificial intelligence to rescan resumes prior to having conversation so there are a lot of different choices out there for finding a job and for finding employees. Why did you start referral staffing referral for English and because I noticed with the other agencies I've worked with that. It was becoming more of a cookie-cutter black-and-white option for for all companies and I didn't feel that that was the best approach. I felt like the best part is really a customized approach for each client. Because each client has different needs in the area of the biggest area that I know that room for improvement and is often vilified a thing of the artificial intelligence that I had mentioned can really break down those hard skills and break down the basic skills are needed. But if there's a personality conflict a personality issue that something that artificial housing will not identify. And that's really where we come in. We can understand the culture understand that the person that employees will be working with and for in your very best to find the right person is going to match not only from the Hartfield standpoint but also from the Fox guilty and flaky and the culture you mention hard skills and soft skills. What does that mean so hard skills is basically the skill set that could be working with Microsoft office that could be working with a caliper or Nick micrometer. It could be programming against the machine, the Hartfield are the black and white, math, reading, writing that type of thing. The soft skills are more of the personality side more of the conflict resolution more of the emotional intelligent lady bid the way that you respond to different situations different scenario. We all had a revised or updated literary someone in our life that we just did not see eye to eye with it doesn't necessarily mean that the applicant is wrong or you're wrong just the way that you guys handle situations with your thoughts skills. Many doesn't mesh with that person is important that both off don't line up the when there are challenging situations that happen in the workplace. It will be handled appropriately and everybody go home feeling good about their day]]>265business,hire,hiring,hr,interview,jobs,jobseeker,jobservice,lacrosse,onlalaska,opportunity,payroll,referral,resume,service,shobi,solutions,staff,staffing,trainingfalsefullhttps://www.spreaker.com/episode/e2-referral-staffing-solutions-why-would-a-business-hire-you--26514883https://www.referralstaffingsolutions.com/
200 Mason St STE 18, Onalaska, WI 54650
608-790-9075
Transcription is for seo purposes only.

Why would a business need to hire you many reasons choose to work with referral staffing solutions and one reason would be the timing though the economy has recently changed the think of right now I you identify the account we had time to go through phone interview internal interviews and really screen out of town but not going to be the right fit shall be both internal and external clients basically of people coming and looking for jobs and people that are looking for you to help them to fill those jobs. Why would somebody go to you to have a job filled rather than doing it on their own. Right now everything one of the biggest reasons with with the current economic date with covid 19 with the uncertainty that is a major reason like you are coming to. Currently, there are many different rules and regulations that are changing on a daily basis. So many people that are in the HR side of things are spending their days digging through the information trying to understand it making taking care of our current employee with that. They don't necessarily have the time to do the recruiting and breathing, but the needs are still there for the week that we also have the that has been a massive increase in their needs, but are nervous to hire on their own because they don't know how long another great fighter we can step in weakness, for we can really help bridge that gap and it doesn't turn into permanent and if they don't, we can help those individuals with another opportunity, protesting continue to shift and change and evolve. So I asked how referral staff helped out a business, how does it help out an individual looking for a job so we help D. The jobseekers that come to us in many different ways. One of the most important thing to know is that when they come to a wanted money and number two when they come to what we can look at their skin or fat look at their need for and look at their want and compare multiple different job putting out 15 resume one resume and one application of multiple different job and the best opportunity with you important one application, multiple opportunities and one of the biggest reasons that employees come, once all this back to normal. Is it going to be easier or harder to find a job. Don't know yet. I can say that the effect based on the number of baby boomers that are going to be leading the job market. I think that it going to stay in employees market for a very long time. I think there's a little road right now but I think by the end of 2020. Beginning in 2021 think they're probably going to be getting back to a tight labor market like they have been for a number of years just needed a number of people are going to be retiring and the number of doctors are going to be filled]]>https://api.spreaker.com/episode/26514883Mon, 04 May 2020 17:20:15 +0000Produced by Podcast For HireFor more information on Referral Staffing Solutions visit our website at https://www.referralstaffingsolutions.com/ 200 Mason St STE 18, Onalaska, WI 54650 608-790-9075 Transcription is for seo purposes only. Why would a business need to hire you...https://www.referralstaffingsolutions.com/
200 Mason St STE 18, Onalaska, WI 54650
608-790-9075
Transcription is for seo purposes only.

Why would a business need to hire you many reasons choose to work with referral staffing solutions and one reason would be the timing though the economy has recently changed the think of right now I you identify the account we had time to go through phone interview internal interviews and really screen out of town but not going to be the right fit shall be both internal and external clients basically of people coming and looking for jobs and people that are looking for you to help them to fill those jobs. Why would somebody go to you to have a job filled rather than doing it on their own. Right now everything one of the biggest reasons with with the current economic date with covid 19 with the uncertainty that is a major reason like you are coming to. Currently, there are many different rules and regulations that are changing on a daily basis. So many people that are in the HR side of things are spending their days digging through the information trying to understand it making taking care of our current employee with that. They don't necessarily have the time to do the recruiting and breathing, but the needs are still there for the week that we also have the that has been a massive increase in their needs, but are nervous to hire on their own because they don't know how long another great fighter we can step in weakness, for we can really help bridge that gap and it doesn't turn into permanent and if they don't, we can help those individuals with another opportunity, protesting continue to shift and change and evolve. So I asked how referral staff helped out a business, how does it help out an individual looking for a job so we help D. The jobseekers that come to us in many different ways. One of the most important thing to know is that when they come to a wanted money and number two when they come to what we can look at their skin or fat look at their need for and look at their want and compare multiple different job putting out 15 resume one resume and one application of multiple different job and the best opportunity with you important one application, multiple opportunities and one of the biggest reasons that employees come, once all this back to normal. Is it going to be easier or harder to find a job. Don't know yet. I can say that the effect based on the number of baby boomers that are going to be leading the job market. I think that it going to stay in employees market for a very long time. I think there's a little road right now but I think by the end of 2020. Beginning in 2021 think they're probably going to be getting back to a tight labor market like they have been for a number of years just needed a number of people are going to be retiring and the number of doctors are going to be filled]]>233business,covid19,hire,hiring,hr,interview,jobs,jobseeker,jobservice,lacrosse,onlalaska,opportunity,payroll,referral,resume,service,solutions,staff,staffing,trainingfalsefullhttps://www.spreaker.com/episode/e17-chris-jones-1-word-covid19-2-and-baby-name--26514831Transcription for seo purposes only
Chris Jones podcast were back is the second time that were doing this or doing it that will you honestly most of our podcast have been just as we been social distancing, but this is the true social distancing one word Chris Jones podcast reason is that it's true, is because we have to be social distancing now because the way the world is shut down. Chris, the only thing running in and yeah and that you know that the people out there delivering Amazon to psych, Amazon, post office, UPS, FedEx, all those guys are out there men and women are out there delivering packages to everybody and that is people like us that are staying at home and leaving our packages at home. You don't like them they are great for that, and I loved it all. And I will become the perfect payoff. It was something as it was a pleasant home is worth the wait. Or not. Lately you instead of being in front of an audience you doing a different type of audience to see you on Facebook live all the time now showing off how to do some different things and on the other day as a plan you in your beautiful bride mother to be our planes and foosball and it looks like you cheated for the first couple, but I'm sure that you probably end up winning that game I did when when there's a camera on her discrete I don't know well you know what I totally think her to also today there are two against one right. I used to be in front of people like to. That's the whole thing yeah it was my right, you don't need makeup and I'm arty like. I learned how to do magic trick. Watching you watching your IDE or Facebook videos I taught how to turn a small coin into two large going to need to change it. So you're going to bronze coins. Whatever you want from the magic that you know I mean, that's so cool in those traits. They say that I hundred one? Which is true but you buying for only two tricks you though. I read the book. Have you so have you ever done magic in front of people I know that you know that you do as I kiss your you know, me just a magician as if you well, but you're basically listed as a comic right yeah last night and magic was a fundraiser for young boys and family counseling and his parents created a foundation anti-bullying and they give money to first responders. The two things he cared about was being nice people, not bullying, and the character by what we should and women purchased on the greater foundation I went to Burlington, Wisconsin, and that little coffeehouse did poetry and they played in the band and I did magic and I get a card trick and I had a few drinks and beautiful, like the fact that he got a drink, absolutely. Well, you would know that because you're a college graduate from from Utah Valley University Wisconsin crossed and I don't know if I have a lot of people know this about you or not but you were a new model when you're here, but you also gave a scholarship seedless scholarship at UW well because you graduated from here. I had a really great teacher, Dr. Ronald he called me about the blue I never met before, my guess reach out to the school and he says were trying to get new faces in the ring at your 78. Waiver. If we can, so I'm trying for anyone coming from out of state to get that thing discount price that's my hope that you pretty cool to come back to the cross. I think timber said a lot world is open again on the back of the car that you make sure that I'm available for those for that time because I know the last time you're in town. I think we got we got together we did a podcast from him Riverside Park and submit. Remember, people were eating lunch, and a minute staring at them they just walked away or like five and you videotape the two did you ever do anything of it at all I have. I thought yesterday that the people thing, according to just go draw your old furniture. Like all that I went to Japan and never edited into the video like literally like I need to get on that. Speaking of Japan, and the owners of rain sucks her friend Shane is in Japan now and is in there for a couple years but I saw that he liked the post that you posted about you being a dad in your holding a doll baby doll baby girl doll upside down by the foot. Great that you do it that way, did you how did you do that you just come out of a hat. So did you do that, just for a fact not know but when I went to the girl we just want to help each other so I can write but it was a black light hanging by one leg but my friend you like. I got the girl yeah yeah either way that can be applied. Is it scary to have a daughter. You have got I think I'm going to do my best to say look like she's gorgeous how did I get hurt line my ass off. I yeah look out the guys are just charmers like how you dad Marriott because he was nice was polite and patient. I know you your very book smart you what you do a lot of reading and stuff. If you ever thought of writing a book I need to have my page is set up a lot in this room literally with the dog and just get to typing away how ADD is Chris Buckley's rainy days I will. But you know YouTube doesn't stop and then I might have been writing for while it is a reward to get some coffee and then on I had been drinking since my wife is pregnant like literally since we found out that she is weak, 15 and 15 weeks we shared My carbonate yeah good for you have you can pick out a name yet know. So please, we need to ground and meet some girl names. I think what is got a girl name that the thing to be awesome for for Chris and Stacy's baby give Chris an email and it's one word got Joan Miller and whoever raises enough money for the name of their choice that will but like it college or career fund and that you can name the child so I explained to explain this to me explain this to him to us right now. So if somebody has a name that they want to you is someone I like I really want daughter you give us enough money. I think that will Let them go to her college career even want to name honey and you pay five grand so how do something about making a donation to the to the baby Jones file all have to give them my then know which day but yeah we will make it happen because if you want to name a kid doesn't belong to you, you're okay with me and live type of person is the one word Chris Jones podcast podcast]]>https://api.spreaker.com/episode/26514831Fri, 01 May 2020 18:13:15 +0000Produced by Podcast For HireChris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The...Transcription for seo purposes only
Chris Jones podcast were back is the second time that were doing this or doing it that will you honestly most of our podcast have been just as we been social distancing, but this is the true social distancing one word Chris Jones podcast reason is that it's true, is because we have to be social distancing now because the way the world is shut down. Chris, the only thing running in and yeah and that you know that the people out there delivering Amazon to psych, Amazon, post office, UPS, FedEx, all those guys are out there men and women are out there delivering packages to everybody and that is people like us that are staying at home and leaving our packages at home. You don't like them they are great for that, and I loved it all. And I will become the perfect payoff. It was something as it was a pleasant home is worth the wait. Or not. Lately you instead of being in front of an audience you doing a different type of audience to see you on Facebook live all the time now showing off how to do some different things and on the other day as a plan you in your beautiful bride mother to be our planes and foosball and it looks like you cheated for the first couple, but I'm sure that you probably end up winning that game I did when when there's a camera on her discrete I don't know well you know what I totally think her to also today there are two against one right. I used to be in front of people like to. That's the whole thing yeah it was my right, you don't need makeup and I'm arty like. I learned how to do magic trick. Watching you watching your IDE or Facebook videos I taught how to turn a small coin into two large going to need to change it. So you're going to bronze coins. Whatever you want from the magic that you know I mean, that's so cool in those traits. They say that I hundred one? Which is true but you buying for only two tricks you though. I read the book. Have you so have you ever done magic in front of people I know that you know that you do as I kiss your you know, me just a magician as if you well, but you're basically listed as a comic right yeah last night and magic was a fundraiser for young boys and family counseling and his parents created a foundation anti-bullying and they give money to first responders. The two things he cared about was being nice people, not bullying, and the character by what we should and women purchased on the greater foundation I went to Burlington, Wisconsin, and that little coffeehouse did poetry and they played in the band and I did magic and I get a card trick and I had a few drinks and beautiful, like the fact that he got a drink, absolutely. Well, you would know that because you're a college graduate from from Utah Valley University Wisconsin crossed and I don't know if I have a lot of people know this about you or not but you were a new model when you're here, but you also gave a scholarship seedless scholarship at UW well because you graduated from here. I had a really great teacher, Dr. Ronald he called me about the blue I never met before, my guess reach out to the school and he says were trying to get new faces in the ring at your 78. Waiver. If we can, so I'm trying for anyone coming from out of state to get that thing discount price that's my hope that you pretty cool to come back to the cross. I think timber said a lot world is open again on the back of the car that you make sure that I'm available for those for that time because I know the last time you're in town. I think we got we got together we did a podcast from him Riverside Park and submit. Remember, people were...]]>4811word,baby,bswithbob,chris,communication,corona,covid19,dad,fatherhood,goals,hypnotist,jones,justtalking,listening,microcast,name,one,oneword,patience,talkingfalsefullhttps://www.spreaker.com/episode/e1-referral-staffing-solutions-we-make-people-comfortable--26237395https://www.referralstaffingsolutions.com/

Transcription is for seo purposes only.

One thing that we do is we make people very very comfortable so they can give us the answer
is that maybe they wouldn't give if they were out interviewing with client directly to get more of
the real answer. That way you people become good question. A good quest and I think it is like
to think that we do so they best but so everybody been to what men right very low food. There's
a different right there difference when you walk in the woodland birds on the walking difference
when you walk into a Casey's general store versus the quick trip right like one of them you feel
welcomed one of my show I can and can we really want to be the quick trip we really want to be
the festival. The one thing that we do when one candidate derive a great sound to make it feel a
little more personal. We care about you and coffee or water which isn't really a big thing for child
make them feel comfortable with where they're at. That's kind of the first portion of that we want
to know what you really want. Let's talk about that unit even meet you Nell Ford having a
conversation. I don't know if it's a skill that can be taught, necessarily, is definitely one of those
soft skills that we look for when were interviewing for internal candidate work for reprocessing
pollution want to make sure that the people have that ability to build some reporter wish I
candidate shall be new marker is the owner will fully staffing's. Why did you start your own
agency reprocessing pollution because I thought out there for an organization to really help
multiple company I saw the need to have partnerships with organizations in the area and I really
noticed that not a one stop shop is very important to understand and get to know each client
and each individual me and cut my program for that I am having a one-size-fits-all approach and
that's what referral was employed as well get to know our client get number supervisors that are
hiring more employees and not just Elkhart but also those soft skills that are so what is her
staffing and recruitment agency. What is it what's it all about. We are a matchmaker be what we
do is we identify a client needs. We talk to them about areas where they're struggling or areas
where they could get additional help within their company within their department. We really get
to know what soft skills are needed, as well as what Hartfield are needed. We we can look at
the resume and maps of Hartsville pretty easily like a computer system can essentially do that
for you where we really specialize it will get those soft skills and understanding what the needs
are to make a successful match not only with Elkhart silk but with the well not just a quick
match. It's a long-term sofa looking for jobs or cost me money to come in and talk to referral
seven absolutely not. Absolutely not. We do not charge any of our jobseekers anything that we
offer. What's the difference between the fully staffing solution's in one of the big names in

everybody's hurdles we really come from either approach per client versus having a one-size-
fits-all approach and what that means is we we get to know our client get to know what the

needs are get to know the culture really of the company that were were looking for candidates
for the we can match not only the yellow but that employee has, but also the culture that is
going to fit with the company]]>https://api.spreaker.com/episode/26237395Tue, 28 Apr 2020 00:44:23 +0000Produced by Podcast For HireFor more information on Referral Staffing Solutions visit our website at https://www.referralstaffingsolutions.com/ Transcription is for seo purposes only. One thing that we do is we make people very very comfortable so they can give us the answer...https://www.referralstaffingsolutions.com/

Transcription is for seo purposes only.

One thing that we do is we make people very very comfortable so they can give us the answer
is that maybe they wouldn't give if they were out interviewing with client directly to get more of
the real answer. That way you people become good question. A good quest and I think it is like
to think that we do so they best but so everybody been to what men right very low food. There's
a different right there difference when you walk in the woodland birds on the walking difference
when you walk into a Casey's general store versus the quick trip right like one of them you feel
welcomed one of my show I can and can we really want to be the quick trip we really want to be
the festival. The one thing that we do when one candidate derive a great sound to make it feel a
little more personal. We care about you and coffee or water which isn't really a big thing for child
make them feel comfortable with where they're at. That's kind of the first portion of that we want
to know what you really want. Let's talk about that unit even meet you Nell Ford having a
conversation. I don't know if it's a skill that can be taught, necessarily, is definitely one of those
soft skills that we look for when were interviewing for internal candidate work for reprocessing
pollution want to make sure that the people have that ability to build some reporter wish I
candidate shall be new marker is the owner will fully staffing's. Why did you start your own
agency reprocessing pollution because I thought out there for an organization to really help
multiple company I saw the need to have partnerships with organizations in the area and I really
noticed that not a one stop shop is very important to understand and get to know each client
and each individual me and cut my program for that I am having a one-size-fits-all approach and
that's what referral was employed as well get to know our client get number supervisors that are
hiring more employees and not just Elkhart but also those soft skills that are so what is her
staffing and recruitment agency. What is it what's it all about. We are a matchmaker be what we
do is we identify a client needs. We talk to them about areas where they're struggling or areas
where they could get additional help within their company within their department. We really get
to know what soft skills are needed, as well as what Hartfield are needed. We we can look at
the resume and maps of Hartsville pretty easily like a computer system can essentially do that
for you where we really specialize it will get those soft skills and understanding what the needs
are to make a successful match not only with Elkhart silk but with the well not just a quick
match. It's a long-term sofa looking for jobs or cost me money to come in and talk to referral
seven absolutely not. Absolutely not. We do not charge any of our jobseekers anything that we
offer. What's the difference between the fully staffing solution's in one of the big names in

everybody's hurdles we really come from either approach per client versus having a one-size-
fits-all approach and what that means is we we get to know our client get to know what the

needs are get to know the culture really of the company that were were looking for candidates
for the we can match not only the yellow but that employee has, but also the culture that is
going to fit with the company]]>265business,hire,hiring,hr,jobs,jobservice,lacrosse,onlalaska,payroll,referral,resume,service,solutions,staff,staffing,trainingfalsefullhttps://www.spreaker.com/episode/e1-leaderethics-wisconsin-what-is-leaderethics--25850600
Transcription is for seo purposes only,
What is leader ethics Wisconsin. Thanks for the opportunity to chat about this Bob leader ethics Wisconsin is a nonprofit, nonpartisan organization is committed to promoting ethical leadership among elected officials. We believe that there are four principles that define ethical leaders truthful the transparent with public information. Their unifier's rather than dividers in the work to the best of their ability to represent their entire constituency, and as such we don't believe ethical leadership is tied to any particular political party, or even to any particular legislative policy because an ethical leader can approach those things. Following those principles and have options and how they can demonstrate it so leader ethics Wisconsin is there to bring about increased awareness and the need for this in our elected leaders then tell me who is Lee Rasch well you know I I lived in the Chicago area for a number years and prior to coming to La Crosse I worked at a large community college in the suburbs. It was a good college in many ways, but it was not founded on what I would call ethical principles, they lacked integrity, and in some of their hiring practices and marketing practices, and it was really the catalyst for me coming up to La Crosse and in 1989 and I assume the role of president that Western technical College and what I realized is that many of the practices that I brought with me to Western practices that I learned in suburban Chicago and so I actually spent several years trying to unlearn things that I had been doing in the past and learn things in a new way that I felt was better reflecting what the college needed and what I needed to demonstrate and solve those are things that I worked on over the years in an effort to be more character-based and a servant leader and practice Lee. What's the difference between leadership and servant leadership and ethical leadership. I think the terms are somewhat interchangeable in my view, those four principles are critical for not just Anna in the political world really the kinds of things that ethical leaders servant leaders follow and practice in business, education, healthcare services and so those are the things were trying to promote as expectations for elected leaders think that this way, if you are buying service or or product from a local company do you expect that the company will operate the ethical leadership if you're school that where you can still has an administrative you expect that person to be an ethical leader. People don't always deliver to the level that you hope. But there's an effort and an expectation that they would. So the question we would ask, why don't we carry those same expectations in the political arena and those of the things were trying to talk about in the direct Scott commit example of one of the member eventually well. Each chapter holds a member of an quarterly. I think one good example would be right brewed a vice president at their own power Cooperative, who was also a former leader, president of the state Senate in Wisconsin. His topic was countering political tribalism and that's an important topic today because the more we become partners in our beliefs than the farther we are away from being able to unify our efforts and to represent our entire constituency, so is a really good presentation. There was a lot of good interaction and we was good to hear from someone who's who's been there. What your goal for leader ethics was constantly in all, the goal is more than anything else. It is getting citizen involvement in raising expectations that are ethical leaders are elected leaders can be ethical leaders and you know we we provide a a citizens guide for 2020 is something that we shared with our members because we want them to realize there are big things and small things they can do in the state of North Dakota, for example, the state is dominated by one political party, and the fact they are ranked very low nationally in terms of transparency, a group of citizens they call themselves the bad ass grandmas. They took upon themselves to start a process to pass a new constitutional amendment that would improve transparency and implement an ethics commission. They were outspent more than 10 to 1 in that effort. This was in 2018 yet the legislation passed and it shows that when citizens take it upon themselves to the right thing they can produce really good results. So we want to share those stories with our members. How is a pandemic, telling of who is ethical and who is not ethical in the political arena will you know the pandemic is really calling out the importance of ethical leadership. We think of it this way when we need at a time when we are facing a threat, nonpartisan threat. It's a threat that's affecting potentially all of us so we need to look at those four principles we need ethical leaders at the federal and state and local level who were truthful giving us straight information. We need leaders who are transparent with public information and this is particularly difficult because in a pandemic like this. The conditions may be rapidly changing and so it's difficult to present something as accurate information. Knowing that it might evolve and change in a short period of time, but ethical leaders can be straightforward and how they present things and do the best they can. Transparency it's really important that we are unifying at this time, we should not be trying to divide our perspectives in the political and partisan views. We really need to represent the needs of the entire country or state in this effort. In a course that means representing our entire constituency in the process of not taking sides or singling out groups for favorable treatment or blaming. So at this time and that in a pandemic we really need ethical leaders to shine. So why would somebody want to become a member of leader ethics Wisconsin. But first of all, membership allows you to be a part of the effort and it's a simple process if you go to our website, leader, ethics WI.org on the homepage. There is a button since joining the press that button and you can follow the steps and you can become a member. It's a very affordable effort $25 a year. In fact, if you are age 23 or younger. It's $10 here. Your goal is to be as accessible for auspice not just those that have money, but by becoming a member, you get a monthly newsletter called the ethics report where we give examples of good ethical leadership in practice and examples that are not so good. We invite you to those quarterly chapter events. We also give every chapter an opportunity to hold a candidate development workshop and such. Try to develop the next generation of ethical leaders starting with local school boards, city Council. So those are things that happen if you become a member of leader ethics Wisconsin gives you a chance to be a part of that process. Why is $25 to join and we had a lot of discussion on this and I was a conscious decision by the board in your organization to make engagement and leader ethics. Wisconsin is available and is affordable for everyone. And we didn't want to have funds coming from private organizations or individuals that would raise questions about who's pulling the strings on this effort, we want this to be something that a citizen led and grassroots in every way. Do you think it's possible to change expectations with leader ethics Wisconsin were not naïve about this. We understand that the challenges are huge. But if we stay persistent with this. We think over time we can make that difference I think back to an example of when I was a freshman in college and I was sitting in psychology class and I had a portable ashtray in my left hand and I was chain-smoking cigarettes and I wasn't the only one there were others in the class to. In fact, the air was blue when you think of that image today. It just seems so foreign. But you know the change in that expectation didn't happen in one piece of legislation. It didn't happen in one year. It happened in lots of ways at the legislative level at the organizational level over many years. We think if we stay persistent with this and we continue to have the conversation, consistently in many different communities over time. Yes, we can bring about the change and we can see better ethical leadership in the political.]]>https://api.spreaker.com/episode/25850600Tue, 21 Apr 2020 15:53:23 +0000Produced by Podcast For HireFor more information on Leader Ethics Wisconsin please visit their website at leaderethicswi.org Transcription is for seo purposes only, What is leader ethics Wisconsin. Thanks for the opportunity to chat about this Bob leader ethics Wisconsin is a...
Transcription is for seo purposes only,
What is leader ethics Wisconsin. Thanks for the opportunity to chat about this Bob leader ethics Wisconsin is a nonprofit, nonpartisan organization is committed to promoting ethical leadership among elected officials. We believe that there are four principles that define ethical leaders truthful the transparent with public information. Their unifier's rather than dividers in the work to the best of their ability to represent their entire constituency, and as such we don't believe ethical leadership is tied to any particular political party, or even to any particular legislative policy because an ethical leader can approach those things. Following those principles and have options and how they can demonstrate it so leader ethics Wisconsin is there to bring about increased awareness and the need for this in our elected leaders then tell me who is Lee Rasch well you know I I lived in the Chicago area for a number years and prior to coming to La Crosse I worked at a large community college in the suburbs. It was a good college in many ways, but it was not founded on what I would call ethical principles, they lacked integrity, and in some of their hiring practices and marketing practices, and it was really the catalyst for me coming up to La Crosse and in 1989 and I assume the role of president that Western technical College and what I realized is that many of the practices that I brought with me to Western practices that I learned in suburban Chicago and so I actually spent several years trying to unlearn things that I had been doing in the past and learn things in a new way that I felt was better reflecting what the college needed and what I needed to demonstrate and solve those are things that I worked on over the years in an effort to be more character-based and a servant leader and practice Lee. What's the difference between leadership and servant leadership and ethical leadership. I think the terms are somewhat interchangeable in my view, those four principles are critical for not just Anna in the political world really the kinds of things that ethical leaders servant leaders follow and practice in business, education, healthcare services and so those are the things were trying to promote as expectations for elected leaders think that this way, if you are buying service or or product from a local company do you expect that the company will operate the ethical leadership if you're school that where you can still has an administrative you expect that person to be an ethical leader. People don't always deliver to the level that you hope. But there's an effort and an expectation that they would. So the question we would ask, why don't we carry those same expectations in the political arena and those of the things were trying to talk about in the direct Scott commit example of one of the member eventually well. Each chapter holds a member of an quarterly. I think one good example would be right brewed a vice president at their own power Cooperative, who was also a former leader, president of the state Senate in Wisconsin. His topic was countering political tribalism and that's an important topic today because the more we become partners in our beliefs than the farther we are away from being able to unify our efforts and to represent our entire constituency, so is a really good presentation. There was a lot of good interaction and we was good to hear from someone who's who's been there. What your goal for leader ethics was constantly in all, the goal is more than anything else. It is getting citizen involvement in raising expectations that are ethical leaders are elected leaders can be ethical leaders and you know we we provide a a citizens guide for 2020 is something that we shared with our members because we want them to realize there are big things and small things they can...]]>646candidate,change,development,ethics,honesty,hope,leader,leaderethics,leaderethicswi,leadership,lee,nonpartisan,podcast,podcastforhire,politics,rasch,speaker,unifier,wisconsinfalsefullhttps://www.spreaker.com/episode/e4-city-of-la-crosse-mayor-kabat-covid-19--25551312www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

The city of La Crosse 2020 vision podcasts were set up to talk about things the future. However, in a time of crisis. In the time of the coalbed 19 needed to talk about was going on around us today. Mayor Tim Kabat is our guest and Mayor wherein unprecedented times now, with the coveted 19 and basically the shutdown of not only it out neighborhood cities states that the country is basically shut down Mayor Raga little hello I know that you know more than 100 years ago Spanish influenza back in 1918 and all that it was probably somewhat of a similar situation, but there's not a lot of us alive back then. So for all of us. It really is never experienced before, and I am one of the things I'm really impressed with our earlier larger area community is that people are taking seriously and trying to do the right thing by staying home and meeting interaction, and only making essential travel. So I think we all stay strong and keep itself will be able to get back to normal a little bit quicker Mayor what is the city of La Crosse doing in order to help the citizens. The few areas imagine our critical services email the emergency response and law enforcement to our streets and things like water and sewer service are our garbage pickup and recycling transit service. You know those things are are staying pretty much as it is been a few changes to those services. But for the most part, those are operating in the memory load and those are critical services that the community relies on having been drinking water in and waste disposal on all hats on board's efforts really continue to meet me make some changes to how staff can provide those services. So you been really gotten split shifts and she to schedule so that we don't have all of our team operating in the same place at the same time. Their goal is spread them out and have some folks that are on call versus being not even the officer in field so we made those changes but I think the most part that's not something that you would notice that your turn on your tap water are you know your your weekly garbage pick up whatever goes again are gone as planned, then the other working on the other efforts that we've done the will treating this obviously is a public health emergencies gone to our emergency operations center in a different structure for how the cities organize our fire chief and police chief fire are emergency managers in the brilliant stepped up to take the lead and so we do have a group that still working on our the operation but we've added no folks, now that work on logistics of trying to find in secure that personal protective equipment and other supplies and things that we can help with our our healthcare providers to secure whether that's again master gloves or grounds or whatever the case may be, hand sanitizers in those types of things so we really focused on trying to balance you know keeping our our stirrup services going and also just making sure that our public and our employees are very limited exposure and keeping them safe. Mayor Tim Kabat and I talking about the coalbed 19 and Mary surprised with the size of our community and how we've done better than other communities our size at stopping the spread and that having a slower amount of growth of people that have the coalbed 19 virus have been very impressed with that and I don't know that it really surprised, but I do feel like we we have lot of people taking very seriously and trying to follow the governor secret homeowner and people staying home keeping those social distancing good hygiene practices when they are having to go out. So I I'm hopeful that we can keep this momentum going to turn talk today I believe are 26 cases in nonsexual not had any guests here La Crosse County and then think just about anybody that has been a concern case has recovery so you want to keep that going. Again, it's really because the head of the other places around the country known around the world have experienced this people stay at home and avoid crowds and practice social distancing another you guys guys out there don't wear a mask Republican thing people are arguing that an I think that's what I'm seeing good results here in La Crosse County that we do have a lot of folks that are still on the to do this thing whether that's essential worker travel for groceries or the like… Doing good here and I hope we can keep it up I hope will start to see those numbers now actually start to go down at some point, Mayor one of the big questions I think a lot of people have is there's a lot of small businesses that are based in La Crosse and that are run out of homes and out of some of the great spaces that we have here La Crosse. What is the city of La Crosse doing to help out those small businesses we knew early on, especially when all the governor's order to close the bars and restaurants movement there will be a lot of hardship from a lot of people hurting big time as you said down that one of the things in La Crosse just such a special place in the amount of food that we have that are here owned locally that people in our community are loners, and so we knew that this would be some very dire times for walls owners in them policy for the employees. So we started to reach out, you know, we have one great staff in our our planning departments. They started reaching out to businesses going on trying to understand the impacts and what things the city could do to help out. So we have put together a grant program will not not a large amount of money but hopefully enough funding to get people can buy them some time and get them over the hump until larger efforts from the federal government and state government kicking button got out to a maximum of $25,000 business grant funding to help people out so that the city Council that last week and I think a big challenge is just going to be about the number of businesses that we already heard from ethically last column for more than 100 businesses here La Crosse that are interested in that assistance. And so will have to see how far dollars can go. That's one thing that again. We really wanted to show our business community that the city of La Crosse. Now scanning them as much as we possibly can in helping Naaman and employees follow the links for information are on the city's website at La Crosse duck will want people more information or questions or whatever they can glory. Men between Andrea and Jason are now calling parent or their tongue people trying to work with folks on that conducting similar challenges. The SBA loan almost thinking very bureaucratic program really just trying to make it when I can oversimplify it to make it just very cold so that there's not a lot of hoops to jump through Mayor Tim Kabat you have any words of encouragement for the community as a whole. Staying home being really diligent and strong even myself. I know where times and I recall going just a little stir crazy inside, but it is for the larger group because more people involved in them mostly for healthy and I find there are people out there that the signal think David exposed this and catch this virus with the difficult for them so you want to stay strong and really almost together as a community and encourage our residents to continue. Again, I just been so impressed and thankful that people are taking this very seriously and when there are absolute vessel. I think I wish everybody had their healthy and safe and I continued to practice the social distancing in good hygiene will get through this together.]]>https://api.spreaker.com/episode/25551312Wed, 15 Apr 2020 16:54:41 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com The city of La Crosse 2020 vision podcasts...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

The city of La Crosse 2020 vision podcasts were set up to talk about things the future. However, in a time of crisis. In the time of the coalbed 19 needed to talk about was going on around us today. Mayor Tim Kabat is our guest and Mayor wherein unprecedented times now, with the coveted 19 and basically the shutdown of not only it out neighborhood cities states that the country is basically shut down Mayor Raga little hello I know that you know more than 100 years ago Spanish influenza back in 1918 and all that it was probably somewhat of a similar situation, but there's not a lot of us alive back then. So for all of us. It really is never experienced before, and I am one of the things I'm really impressed with our earlier larger area community is that people are taking seriously and trying to do the right thing by staying home and meeting interaction, and only making essential travel. So I think we all stay strong and keep itself will be able to get back to normal a little bit quicker Mayor what is the city of La Crosse doing in order to help the citizens. The few areas imagine our critical services email the emergency response and law enforcement to our streets and things like water and sewer service are our garbage pickup and recycling transit service. You know those things are are staying pretty much as it is been a few changes to those services. But for the most part, those are operating in the memory load and those are critical services that the community relies on having been drinking water in and waste disposal on all hats on board's efforts really continue to meet me make some changes to how staff can provide those services. So you been really gotten split shifts and she to schedule so that we don't have all of our team operating in the same place at the same time. Their goal is spread them out and have some folks that are on call versus being not even the officer in field so we made those changes but I think the most part that's not something that you would notice that your turn on your tap water are you know your your weekly garbage pick up whatever goes again are gone as planned, then the other working on the other efforts that we've done the will treating this obviously is a public health emergencies gone to our emergency operations center in a different structure for how the cities organize our fire chief and police chief fire are emergency managers in the brilliant stepped up to take the lead and so we do have a group that still working on our the operation but we've added no folks, now that work on logistics of trying to find in secure that personal protective equipment and other supplies and things that we can help with our our healthcare providers to secure whether that's again master gloves or grounds or whatever the case may be, hand sanitizers in those types of things so we really focused on trying to balance you know keeping our our stirrup services going and also just making sure that our public and our employees are very limited exposure and keeping them safe. Mayor Tim Kabat and I talking about the coalbed 19 and Mary surprised with the size of our community and how we've done better than other communities our size at stopping the spread and that having a slower amount of growth of people that have the coalbed 19 virus have been very impressed with that and I don't know that it really surprised, but I do feel like we we have lot of people taking very seriously and trying to follow the governor secret homeowner and people staying home keeping those social distancing good hygiene practices when they are having to go out. So I I'm hopeful that we can keep this momentum going to turn talk today I believe are 26 cases in nonsexual...]]>5572020,business,city,cityvision,corona,covid,covid-19,infomation,kabat,lacrosse,lacrossewisconsin,mayor,podcast,safety,shelter,tim,virus,vision,wisconsinfalsefullhttps://www.spreaker.com/episode/e16-chris-jones-1-word-covid19--24854330https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.
Transcription for seo purposes only
One word Chris Jones podcast this month talking about what's on everybody's mind these days. Of course, talking Cove at 19th and Chris actually has a special guest with him though much better half of the of the equation there. Stacy is joining him for the first time Stacy, welcome to the podcast so things nowadays you guys basically have a whole life that's change you guys just got married, you're pregnant with their first child. You guys bought a house now were dealing with the pandemic and we all have to kind of shelter in place. How he has been dealing with that I think were doing pretty good I'm doing great. I really really enjoyed being your state how all department where there is so big and kind that will tell you what the few times that Chris is one I see the post on Facebook that he won so that's what friends are for. You have the option of talking your cell phone ringing with the TV or typing it in and I can't tell for ship and I can't talk so I'm like no I like I like the thousand points on the final Jeopardy in my five round my colleague like I can you please hey you probably way more colleges than anybody I know right like college that I got for the figure you think Dick Baker know nothing. So how is the one that you want the chess games. Oh, I can beat my wife and shut public connect for little that were killed or pre-Mac that you go talk our Stacy got a passenger married to a hypnotist as he ever uses hypnotic presence in order to win games that think about. She talked about everything. All that is what you what you call a Chris no birthing you don't get yeah childbirth there you go you can you can learn that and that could be a whole mother side gig for you. Yeah you could see that you would be created yeah I want to be like oh we are feeling pain. You don't feel pain like. So how are you guys doing with the Cove at 19 and I'll be the quarantine and all that cool though I've been working and where to figure out ways to family and not only so a lot of meeting place for learning and they said and trying to be created a new date that and then I will be our main using our work walking and I was when I left the room. The more than seven people on my show book called like some schools are saying you can't performance so July and even then it should be online. Really well so I thought about doing like tell it like tele-type shows I have. I think a lot of performers really like their audiences and you feed off their laughing. Your timing comes in there laughing like Stephen Colbert and all he lately chose to do and she chose without audience and it is it doesn't hit the no really doesn't and especially like with yours and when you call people from the audience to come on up and do and to do things so would probably be a lot different than in a situation like that. So you think that were doing the right thing with the we know quarantine and the shutdown of basically the country code. Stacy and people will know that talking about that kind of thing that people who do think they are so think I think that's how it is well not anymore. What I know one thing that you know so that is very easily. I think that's the question people ask me if it's good or bad, and I wanted to compare it to other like people in Italy are going around and gone the people were outdoor China was monitoring people from their car and they were experiencing separate them immediately. I think you have to find the middle Like you should to some degree Of people who are going out but you shouldn't lock people up with their family because they have house America doing it. I am course, we could do better. All excellent faces that yeah but it other countries and look at the science that says people are getting sick as a hoax and you think you're going to survive this country or as a world with this policy to go next. But you know you can't stop human spirit working get better over. Cannot want to get back to state of normalcy. Yeah, I think I think I think that if we don't have a long talk about. I think that's really key part like the amazing work that are doing that if the we don't slow it down, but a lot of black and I think the fourth likely examined how they do things in a lot of ways examine our policies not possible like just caring for healing in this country and nothing more. Like all the way to go about it because they sound exactly like the sun and people need more than what the government is hopeful that we can come out of having a more solid and yeah a lot of these ideas like everyone hundred dollars check. The socialist idea is a good idea if you were out of work. Give them money to put into the economy like that US dollars here. You know Stacy is your right Chris, but Stacy, the nail on the head with the slowdown in reflection I think that that's what a lot of us need to do in order to to survive and to be it out to be right of mind. You know, and so I want to be healthy, go to the hospital and not be found by people coronavirus give birth and be healthy the kid to be healthy so that one find reason to for someone else will be okay about. Right now without a fight. Without any support. I can't even what that would be like in reality think any words or parting words of the of encouragement and hope for people out there that everything think the thing itself getting into a very hopeless negative outlook of being overwhelmed by things everything to think about the potential you can take advantage of that and get your stuff and enable anything that is your not writing a disease or your family and also indecisive because it can be really overwhelming for find that that one and I think it really really condemning you. Can you talk like a new Chris I wanted to say ditto but with I concur you don't have a dog think about getting a dog that yeah I think that a lot of people who make you love me right now and go shopping online right now and I take it dog or cat out of the foster stable life from being euthanized and the home with your finger help]]>https://api.spreaker.com/episode/24854330Sun, 05 Apr 2020 16:52:37 +0000Produced by Podcast For Hirehttps://www.hypnotistchrisjones.com/ Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance,...https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.
Transcription for seo purposes only
One word Chris Jones podcast this month talking about what's on everybody's mind these days. Of course, talking Cove at 19th and Chris actually has a special guest with him though much better half of the of the equation there. Stacy is joining him for the first time Stacy, welcome to the podcast so things nowadays you guys basically have a whole life that's change you guys just got married, you're pregnant with their first child. You guys bought a house now were dealing with the pandemic and we all have to kind of shelter in place. How he has been dealing with that I think were doing pretty good I'm doing great. I really really enjoyed being your state how all department where there is so big and kind that will tell you what the few times that Chris is one I see the post on Facebook that he won so that's what friends are for. You have the option of talking your cell phone ringing with the TV or typing it in and I can't tell for ship and I can't talk so I'm like no I like I like the thousand points on the final Jeopardy in my five round my colleague like I can you please hey you probably way more colleges than anybody I know right like college that I got for the figure you think Dick Baker know nothing. So how is the one that you want the chess games. Oh, I can beat my wife and shut public connect for little that were killed or pre-Mac that you go talk our Stacy got a passenger married to a hypnotist as he ever uses hypnotic presence in order to win games that think about. She talked about everything. All that is what you what you call a Chris no birthing you don't get yeah childbirth there you go you can you can learn that and that could be a whole mother side gig for you. Yeah you could see that you would be created yeah I want to be like oh we are feeling pain. You don't feel pain like. So how are you guys doing with the Cove at 19 and I'll be the quarantine and all that cool though I've been working and where to figure out ways to family and not only so a lot of meeting place for learning and they said and trying to be created a new date that and then I will be our main using our work walking and I was when I left the room. The more than seven people on my show book called like some schools are saying you can't performance so July and even then it should be online. Really well so I thought about doing like tell it like tele-type shows I have. I think a lot of performers really like their audiences and you feed off their laughing. Your timing comes in there laughing like Stephen Colbert and all he lately chose to do and she chose without audience and it is it doesn't hit the no really doesn't and especially like with yours and when you call people from the audience to come on up and do and to do things so would probably be a lot different than in a situation like that. So you think that were doing the right thing with the we know quarantine and the shutdown of basically the country code. Stacy and people will know that talking about that kind of thing that people who do think they are so think I think that's how it is well not anymore. What I know one thing that you know so that is very easily. I think that's the question people ask me if it's good or bad, and I wanted to compare it to other like people in Italy are going around and gone the people were outdoor China was monitoring people from their car and they were experiencing separate them immediately. I think you have to find the middle Like you should to...]]>6261word,bswithbob,chris,communication,corona,covid19,goals,havingbabies,homeownership,hypnotist,jones,justtalking,listening,microcast,one,oneword,patience,stacy,talkingfalsefullhttps://www.spreaker.com/episode/bbbs-what-is-the-process-big-brothers-big-sisters--24502817 Many people are interested in becoming a big brother big sister, the oldest, largest and most proven mentoring organization in the nation at seven Rivers big Brothers big sisters were helping all you to achieve their full potential wear really just looking to create and support matches that night, so it's a process to becoming a big brother big sister, it's a bit of a robust process. We ask that you plan on committing at least a year to year. Matt's first start by applying either online or you can tap into our offense for street downtown exactly and fill out a paper copy if you prefer that will set up an interview with you and then it is really just to gather information on your interests and likes and dislikes that we can best pair you with the little that is similar to you and so the so that way is long lasting relationship exactly what we do from there yelled to a online and in person training in your and on and then on I and will do reference checks, and background checks. After that we will send you info on potential literals that we think would be a good match for you on. We have a lot of kids looking for matches and will work with you to find the best match for you after you get matched will set up a notch meeting and not really my favorite part because we get to discuss with the bag in the let all why we believe will be a successful match and sort of get them excited about being a successful match and they get to understand you know their similarities and why they are match together after that. It's really just maintenance so you'll receive ongoing support and training from the big Brothers big sisters agency that you're working with, and will do to start will do monthly check and just see how the matches going and sort of team with you on any challenges you might encounter in your match and celebrate the successes of your match with you. We also will be connecting with parents and Littles once a month just to be supporting the match from every angle, really. We also host events once a month and these events can vary from rockclimbing or welding or ice-skating or even just watching a movie that gives us the opportunity to interact with the matches moderate matches interact with each other. The robust process we just outlined is my big Brothers big sisters has been proven to be the most successful mentoring program because we put a lot of effort and time into creating and supporting the matches and that is why we've been proven to creating one-on-one mentoring relationships, igniting the power and promise of our you to find out how you can become a big brother big sister contact seven Rivers big Brothers big sisters at 608782. 2227 in the cross or 507-452-2227 Winona you can also find us on 17 Rivers BBBS.org]]>https://api.spreaker.com/episode/24502817Sat, 28 Mar 2020 12:07:25 +0000Produced by Podcast For HireFind 7 Rivers BBBS online at 7riversbbbs.org Transcription is for SEO purposes only. Many people are interested in becoming a big brother big sister, the oldest, largest and most proven mentoring organization in the nation at seven Rivers big... Many people are interested in becoming a big brother big sister, the oldest, largest and most proven mentoring organization in the nation at seven Rivers big Brothers big sisters were helping all you to achieve their full potential wear really just looking to create and support matches that night, so it's a process to becoming a big brother big sister, it's a bit of a robust process. We ask that you plan on committing at least a year to year. Matt's first start by applying either online or you can tap into our offense for street downtown exactly and fill out a paper copy if you prefer that will set up an interview with you and then it is really just to gather information on your interests and likes and dislikes that we can best pair you with the little that is similar to you and so the so that way is long lasting relationship exactly what we do from there yelled to a online and in person training in your and on and then on I and will do reference checks, and background checks. After that we will send you info on potential literals that we think would be a good match for you on. We have a lot of kids looking for matches and will work with you to find the best match for you after you get matched will set up a notch meeting and not really my favorite part because we get to discuss with the bag in the let all why we believe will be a successful match and sort of get them excited about being a successful match and they get to understand you know their similarities and why they are match together after that. It's really just maintenance so you'll receive ongoing support and training from the big Brothers big sisters agency that you're working with, and will do to start will do monthly check and just see how the matches going and sort of team with you on any challenges you might encounter in your match and celebrate the successes of your match with you. We also will be connecting with parents and Littles once a month just to be supporting the match from every angle, really. We also host events once a month and these events can vary from rockclimbing or welding or ice-skating or even just watching a movie that gives us the opportunity to interact with the matches moderate matches interact with each other. The robust process we just outlined is my big Brothers big sisters has been proven to be the most successful mentoring program because we put a lot of effort and time into creating and supporting the matches and that is why we've been proven to creating one-on-one mentoring relationships, igniting the power and promise of our you to find out how you can become a big brother big sister contact seven Rivers big Brothers big sisters at 608782. 2227 in the cross or 507-452-2227 Winona you can also find us on 17 Rivers BBBS.org]]>189big,bigbrothers,bigcouples,bigsisters,brothers,couples,lacrosse,mentoring,mentorship,minnesota,process,sisters,winona,wisconsinfalsefullhttps://www.spreaker.com/episode/bbbs-what-is-big-brothers-big-sisters--24502790https://api.spreaker.com/episode/24502790Sat, 28 Mar 2020 12:03:06 +0000Produced by Podcast For HireFind 7 Rivers BBBS online at 7riversbbbs.org Transcription is for SEO purposes only. Many people are interested in becoming a big brother big sister, the oldest, largest and most proven mentoring organization in the nation at seven Rivers big...290bbbs,big,bigbrothers,bigcouples,bigsisters,brothers,lacrosse,mentors,mentorship,minnesota,sisters,winona,wisconsinfalsefullhttps://www.spreaker.com/episode/e3-city-of-la-crosse-teri-lehrke-city-clerk--23753071www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

Teri Lehrke the city of La Crosse city clerk. What is the city clerk do well that does a lot of different things to a lot of licenses. We maintain the records that the common Council records management for the leases contract legislation the account so that a large portion of the duties of the city clerk tell him to be the election administrator for the city. So what does that mean as election administrator for the equally fabulous and equipped the polling places to hire and train the election worker we acquire and maintain the voting machine. Prepare ballot placement certification and and how many quantities ballots were going to need in order to get the right number of pallets printed for each election. We also issue at thinking ballots administer campaign-finance registration and voter registration and with it being an election season and even here is the volume of voter registration and balance it increased quite significantly. Let's talk about voter registration five twins and they just turned 18. I took my son to vote for the first time it took a long time to get registered. There's gotta be a simpler way. There is a simpler way and that's on election day. People in Wisconsin are allowed to register on election day prior to voting. However, there is a new opportunity that's been out for probably two years. It's basically online voter registration. The website that people would be using would be my vote.WI.gov voter registration database is for the whole state of Wisconsin and so the Wisconsin election commission created this online portal with you. Well, to allow for a lot of different things a lawyer can look up the polling place they can check their status to see if they register they can see what's on their ballot, but one thing that is really nice is that they can register totally online. If their drivers license in Wisconsin next is where they live currently is a seamless online voter registration where it's basically a matching system. The databases look at each other and match their address, people can get themselves registered ahead of time if you do at the time it will avoid standing in two lines on election day. At least you will already be registered and then you would have to stand in line for voting purposes. Course there are deadlines are still seated with me online voter registration, the online registration is only available during open registration. What that means is every day of the year. You can register online. If your address also matches the DMV except it closes 20 days before the election and on election day Terry, how does somebody go about registering in person on election day. What do we need to bring. I would encourage people to go to the my vote website. My vote that WI.gov and look up the address of the polling place and so what they know that. And then there at least 10 days. That's a lot of our time. That they have to establish residency for voting, then what they do is they have to bring an acceptable form of proof of residence with them. The most common form is the Wisconsin driver license or ID. If your driver's license or ID has not been changed through the DMV and other acceptable proof of residency document would be a utility like charter bill or sensory or XL energy there a utility bill, bank statement or credit card different things that you can use for proof of residency and all those different things are spelled out on the on the my vote website. You were always here to help people to navigate the system. The municipal clerk Joe is a good resource for voting information we do have a lot of information on the website. We are located in City Hall 400 La Crosse St. on the second floor is anything missing. Just take a look at the my voice I save yourself some time on election day get prepared to get registered and then go]]>https://api.spreaker.com/episode/23753071Sun, 15 Mar 2020 17:00:10 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com Teri Lehrke the city of La Crosse city...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

Teri Lehrke the city of La Crosse city clerk. What is the city clerk do well that does a lot of different things to a lot of licenses. We maintain the records that the common Council records management for the leases contract legislation the account so that a large portion of the duties of the city clerk tell him to be the election administrator for the city. So what does that mean as election administrator for the equally fabulous and equipped the polling places to hire and train the election worker we acquire and maintain the voting machine. Prepare ballot placement certification and and how many quantities ballots were going to need in order to get the right number of pallets printed for each election. We also issue at thinking ballots administer campaign-finance registration and voter registration and with it being an election season and even here is the volume of voter registration and balance it increased quite significantly. Let's talk about voter registration five twins and they just turned 18. I took my son to vote for the first time it took a long time to get registered. There's gotta be a simpler way. There is a simpler way and that's on election day. People in Wisconsin are allowed to register on election day prior to voting. However, there is a new opportunity that's been out for probably two years. It's basically online voter registration. The website that people would be using would be my vote.WI.gov voter registration database is for the whole state of Wisconsin and so the Wisconsin election commission created this online portal with you. Well, to allow for a lot of different things a lawyer can look up the polling place they can check their status to see if they register they can see what's on their ballot, but one thing that is really nice is that they can register totally online. If their drivers license in Wisconsin next is where they live currently is a seamless online voter registration where it's basically a matching system. The databases look at each other and match their address, people can get themselves registered ahead of time if you do at the time it will avoid standing in two lines on election day. At least you will already be registered and then you would have to stand in line for voting purposes. Course there are deadlines are still seated with me online voter registration, the online registration is only available during open registration. What that means is every day of the year. You can register online. If your address also matches the DMV except it closes 20 days before the election and on election day Terry, how does somebody go about registering in person on election day. What do we need to bring. I would encourage people to go to the my vote website. My vote that WI.gov and look up the address of the polling place and so what they know that. And then there at least 10 days. That's a lot of our time. That they have to establish residency for voting, then what they do is they have to bring an acceptable form of proof of residence with them. The most common form is the Wisconsin driver license or ID. If your driver's license or ID has not been changed through the DMV and other acceptable proof of residency document would be a utility like charter bill or sensory or XL energy there a utility bill, bank statement or credit card different things that you can use for proof of residency and all those different things are spelled out on the on the my vote website. You were always here to help people to navigate the system. The municipal clerk Joe is a good resource for voting information we do have a lot of information on the website. We are located in City Hall 400 La Crosse St. on the second floor is anything missing....]]>2832020,city,cityvision,clerk,election,infomation,lacrosse,lacrossewisconsin,lehrke,podcast,teri,vision,vote,voter,wisconsinfalsefullhttps://www.spreaker.com/episode/e1-randy-nelson-extra-innings-school-safety--23621656807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

This is Randy Nelson and this is an edition of extra innings as a retiring superintendent of schools. Many things run across my mind when I reflect on 37 years of education, what's happened in those 37 years. What we been doing in our schools and even what's on the horizon to help facilitate the discussion. I've enlisted the assistance of Mr. Bob Schmidt past radio talkshow host a parent and a friend. There's a lot of things is apparent, especially since all for my kids are gone through lacrosse schools that concern the things that are happening in schools that are not good all around the country, you know, I think I we haven't had any issues here in the La Crosse area but when it comes to safety in lacrosse schools. What Things are being done is a lot of things that are been happening over the last several years and unfortunately most of those have been happening as a response to the national scene and tragedies that have taken place in other schools and what we learn from those Sandy Hook really being the one that started a lot more national conversation about school safety, like many other school districts we have stepped out in front as best we can to respond in several different ways. One of the things and probably the most costly thing that we've done is we have now retrofitted every one of our schools and the school district lacrosse to ensure that there is a two-step entryway into the schools by two-step meaning that there is a vestibule there is a there is a place where once you get into the school. There's another holding place that you go in and add before you would see an adult inside of that school so it's kind of a two-stage process to get in and I just to get into the front door. We've also established cameras and an opportunity for person to announce themselves pushing the button I think of the days that you know people Michael in a club and you push a button or sciences was there and so we been able to use security cameras in such a way that someone with a direct line of sight to that doorway can see with the person as they can get a line of vision on that person. They can also buzz in that particular person. And so it does provide for us an opportunity for that person to go through stages before they actually get into the school you know you talk about school safety and I wish that there were guarantees and and in life and and and there really are to whether it's for me or whether it's for you. There just aren't any guarantees that tomorrow morning were to wake up and I wish that there were guarantees, but what I will say is that what our goal is here is to slow people down when someone's coming to school with that terrible intentions. It's to slow people down slow down the process and do what we can to make sure that we have more ample time to to contact we need to contact for help. One of the things to that the La Crosse school district doesn't think does well is that in the middle school and high school. There's a uniformed police officer in those schools all the time right yeah absolutely that's another thing that we've done. It's something that we've included in partnership with the Police Department and that is that we have full-time SRO school resource officers are schools and one of the things that's really true, it's that the job of those individuals is not just to address someone who might break the law someplace on our school campus or thereabouts, but the purpose of that person inside of that particular school is to build relationships of students we want that school resource officer to be connecting with students. We want the school resource officer to be connected with families because what we do find out is that sometimes despite all of the effort in all the work that we put into buy things and to do things inside of the schools like we've been talking about its many times relationships and the capacity for adults to have built strong relationships with students and other family members that we sometimes can get out in front of issues before they died might develop in the something bad at school when it comes to training staff about safety in general. What kind of things are being done to to help our staff out with knowing and being above and being ready to jump in when they need to just make sure that people are not hearing things and just ignoring it, but they are indeed intervening in those types of situations and helping students understand a couple of other things that that were doing in the school district through some grants that came to us from the Department of Justice here in Wisconsin we have on several of our schools. We have installed what we would call some shatterproof a film on some of our schools that again makes it more difficult for an intruder to comment. The other thing that we've done is were implementing what's called a raptor system when someone does come through those front portals to our schools before they can move into the rest of the school or get past that office. They have to swipe their license and that drivers license swipe is actually going through a really quick database that databases helping us better understand if this particular person. For instance, might not be a good person to be in that particular school. We continue to work on those things. I think what's been difficult to see is that we used to do one fire drill per month in a school now are doing active shooter drills, schools, and it's been difficult to watch that transition and it said it's it makes me wonder why got a lot of philosophies about that, but it's one of the discouraging things that I see happening. I really hope that whatever those things are that are milling about that cause these things to happen that they can be addressed whether it's mental health. Whether it's social status than standing on these things need to be addressed. Somehow, because our schools should not be the place where students feel that they are going to school in fear. It should be at least one of several places, but it should always be a place that they feel that they are safe and there amongst adults who care about. Thanks, Randy. I'm looking forward to our next extra conversation retiring superintendent of schools Randy Nelson's extra innings time as a podcastforhire.com]]>https://api.spreaker.com/episode/23621656Sat, 07 Mar 2020 22:50:27 +0000Produced by Podcast For HireContact School District of La Crosse 807 East Avenue South La Crosse, Wisconsin 54601 (608) 789-7600 https://www.lacrosseschools.org/ Transcription is for SEO only This is Randy Nelson and this is an edition of extra innings as a retiring...807 East Avenue South
La Crosse, Wisconsin 54601
(608) 789-7600
https://www.lacrosseschools.org/

Transcription is for SEO only

This is Randy Nelson and this is an edition of extra innings as a retiring superintendent of schools. Many things run across my mind when I reflect on 37 years of education, what's happened in those 37 years. What we been doing in our schools and even what's on the horizon to help facilitate the discussion. I've enlisted the assistance of Mr. Bob Schmidt past radio talkshow host a parent and a friend. There's a lot of things is apparent, especially since all for my kids are gone through lacrosse schools that concern the things that are happening in schools that are not good all around the country, you know, I think I we haven't had any issues here in the La Crosse area but when it comes to safety in lacrosse schools. What Things are being done is a lot of things that are been happening over the last several years and unfortunately most of those have been happening as a response to the national scene and tragedies that have taken place in other schools and what we learn from those Sandy Hook really being the one that started a lot more national conversation about school safety, like many other school districts we have stepped out in front as best we can to respond in several different ways. One of the things and probably the most costly thing that we've done is we have now retrofitted every one of our schools and the school district lacrosse to ensure that there is a two-step entryway into the schools by two-step meaning that there is a vestibule there is a there is a place where once you get into the school. There's another holding place that you go in and add before you would see an adult inside of that school so it's kind of a two-stage process to get in and I just to get into the front door. We've also established cameras and an opportunity for person to announce themselves pushing the button I think of the days that you know people Michael in a club and you push a button or sciences was there and so we been able to use security cameras in such a way that someone with a direct line of sight to that doorway can see with the person as they can get a line of vision on that person. They can also buzz in that particular person. And so it does provide for us an opportunity for that person to go through stages before they actually get into the school you know you talk about school safety and I wish that there were guarantees and and in life and and and there really are to whether it's for me or whether it's for you. There just aren't any guarantees that tomorrow morning were to wake up and I wish that there were guarantees, but what I will say is that what our goal is here is to slow people down when someone's coming to school with that terrible intentions. It's to slow people down slow down the process and do what we can to make sure that we have more ample time to to contact we need to contact for help. One of the things to that the La Crosse school district doesn't think does well is that in the middle school and high school. There's a uniformed police officer in those schools all the time right yeah absolutely that's another thing that we've done. It's something that we've included in partnership with the Police Department and that is that we have full-time SRO school resource officers are schools and one of the things that's really true, it's that the job of those individuals is not just to address someone who might break the law someplace on our school campus or thereabouts, but the purpose of that person inside of that particular school is to build relationships of students we want that school resource officer to be connecting with students. We want the school resource officer to be connected with families because what we do find out is that sometimes...]]>356education,lacrosse,nelson,randy,retiring,safety,school,schools,schoolsafety,superintendent,wisconsinfalsefullhttps://www.spreaker.com/episode/e16-chris-jones-1-word-house-and-baby-on-the-way--23214418https://www.hypnotistchrisjones.com/


Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.


This episode we start to talk about Chris Jones buying a house and fatherhood. Listen to where the conversation takes you.

transcription for seo only
hows homeownership. The house that's pretty cool little life is pregnant and so I've been moving things because she is working and growing up show you the work and enduring morning sickness I'm packing. How far is the house from where you live is currently 20 minutes okay 25 is that traffic right was not horrible and it is only like 4 miles from the airport. Those that make my commute a lot easier. So tell me about the pregnancy, you know, I'm just trying to be thoughtful because Stacy can't drink I'm not drinking, and the you know like wow I really could have like a nice drink right now and not stressed so much or be in my head, but you don't try to be empathetic, so she can't drink. I'm not drinking the babies up the last time we spoke you pretty excited about the about about a couple things we talked about both of them actually talked about that you know the homeownership and about the about you being a father is kind of weird that only first met. I don't think you'd want to be a dad always met me. I deftly didn't want that responsibility. I would like is all about me I am the focus of the and out like I want attention or when the I rather give someone else realize universe is much, much bigger than I which is an insane concept like I'm one person that there's 7 billion people on the planet like to be self-centered at 30 40 you mean you've grown to come along way you know think about it that way. Thanks. Hello. I blame Stacy for my growth yeah yeah something to blame… That's pretty awesome to think about it. If you think about it like is good. I went to one of those job fairs for myself and I showcase for 30 minutes and usually I could do is show and 30 minute like that's plenty of time, but I didn't but I didn't rock my agent because he likely had anything so graciously heavy on stage like it's on audience like to try to stand up and it's funny you give me an ulcer you know is what you get to the part reinvent. I do your skip and I get to the point of the like, yeah, I do my best and his name is Chris as well and I got up there and I on that. I talked for like eight minutes on my 30 nights in three minutes at a time. People now I got to do one or two skits that I got Chris. I got up I wasn't thrilled with my performance. I got off stage and I was like I Stacy was there. My buddy Adam was there. My videographer was there like guys I'm going to go take a nap because I didn't Bob it wasn't a flop but I give that performance to C+ and it was in front of no 1500 people, but in the real other shady thing is there are other hypnotists performed after me the least to others, and they probably did better than I did and it's just what it is like I'm the guy who who had a target on his back. I went the first day like opening this job fair this conference. I didn't compete like I wanted to, but the house alike in a big way so I can't complain what the teacher I had all these ideas I wanted to share with the audience and Stacy like you know what your goal what your purpose and she sleeps in his ability to do this you like just you have a lot of messages just focus on one of them. I like know about inequality in our talk about this idea as a lady standing up if you Restrain your hand your keychain. Show me your preference. Regular size guys. They're afraid of us. We need to be better is the thing I want to talk was that yeah I hear you Stacy like you could just do that at the school. You don't need to go on your platform you know every chance you can you wait to your on-campus yeah but one might ask people from all 50 states in a room at one is like the size of the listeners is a focus on entertainment so I got to the school like a guy I get upset because women have to walk around in the dark with your keeping your fingers and rape whistle and pepper spray and we drunk guys and distributors we want and stucco his own apartment like you understand. I like how privileged we are. So what did I learn you now as you hurry you can drill five whole 5 feet deep, boating, drill one whole 25 feet but you can't do both. Like make your message firm or make five messages whatever dream is and not structurally sound. The binder that make sense yeah actually it does you got that you can 3:30 or four or you can do, wanted to know, yeah, the last thing that all I'll let you go. I think part of that is because I needed someone to talk to. I admitted their personal a while. I haven't had sharing time I got out of the time but just losing my headphones is not enough. I didn't do any writing talk venting all of this is just me moving +567 days by myself with the dog, and the like Tom Hanks and castaway we can just talk to your dog than that of an object being you have my number brother you can always call me I do and that you talk me on a great day like you talking on visiting my mom. My grandma Terry and I'm not a cemetery guy all hang there for all of 60 seconds and I'm like well the bugs I'm leaving cemetery are not my cup of tea]]>https://api.spreaker.com/episode/23214418Wed, 26 Feb 2020 16:02:35 +0000Produced by Podcast For Hirehttps://www.hypnotistchrisjones.com/ Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance,...https://www.hypnotistchrisjones.com/


Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.


This episode we start to talk about Chris Jones buying a house and fatherhood. Listen to where the conversation takes you.

transcription for seo only
hows homeownership. The house that's pretty cool little life is pregnant and so I've been moving things because she is working and growing up show you the work and enduring morning sickness I'm packing. How far is the house from where you live is currently 20 minutes okay 25 is that traffic right was not horrible and it is only like 4 miles from the airport. Those that make my commute a lot easier. So tell me about the pregnancy, you know, I'm just trying to be thoughtful because Stacy can't drink I'm not drinking, and the you know like wow I really could have like a nice drink right now and not stressed so much or be in my head, but you don't try to be empathetic, so she can't drink. I'm not drinking the babies up the last time we spoke you pretty excited about the about about a couple things we talked about both of them actually talked about that you know the homeownership and about the about you being a father is kind of weird that only first met. I don't think you'd want to be a dad always met me. I deftly didn't want that responsibility. I would like is all about me I am the focus of the and out like I want attention or when the I rather give someone else realize universe is much, much bigger than I which is an insane concept like I'm one person that there's 7 billion people on the planet like to be self-centered at 30 40 you mean you've grown to come along way you know think about it that way. Thanks. Hello. I blame Stacy for my growth yeah yeah something to blame… That's pretty awesome to think about it. If you think about it like is good. I went to one of those job fairs for myself and I showcase for 30 minutes and usually I could do is show and 30 minute like that's plenty of time, but I didn't but I didn't rock my agent because he likely had anything so graciously heavy on stage like it's on audience like to try to stand up and it's funny you give me an ulcer you know is what you get to the part reinvent. I do your skip and I get to the point of the like, yeah, I do my best and his name is Chris as well and I got up there and I on that. I talked for like eight minutes on my 30 nights in three minutes at a time. People now I got to do one or two skits that I got Chris. I got up I wasn't thrilled with my performance. I got off stage and I was like I Stacy was there. My buddy Adam was there. My videographer was there like guys I'm going to go take a nap because I didn't Bob it wasn't a flop but I give that performance to C+ and it was in front of no 1500 people, but in the real other shady thing is there are other hypnotists performed after me the least to others, and they probably did better than I did and it's just what it is like I'm the guy who who had a target on his back. I went the first day like opening this job fair this conference. I didn't compete like I wanted to, but the house alike in a big way so I can't complain what the teacher I had all these ideas I wanted to share with the audience and Stacy like you know what your goal what your purpose and she sleeps in his ability to do this you like just you have a lot of messages just focus on one of them. I like know about inequality in our talk about this idea as a lady standing up if you Restrain your hand your keychain. Show me your preference. Regular size guys. They're afraid of us. We need to be...]]>386baby,chrisjones,daddy,fatherhood,homeowner,hypnotist,hypnotistchrisjonestruefullhttps://www.spreaker.com/episode/e1-initiate-demand-be-social-content-is-king--23145078https://www.initiatedemand.com/
Follow them on Facebook https://www.facebook.com/initiatedemand/ and LinkedIn https://www.linkedin.com/company/initiatedemand/

Transcription is for seo purpose only. Your brand name is initiate demand orders competently. It took a while we looked at what we do well we help people really get started. We help them in different formats really start to reach their audience well and because there's so much turmoil in the delivery of content were continually having to initiate new things for the same client with the same content in different formats what content is king. These days content all content content is better than buying ads pretty much buy anything if you have great content, people will consume it but it has to be presented correctly. A lot of people will put up walls of text or poor images or poor video. If you put forth content its poor people tune you out. It's really easy nowadays to simply unlike something or block it or not follow it anymore. We do those things you lose an audience member. So is no content better than poor content. Yes it is. I've seen interesting success with people who know their audience well your audience is someone who they've done business with always over the phone so they will market their basic product with their phone number. They don't have a lot of content on top of that, and those people and turn around and call them it in. That's how that business works and I think that's a key is understanding the business, how it has reached its clients or customers, but more importantly, how else can they in some cases you can only reach specific types of clientele by getting them on the phone. In other cases, you can only get to them through a podcast like were doing today and now we had this distributed market so used to have TV, radio, newspaper, for the most part was a main advertising formats. Now content is distributed in hundreds of different ways and so you need to really have a good content strategy for every chance that your content will be out there and gain someone's attention does a different content reach different clients completely. Please radio. For instance, podcasting reaches way more people in an audio format than radio does today and those people are typically under 30 there already consuming podcast there on spot a fire there using another podcasting type tool or music tool and that's where they find you know, one of the things that we talk about is how the audience is changed. They've moved Hill used to be in that traditional market right your audience was consuming most of your content from TV, radio, newspaper print, then the Internet exploded brought Google on the play. Everyone wanted to be found in the search and want to be found in Google that still important, but was changed now since then is social media. Your audience is now in social media there on their Facebook app all day there and LinkedIn all day there on tick-tock or some other social media apps that they have on their phone that they don't leave that environment so only search for something they don't go out to a browser they search from within that application. That's how they find you and so you had to find ways to reach those audiences almost different places can initiate demand. Help me to do that. That's what we do. That's were very good at how we take the time to understand your business, your customers, not just your existing or potential, and where there consuming content. What type of content they prefer and then how their consuming. Someone may not want to read two paragraphs. Might one of read three sentences they might want a visual image they might want a short video they might want just animate a gift or some humor. It's really take some time to understand the right process. You know in our market. Now we see a large trend to people selling just pay per click ads on Google because in our market. People have been there. Still, in that I want to be on Google search radar and it does help them because right now they're not. But really what would help them even beyond that is to get them into those social realms where they're not performing well and that's one thing that's difficult for most is it's very easy for anyone to create a Facebook page. It's very easy for anyone to create a business page on LinkedIn or have a Pinterest account and post a bunch of stuff there is a misconception that the amount of likes I get current is positive the number of likes you have with content doesn't necessarily mean people are engaged in what you're doing. It simply means liking is easy and it's so easy that Instagram removed likes because it's not a good indicator of what people are looking to turn those views into potential clients. That's the key is to get them, not just from a view, but to get them engaged to have content that causes them to want to do something, whether it's make a comment call you send you a note send you a message you know instant message you through an app, it's really getting them to react in a positive way about what you're talking about about what your content subject matter is and that's what were lacking right now with a lot of social media content that I see out there so is paid versus organic better when it comes to reaching new clients paid as fast, organic is a longer-term process, you can turn much more quickly in the paid solution, but that longer-term content strategy through organic search will last longer. It will have longer value over time. So the question is really, are you trying to quickly enter into a market or specific audience or demographic. And I would see do both. Both of what you know what you're doing is to be that way. Can you be successful at both. Of course you can be very successful both. The issue is making certain that your targeting your audience correctly when I say that I don't mean having the right demographics picked for your ad. I mean having the right content in place. I've had clients who try to replicate what we've done and they don't understand why a specific image works as well as it does to cause a reaction to cause him to engage in what you're doing and they just don't understand and that's okay because their role in their business is not to know how to do that their role in their businesses to run their business and to be a part of their business. There's a reason that I don't do my own plumbing in my house. I call a plumber could I do it sure should I Heck no. So you're the guy that'll come in when your quote. Brother-in-law knows how to do website or your quote child knows how to set up a Facebook page or your you know your best friend's son or daughter is a is great at twitter you're the guy that comes in and does the cleanup. A lot of times, yes. But the difficulty is understanding those previous efforts. You see IA's people are liking our page. People are liking your content and right now the assumption is that is very positive, but likes are so easy, it's not engaging you need to be engaged in your and your client base need to post things they want to read it in our world. Not many people want to read about social media and how to market it. Not many people want to understand it from a business right what's right way to go ahead and and tackle some of these things, you know that you know we talked about we talk we talked a little bit about paid versus organic. We talked about the different you know putting putting stuff up and putting it up regularly. But what's the right way to go ahead and tackle getting new clients with my social media search really good strategy you have to have a strategy before you attack any of a lot of people will simply look at I just want to bid on a keyword and I'll do that but that keyword brings them to say their website or landing page, but their website itself doesn't convert that customer doesn't turn them into someone who calls them, or engages in their website or their podcast or whatever that that content is being pushed to from that paper click add and so all of a sudden they don't see good conversion rate on what they're doing and they just give up when, in essence, the ad was good targeting was good it was causing people to go to that secondary location there website or something else with their website itself wasn't set up to convert someone. It wasn't set up well to do that and sometimes those changes can be very simple. One of the best things you can do is stop hiding your contact information on the contact page. If I hit it. If I click on an ad and I go to your website and I want to call you. I'm not typically going to click two or three more times. I want to know how to get a hold of you right now, especially with small businesses. It's very relevant]]>https://api.spreaker.com/episode/23145078Mon, 24 Feb 2020 19:08:37 +0000Produced by Podcast For HireTo find out more about Initiate Demand please check out their website https://www.initiatedemand.com/ Follow them on Facebook https://www.facebook.com/initiatedemand/ and LinkedIn https://www.linkedin.com/company/initiatedemand/ Transcription is...https://www.initiatedemand.com/
Follow them on Facebook https://www.facebook.com/initiatedemand/ and LinkedIn https://www.linkedin.com/company/initiatedemand/

Transcription is for seo purpose only. Your brand name is initiate demand orders competently. It took a while we looked at what we do well we help people really get started. We help them in different formats really start to reach their audience well and because there's so much turmoil in the delivery of content were continually having to initiate new things for the same client with the same content in different formats what content is king. These days content all content content is better than buying ads pretty much buy anything if you have great content, people will consume it but it has to be presented correctly. A lot of people will put up walls of text or poor images or poor video. If you put forth content its poor people tune you out. It's really easy nowadays to simply unlike something or block it or not follow it anymore. We do those things you lose an audience member. So is no content better than poor content. Yes it is. I've seen interesting success with people who know their audience well your audience is someone who they've done business with always over the phone so they will market their basic product with their phone number. They don't have a lot of content on top of that, and those people and turn around and call them it in. That's how that business works and I think that's a key is understanding the business, how it has reached its clients or customers, but more importantly, how else can they in some cases you can only reach specific types of clientele by getting them on the phone. In other cases, you can only get to them through a podcast like were doing today and now we had this distributed market so used to have TV, radio, newspaper, for the most part was a main advertising formats. Now content is distributed in hundreds of different ways and so you need to really have a good content strategy for every chance that your content will be out there and gain someone's attention does a different content reach different clients completely. Please radio. For instance, podcasting reaches way more people in an audio format than radio does today and those people are typically under 30 there already consuming podcast there on spot a fire there using another podcasting type tool or music tool and that's where they find you know, one of the things that we talk about is how the audience is changed. They've moved Hill used to be in that traditional market right your audience was consuming most of your content from TV, radio, newspaper print, then the Internet exploded brought Google on the play. Everyone wanted to be found in the search and want to be found in Google that still important, but was changed now since then is social media. Your audience is now in social media there on their Facebook app all day there and LinkedIn all day there on tick-tock or some other social media apps that they have on their phone that they don't leave that environment so only search for something they don't go out to a browser they search from within that application. That's how they find you and so you had to find ways to reach those audiences almost different places can initiate demand. Help me to do that. That's what we do. That's were very good at how we take the time to understand your business, your customers, not just your existing or potential, and where there consuming content. What type of content they prefer and then how their consuming. Someone may not want to read two paragraphs. Might one of read three sentences they might want a visual image they might want a short video...]]>348content,initiatedemand,linkedin,socialmediafalsefullhttps://www.spreaker.com/episode/e2-city-of-la-crosse-jason-gilman-planning-and-development--22700581www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

This is Jason Gilman, the director, planning and development for the city of La Crosse and my role is basically to make sure that the plans that the city ratifies. That is, the Council adopts are implemented in those plans largely focused on ways that we can improve the city from a quality-of-life standpoint, but if you break it down into baby for digestible areas. You can think about economics, environmental conditions, social conditions and cultural conditions. Those are the pillars of most plan implementation gets done by, usually three different tools that municipal government has at its disposal. One would be regulation or deregulation second would be financial programs that would have some measure of return on the public's investment and then the third would be education and awareness of networking, so this would be things like making sure that were constantly reaching out to investors to nongovernmental organizations to neighborhood associations and keeping people colored with good information about city. The city's comprehensive plan is now 18 years old… Are you planning on doing to retire that plan and to start with a new one, were actually working on a plan update. Right now it's customary for a comprehensive plan to have about a 20 year shelf life. If we look at a snapshot of our last 20 we seem very significant changes from the great recession to lots of construction downtown La Crosse to rapidly aging population. The first phase is really to collect information about the city to update all the data is both primary and secondary data so the primary data would be survey information unique information from our citizens. Secondary data would be the stuff that's available on the web from demographics to the Department of workforce development and other sources and we really look at that data in defense and offense of categories for the defense. It would be decisions over the next decade to mitigate downside risk so you can think about some of the risks cities are facing like decaying infrastructure or mental health issues in the community or aging could be one although there's a positive side to aging to but we want to make sure we address the issues that could affect quality of life of our aging population. Climate action is another one, and several others in the offense of side is really to build capacity. How do we make a better city so that citizens have a better quality of life. Then they might elsewhere that can be everything from affordable housing and economic security for people to bolstering our neighborhood Association so people can be civic. We engaged in their city with good information and access to resources and other things like that Kissimmee did mention housing affordability, and I know that in the 28 years that I've owned a house on the cross that the housing market is kind of gone up all puppet away how how do we bring those prices back down so they can be more affordable for the average person to be home water. It's a real conundrum and in cities because were really facing the perfect storm. We have high levels of retention because of aging population. People are wanting to age in place and that's partly due to the fact that we don't have enough senior housing to meet demand, or enough of the variety that seniors are looking for like urban tall houses or condominiums think like that. The other part of that is construction inflation were facing unprecedented construction inflation or new construction for single-family homes is pushing $200 a square foot or more. And the problem manifests in other ways because he should be spending more than 30% of your debt income on housing related costs and if you're spending 50 or 60% it leaves you vulnerable to other problems with the stuff you basically just been talking about. Is there any hopes for maybe the old ShopKo's or Kmart or any of the other vacant properties that are out there to maybe have those become affordable. Yeah, absolutely. And that that's really what's exciting about some of these what we call greenfield sites which are really in transition from the old big box retail model to something more current. A lot of the success stories around the United States with regard doing adaptive reuse or retrofitting of those old retail sites are showing more compact retail Lake neighborhood retail which could be anything from coffee shops to insurance and fitness centers, and other things in the context of mixed-use of the year housing component and that housing component could be a combination of senior housing affordable housing market rate housing and it's usually vertical construction, which is yield better land utilization more tax base for the city but it also puts people closer to services so they can all live, work and play in the same area. Let me ask you this strength score La Crosse. I would say in our strengths here are tremendous employers that are in growth mode are great medical institutions are schools the fact that we have urban elementary schools which give people great quality-of-life neighborhoods. We have beautiful older housing stock. Even though some of it needs REIT rehabilitation. It's it's on the up ticking on terms of investment lot. Lots of strengths and then of course are natural firemen gets talked about all the time. With regard to homeport matters in your life have access to patron recreation and then external opportunities. I think there are all kinds of things like Viking cruise lines wanting to invest on the Mississippi River docking 7 to 12 times a season and having international visitors enjoy our city and shop at our doors downtown and help our local business owners can then then I would say energy innovation. We got some great minds in the city with train company in our universities and our power companies that are shifting gears to renewable energy and provide people with more cost-effective services that are more environmentally sound]]>https://api.spreaker.com/episode/22700581Sat, 15 Feb 2020 18:00:12 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com This is Jason Gilman, the director,...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

This is Jason Gilman, the director, planning and development for the city of La Crosse and my role is basically to make sure that the plans that the city ratifies. That is, the Council adopts are implemented in those plans largely focused on ways that we can improve the city from a quality-of-life standpoint, but if you break it down into baby for digestible areas. You can think about economics, environmental conditions, social conditions and cultural conditions. Those are the pillars of most plan implementation gets done by, usually three different tools that municipal government has at its disposal. One would be regulation or deregulation second would be financial programs that would have some measure of return on the public's investment and then the third would be education and awareness of networking, so this would be things like making sure that were constantly reaching out to investors to nongovernmental organizations to neighborhood associations and keeping people colored with good information about city. The city's comprehensive plan is now 18 years old… Are you planning on doing to retire that plan and to start with a new one, were actually working on a plan update. Right now it's customary for a comprehensive plan to have about a 20 year shelf life. If we look at a snapshot of our last 20 we seem very significant changes from the great recession to lots of construction downtown La Crosse to rapidly aging population. The first phase is really to collect information about the city to update all the data is both primary and secondary data so the primary data would be survey information unique information from our citizens. Secondary data would be the stuff that's available on the web from demographics to the Department of workforce development and other sources and we really look at that data in defense and offense of categories for the defense. It would be decisions over the next decade to mitigate downside risk so you can think about some of the risks cities are facing like decaying infrastructure or mental health issues in the community or aging could be one although there's a positive side to aging to but we want to make sure we address the issues that could affect quality of life of our aging population. Climate action is another one, and several others in the offense of side is really to build capacity. How do we make a better city so that citizens have a better quality of life. Then they might elsewhere that can be everything from affordable housing and economic security for people to bolstering our neighborhood Association so people can be civic. We engaged in their city with good information and access to resources and other things like that Kissimmee did mention housing affordability, and I know that in the 28 years that I've owned a house on the cross that the housing market is kind of gone up all puppet away how how do we bring those prices back down so they can be more affordable for the average person to be home water. It's a real conundrum and in cities because were really facing the perfect storm. We have high levels of retention because of aging population. People are wanting to age in place and that's partly due to the fact that we don't have enough senior housing to meet demand, or enough of the variety that seniors are looking for like urban tall houses or condominiums think like that. The other part of that is construction inflation were facing unprecedented construction inflation or new construction for single-family homes is pushing $200 a square foot or more. And the problem manifests in other ways because he should be spending more than 30% of your debt income on housing related costs and if you're spending 50 or 60%...]]>3822020,development,gilman,jason,lacrosse,lacrossewisconsin,neighborhoods,planning,podcast,podcastforhire,vision,wisconsinfalsefullhttps://www.spreaker.com/episode/e-15-chris-jones-1-word-building-family-and-not-touching-water--22128716https://www.hypnotistchrisjones.com/


Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.


This episode we start to talk about Chris Jones buying a house and not touching the water. Listen to where the conversation takes you.]]>https://api.spreaker.com/episode/22128716Mon, 27 Jan 2020 18:00:44 +0000Produced by Podcast For Hirehttps://www.hypnotistchrisjones.com/ Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance,...https://www.hypnotistchrisjones.com/


Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.


This episode we start to talk about Chris Jones buying a house and not touching the water. Listen to where the conversation takes you.]]>3031word,bswithbob,business,chris,college,communication,goals,grow,growth,havingbabies,homeownership,hypnotist,jones,justtalking,listening,microcast,one,oneword,patience,talkingtruefullhttps://www.spreaker.com/episode/e1-city-of-la-crosse-mayor-kabat--21713010www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

Were always looking for new and innovative ways to try to tell the story of what goes on in city government and services and projects that were working on and I think this is a great opportunity to do that to have a monthly podcast with various departments and economic can highlight things that people don't know about that our city government. Mayor Tim Kabat why electing the mayor of city of La Crosse. It's really about our people here we have such an incredible community and I think there's a lot of folks that point out the natural beauty in the river and the bluffs in the Martian and just being able to get outside. Here is particularly special for me it's all about the people in the hospitality and just the friendliness and and what it means to live and work and play in the La Crosse area. I think you know when I hear stories all the time and and get to experience it firsthand of just how nice people are here and that just have so much to offer not only the outdoor recreation. We got a great downtown that has a lot of just wonderful restaurants and bars and music in your looking for that nightlife. It's it's here. You've got great employers send place to work, so they just all in all of course I'm perhaps a little bit biased, but I just happen to think that this is a wonderful community and it's because of the people that live here and work here that really make a huge difference there. Tim Kabat talking about the city of La Crosse was the vision for 2020s we got a number of exciting projects in the works. I think for us. It's all about focus on these essential services. So are our street repairs and working on our infrastructure and trying to get caught up with getting potholes fixed and in those types of things the public safety aspect were looking at, you know, additional opportunities for expanding our neighborhood policing program, which is been very successful and I'm hoping to be able to break ground on a new Northside fire station this year. I think that's in the works. So from that those essential services the streets and police and fire. I think we do that is good as anybody. But what really makes a community special is how we take care of our most vulnerable citizens. So working on things like our homeless challenges are affordable housing needs were part of the B alliance to heal, which is a multi partner group that's been working and will be working over the course the next couple years to really focus on improving our treatment for people that are experiencing substance abuse and mental health issues when were able to do those things and and then of course obviously beautiful parks in our libraries and just our quality of life when were able to do that then were really, I think exceeding our expectations of the community. The other projects like the La Crosse center in me. That's under construction. Now that's a very significant regional project that is going to mean a lot when it comes to concerts and events and conventions in bringing community together. So I look forward to 2020 think there's a lot of excellent things in the works I think so to just from hearing you talk about it and things I've seen on the do's and read in the paper as well. When it comes to being a newbie or somebody just moved La Crosse or just visited La Crosse for the first time. What are some of the things that you would definitely tell people that you have to see light think that again. If you're looking at getting outside so getting to Hickson forest and hiking the trails they are getting in the La Crosse River marsh having opportunities on the river that's what it means to live here in this community and have the natural resources that we do. But then it is really to kind of experience the things downtown amine Lake everybody's got their favorites is the mayor. All of them are my favorites. I can't just say I can't pick one, but I know it's the ice cream shop since the restaurants as the bars. I think you know we still have a number of of neighborhood taverns that are part of our culture. I think the things like the loggers games in the summertime. Any and all of those if I if I was new to La Crosse I that's what I would be looking to experience because it gives you kind of the sense of what it means to be part of this community. Being a La Crosse resident for the last 29 years myself. I didn't realize it there's 46 parks in the cross. Yeah, it's pretty it's pretty amazing for community. Again, our size and they really range a menu got large open spaces. You've got kind of small neighborhood parks. You got the trail connections and then everything in between and were really working hard to try to know, take care of those improvements, and sometimes there's your people wonder like what we should be spending all of the cities monies on roads and fixing nose and wiry spending money on parks while parks are definitely a part of this infrastructure as a community and our quality-of-life and were working hard to try to make sure that you know keeping them well-maintained and fixing them up when we need to.]]>https://api.spreaker.com/episode/21713010Wed, 15 Jan 2020 15:38:29 +0000Produced by Podcast For HireTranscription is for SEO purposes only. To find out more about the city of La Crosse please visit their website www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com Were always looking for new and innovative...www.cityoflacrosse.org to find out more about Podcast For Hire please visit PodcastForHire.com

Were always looking for new and innovative ways to try to tell the story of what goes on in city government and services and projects that were working on and I think this is a great opportunity to do that to have a monthly podcast with various departments and economic can highlight things that people don't know about that our city government. Mayor Tim Kabat why electing the mayor of city of La Crosse. It's really about our people here we have such an incredible community and I think there's a lot of folks that point out the natural beauty in the river and the bluffs in the Martian and just being able to get outside. Here is particularly special for me it's all about the people in the hospitality and just the friendliness and and what it means to live and work and play in the La Crosse area. I think you know when I hear stories all the time and and get to experience it firsthand of just how nice people are here and that just have so much to offer not only the outdoor recreation. We got a great downtown that has a lot of just wonderful restaurants and bars and music in your looking for that nightlife. It's it's here. You've got great employers send place to work, so they just all in all of course I'm perhaps a little bit biased, but I just happen to think that this is a wonderful community and it's because of the people that live here and work here that really make a huge difference there. Tim Kabat talking about the city of La Crosse was the vision for 2020s we got a number of exciting projects in the works. I think for us. It's all about focus on these essential services. So are our street repairs and working on our infrastructure and trying to get caught up with getting potholes fixed and in those types of things the public safety aspect were looking at, you know, additional opportunities for expanding our neighborhood policing program, which is been very successful and I'm hoping to be able to break ground on a new Northside fire station this year. I think that's in the works. So from that those essential services the streets and police and fire. I think we do that is good as anybody. But what really makes a community special is how we take care of our most vulnerable citizens. So working on things like our homeless challenges are affordable housing needs were part of the B alliance to heal, which is a multi partner group that's been working and will be working over the course the next couple years to really focus on improving our treatment for people that are experiencing substance abuse and mental health issues when were able to do those things and and then of course obviously beautiful parks in our libraries and just our quality of life when were able to do that then were really, I think exceeding our expectations of the community. The other projects like the La Crosse center in me. That's under construction. Now that's a very significant regional project that is going to mean a lot when it comes to concerts and events and conventions in bringing community together. So I look forward to 2020 think there's a lot of excellent things in the works I think so to just from hearing you talk about it and things I've seen on the do's and read in the paper as well. When it comes to being a newbie or somebody just moved La Crosse or just visited La Crosse for the first time. What are some of the things that you would definitely tell people that you have to see light think that again. If you're looking at getting outside so getting to Hickson forest and hiking the trails they are getting in the La Crosse River marsh having opportunities on the river that's what it means to live here in this community and have the natural resources that we do. But then it...]]>292city,crosse,kabat,la,lacrosse,lacrossewisconsin,lax,mayor,mayorkabat,mississippi,of,parks,podcast,podcastforhire,river,tim,timkabat,vision2020,wi,wisconsinfalsefullhttps://www.spreaker.com/episode/e14-chris-jones-1-word-we-can-do-better-new-year--20985700https://www.hypnotistchrisjones.com/]]>https://api.spreaker.com/episode/20985700Sun, 22 Dec 2019 22:04:38 +0000Produced by Podcast For Hirehttps://www.hypnotistchrisjones.com/https://www.hypnotistchrisjones.com/]]>6451word,bswithbob,business,chris,college,communication,goals,grow,growth,hypnotist,jones,justtalking,listening,microcast,newyear,one,oneword,patience,religion,talkingtruefullhttps://www.spreaker.com/episode/e12-wisconsin-great-river-road-dean-klinkenberg--20825716www.WiGRR.com
find out more about at deanklinkenberg.com.

Bob: [He’s] the author of a couple really cool books – actually, a handful of really cool books – dealing with the upper Mississippi River and the Wisconsin Great River Road, as well as the entire Great River Road. Dean Klinkenberg [is] my guest this month on the Wisconsin Great River Road Podcast. Dean, I appreciate you spending some time with us to talk about the beauty that is the Wisconsin Great River Road.

Dean: Thanks for having me on. I love talking about the river.

Bob: Dean, you currently live on the Mississippi, in St. Louis, but you spent some time up in La Crosse, Wisconsin. What was the start of the love for Dean Klinkenberg and the mighty Mississippi River?

Dean: I blame it on La Crosse, mostly. I went to college there; I moved there in 1982 to start college. Being that close to the Mississippi, I took pretty good advantage of the opportunities to get outside and experience the river when I lived there. I had a couple favorite activities that I did often. I loved hiking around in the bluffs and going to places around Grandad Bluff that I wasn’t supposed to go to – of course, don’t do that [because] you’re not supposed to do that – and riding my bike down to the river to the favorite spots for me to sit and brood. I just loved going down to the river and watching it swirl and watching the animals and the birds. The first time I canoed on the Mississippi was also from La Crosse. For some reason, my friend and I started off by paddling upriver. We weren’t the brightest at that age, but we made some progress and got up to some old beach, then we stopped and swam and had a little lunch before we paddled back. It just left a big impression on me from those years in La Crosse.

Bob: It is a beautiful area. I moved here in 1992 thinking I’d be here a year or two, and here it is 27 years later and I’m still enjoying La Crosse, for sure. One of the books you wrote is called, “Small Town Pleasures,” and I’m assuming there’s probably some small-town pleasures here in Wisconsin.

Dean: There are a lot. It’s one of the things that I think sets the Wisconsin Great River Road apart from other areas. It’s mostly small communities. You have places like Fountain City and Alma. [They are] these small, little river towns that have done a great job of maintaining their river identities and staying really connected to the river. Because you have so many small communities, you have a lot of small-town businesses. You have a lot of businesses that are owned locally. I like patronizing those small, local businesses as much as I can because the money I spend tends to stay in those communities. And you’re not sacrificing the least bit of quality. These are all great places, so it’s fantastic. People are generally nice and making sure you have a good experience. It’s just great all around.

Bob: You’ve had the opportunity to travel the entire Great River Road multiple times, I’m assuming.

Dean: Multiple times. I was just thinking about that today. There may be 50 to 100 miles of pavement I haven’t driven yet. I’m kind of losing track of how many miles I’ve driven just along the Great River Road since I started doing it, but I know it’s over 125,000 miles.

Bob: You’re driving that much and spending that much time on the Mississippi. Do you have a favorite spot in Wisconsin on the Great River Road?

Dean: Where I am at the moment. Just wherever I am at that moment. It’s hard to pick a favorite spot. I will say that that stretch of the Great River Road from Prescott down to Sandy Hook is among my favorite drives anywhere. Picking a couple of favorite spots along there, it’s really hard because there are so many that I enjoy.

Bob: The other book that you wrote, “Road Tripping Along The Great River Road,” talk a little bit about that and some of the cool road trips that there are here on the Wisconsin Great River Road.

Dean: One of the reasons I started writing these books is I was discouraged to see people who had heard so much about the Mississippi and went out of their way to drive to the banks of the river, took a look at it, and then drove on somewhere else. I wanted to give people more of a context for what they’re seeing and help them understand why they needed to spend more time along the Mississippi. All my books spend a fair amount of time describing local history for each of the communities along the river, and then giving people different ideas of things that they can see and do while they’re there. I know people like to take day trips when they drive along the Great River Road and then they zip back up to the Twin Cities or Madison or wherever. You need some time to really get to know it well. The Mississippi begs you to slow down. To really get to know it well, you need to take your time and explore it slowly, spend some time in the communities, spend a couple nights here [and] a couple nights there. You can do weekend trips over portions of the Wisconsin Great River Road, particularly around Lake Pepin. The Wisconsin communities along Lake Pepin would be great for a weekend. I know people tend to rush through those. I’d like people to set aside two or three days to do that. Traveling and being along the Mississippi is what was making me happy.

Bob: It’s awesome when you can find something you love to do and make some money at it at the same time. You’ve written a bunch of books, which is really cool. You’ve written nonfiction as well as some fiction books. Tell me about how we can find out more information about you, Dean.

Dean: There are two websites that I maintain. Mississippitraveler.com is the site where I have travel information about places along the Mississippi. I also write fiction. I write mysteries that are set in places along the Mississippi. Two of them are in print: Rock Island Lines and Double Dealing in Dubuque. The third book, which should be out next year, is tentatively called “Letting Go in La Crosse.” That will be topical, sort of the Wisconsin Great River Road. Those you can find out more about at deanklinkenberg.com.]]>https://api.spreaker.com/episode/20825716Tue, 17 Dec 2019 15:21:46 +0000Produced by Podcast For HireTo find out more about the Wisconsin Great River Road please check out the website www.WiGRR.com find out more about at deanklinkenberg.com. Bob: [He’s] the author of a couple really cool books – actually, a handful of really cool books – dealing...www.WiGRR.com
find out more about at deanklinkenberg.com.

Bob: [He’s] the author of a couple really cool books – actually, a handful of really cool books – dealing with the upper Mississippi River and the Wisconsin Great River Road, as well as the entire Great River Road. Dean Klinkenberg [is] my guest this month on the Wisconsin Great River Road Podcast. Dean, I appreciate you spending some time with us to talk about the beauty that is the Wisconsin Great River Road.

Dean: Thanks for having me on. I love talking about the river.

Bob: Dean, you currently live on the Mississippi, in St. Louis, but you spent some time up in La Crosse, Wisconsin. What was the start of the love for Dean Klinkenberg and the mighty Mississippi River?

Dean: I blame it on La Crosse, mostly. I went to college there; I moved there in 1982 to start college. Being that close to the Mississippi, I took pretty good advantage of the opportunities to get outside and experience the river when I lived there. I had a couple favorite activities that I did often. I loved hiking around in the bluffs and going to places around Grandad Bluff that I wasn’t supposed to go to – of course, don’t do that [because] you’re not supposed to do that – and riding my bike down to the river to the favorite spots for me to sit and brood. I just loved going down to the river and watching it swirl and watching the animals and the birds. The first time I canoed on the Mississippi was also from La Crosse. For some reason, my friend and I started off by paddling upriver. We weren’t the brightest at that age, but we made some progress and got up to some old beach, then we stopped and swam and had a little lunch before we paddled back. It just left a big impression on me from those years in La Crosse.

Bob: It is a beautiful area. I moved here in 1992 thinking I’d be here a year or two, and here it is 27 years later and I’m still enjoying La Crosse, for sure. One of the books you wrote is called, “Small Town Pleasures,” and I’m assuming there’s probably some small-town pleasures here in Wisconsin.

Dean: There are a lot. It’s one of the things that I think sets the Wisconsin Great River Road apart from other areas. It’s mostly small communities. You have places like Fountain City and Alma. [They are] these small, little river towns that have done a great job of maintaining their river identities and staying really connected to the river. Because you have so many small communities, you have a lot of small-town businesses. You have a lot of businesses that are owned locally. I like patronizing those small, local businesses as much as I can because the money I spend tends to stay in those communities. And you’re not sacrificing the least bit of quality. These are all great places, so it’s fantastic. People are generally nice and making sure you have a good experience. It’s just great all around.

Bob: You’ve had the opportunity to travel the entire Great River Road multiple times, I’m assuming.

Dean: Multiple times. I was just thinking about that today. There may be 50 to 100 miles of pavement I haven’t driven yet. I’m kind of losing track of how many miles I’ve driven just along the Great River Road since I started doing it, but I know it’s over 125,000 miles.

Bob: You’re driving that much and spending that much time on the Mississippi. Do you have a favorite spot in Wisconsin on the Great River Road?

Dean: Where I am at the moment. Just wherever I am at that moment. It’s hard to pick a favorite spot. I will say that that stretch of the Great River Road from Prescott down to Sandy Hook is among my favorite drives anywhere. Picking a couple of favorite spots along there, it’s really hard because there...]]>34935,dean,deanklinkenberg,great,guide,headwaters,highway,klinkenberg,mississippi,mississippivalleytravelerheadw,podcastforhire,region,river,road,smalltownpleasures,traveler,upper,valley,wigrr,wisconsinfalsefullhttps://www.spreaker.com/episode/e13-chris-jones-1-word-patience-growth-and-getting-better--20166936https://www.hypnotistchrisjones.com/

you met somebody famous named Darren Brown if you ask any magician who the back like performer. They will say without a doubt Darren Brown I was eking out like a schoolgirl. Yeah so what makes them so good. He's incredible. I mean it's it's hard to put in the words how good the show is all happens in your linker to like he tell you what is going to do anger like our and I'm ready and that he doesn't like. I don't know how he did that, for example, he says to put a banana on the stand and at some point a man in a gorilla gospel, out take it. I'm hoping most of you will not notice this and then sure enough, the bananas gone then it's got a second time and the third time you see the net the monkey anger like there is a gorilla, and it takes off its head and its him like he was just on stage. A lot of that is like psychology. I learned a lot of stuff in psych in psychology. Z is the art of the art of misperception or a redirection redirection method about the art of redirection. So maybe your talents will be regular do and you're looking for but then something else happens and look there's a squirrel look at the score where the banana go exactly. So that's pretty cool something so even a guy that's in magic that's in the magic that's in the comedy that is a performer was still taken back by with those guys doing oh yeah and I mean it, like I heard him. Chris rock and Kevin Hart report at Dave Chapelle standup show and they both look each other in there like our ships terrible comparative Dave Chapelle reaches goes up there. He talks in the higher you talk to God and their data delegate start when he was 14. Like he's had years and years of practice, but he also was the highest-paid entertainer one time. In turn, and turn it down and walked all walk away from everything because because he didn't want to do it anymore. I've gone down the YouTube rabbit hole researching why he quit undergoing words like you got away and have you seen a recent photo of Dave Chapelle. I have not even muscular guy. Now he he gained all his weight and he has all his muscle now and then Alexa would happen. He said well when you take care of yourself you you gain weight and II didn't know that you were supposed to look a certain way and not the real so yeah so you care of himself actually think I'm have a relationship with his children. I respect him a lot more now hello school know me ask you as you talk to rabbit holes because I think a lot of us get stuck going down rabbit holes on a very regular basis. I know that I was at the dentist today and is talking to the girl is working my teeth and were just talking about how we as I say always so pretty, yes, very, with Prudential Heights God is very pretty. If you have the prettiest person picking your ears like a little use if possible. I like a lot to tell me, always is the nicest person employed at the blind and beautiful too, but like hey did you have popcorn, like the answer had pop linked to inner-city life yeah, but we're talking about how as a society we did. We now it is were so bored with anything that were doing things we used to do regularly, and not think anything of like going to the grocery store standing in line. Now we pick up our phones are plain on our phones because we don't have the patience to sit through and ended do nothing for a few moments that's true which is which is really too bad. I mean I is I think that where that were all kind of going down rabbit holes just with that with that. I mean, how we times have you been standing in line at, you know, at the grocery store been board looked at something and then 25 minutes later you're standing up. You know, after you paid for your groceries waiting to get in your car because you're trying to figure out what how does this fit into the philosophy of life. Plus your life like you read Fahrenheit 451. I have not. Years ago I was pretty cool book. I think it's called, Fahrenheit 451 that the temperature at which paper and books burn and I have to look at my copy somewhere, but I predicted so much stuff about the future and people don't have time to talk to another. Yeah, Ray Bradberry, Fahrenheit 451 this is the 60th anniversary addiction. I'm holding my hands and I guess was first published in 51 copyright 1950 was risen, called firemen, but either way 1950 use for you pretty much stuff in the future. One thing he predicted his people would have seashells in their years and you wouldn't tell that they were talking to you or the person in their ear is a waterless seashells and those are just, you know that the pod you put in your ear the air, but pods whatever and that he's predicting that TD to be the size of your wall and three TDs put together. So you're surrounded by people. Let me ask you this Chris to think that some people coming up with, you know, things like that in the past helped to initiate that thought process to get that stuff started, as in the future, it is a really good question so as not predicting so is not predicting what is that you're encouraging yeah you're encouraging somebody who it maybe is a stronger thought process than you to come up with and do explore that is as a possibility along the Star Trek was talking about cell phones and gases like that, like a week totally could affect technology we can make start cell phones, Star Trek and big Tracy had a lot you could talk into that was a short-lived thing for you look so magical smart and talking into a shoe and you look at mean there is there's the amount of the amount of technology that was perhaps faked like the $6 million man, you know, things like that that all of a sudden now is more reality than anything else. You know the point interesting to see if that's what I was like like about conversations he Chris that I never know where they're going to go God so true. So, else to worry were you performing these days. How was Harvard Harbor was awesome. After the video, but it was so cool like you see Michelle about crossing everyone get criticized way more people you want you can handle harder got hypnotized by the mirrorlike I feel I'm not going to slow dance this person who that's totally cool but they were on different mental wavelength. Anything outside experience before like legitimately. Do you think that it has to mean good does that have to do with the smarts or does it have to do with the I'm afraid that somebody's going to see me acting like a fool and therefore it's going to corrupt my little it might be it might corrupt my political persuasion in the future Barack Obama was told Lee's smoking weed when he was in college and grad school at Harvard harbor law I think is more just, they are cut from a different cloth. What are we doing what we talk about what's was so what's the word what's the word what's the one word combining electric growth patients or patients. Growth will I'm sure. I'm guessing that the that patience is what something that Stacy is dealing with now because she's married. Do you know, and growth is what you're have a good bill because you're now married yeah so what what about patients she's taking me I'm learning you know if you can make steps towards doing something that's progress. Like today were finally trying to send out thank you cards for our wedding. I was in July. Haley should turn men because you know what there's been. We've been invited to weddings going to weddings going to baby showers and not God, thank you notes so I think about doing them now in November. July is only five months ago. You're ahead of the gang. I appreciate that. So work putting photos, running together and I was good at printer look today at Office Depot? I bark is every authors depot horrible your water at Office Depot got better about your life. No, never stapled I love I love Staples, Office Depot, despite no one wants to be here. This is a warehouse. So yes, again patients and growth patients and I think it's of that we all need to work on. Honestly patients you know what patience is something that we constantly have to you have to deal with it. I am horrible at patience. Even today I dry I told you earlier is that had a dentist appointment I was driving to my dentist appointment and we had a snowfall last night there was only about 1/2 an inch or and and so not much but everybody drives like an idiot. After so little old and the people going slow in the left lane under the speed limit, and there there matching with the person in the right lane kisses me off because I can't do anything. So for me, my patience was pushed and actually yelled at my house shall looking to buy into my windshield today because of the idiot that would move over as I posted that on Facebook in the summer. He said oh, are you the only professional driver out there that night and I'm like no I'm not the only professional driver out there and I'm not a professional driver, but I try to be a courteous driver important. You're right it is but I do need help and patience, as do I think a lot of people yeah another thing I had to learn is sometimes you people will give you their best but you expect more, but it is their best and that's hard for me. Sometimes he will disappoint you because they are literally doing their best, but it's in your mind not good enough. I know exactly what you're saying good I hope so I was like hope is coming up to two strong, and I'm sorry I'm I am doing the best that I can about 20. I was in the lobby of the apartment building today and this kid was showing his report card or front desk worker and by what she does at front desk out of the side hustle like she's good for Marty she does is to meet people and share her sweetness so she just adopts all the kids in the and the apartment she said to him you got a D in math. I'm going to give you some money for it is a and this be $10 but you can have his being that I need to get better baby rolling out real compassionate encouraging. She said y]]>https://api.spreaker.com/episode/20166936Thu, 21 Nov 2019 16:00:12 +0000Produced by Podcast For Hirehttps://www.hypnotistchrisjones.com/ you met somebody famous named Darren Brown if you ask any magician who the back like performer. They will say without a doubt Darren Brown I was eking out like a schoolgirl. Yeah so what makes them so good. He's...https://www.hypnotistchrisjones.com/

you met somebody famous named Darren Brown if you ask any magician who the back like performer. They will say without a doubt Darren Brown I was eking out like a schoolgirl. Yeah so what makes them so good. He's incredible. I mean it's it's hard to put in the words how good the show is all happens in your linker to like he tell you what is going to do anger like our and I'm ready and that he doesn't like. I don't know how he did that, for example, he says to put a banana on the stand and at some point a man in a gorilla gospel, out take it. I'm hoping most of you will not notice this and then sure enough, the bananas gone then it's got a second time and the third time you see the net the monkey anger like there is a gorilla, and it takes off its head and its him like he was just on stage. A lot of that is like psychology. I learned a lot of stuff in psych in psychology. Z is the art of the art of misperception or a redirection redirection method about the art of redirection. So maybe your talents will be regular do and you're looking for but then something else happens and look there's a squirrel look at the score where the banana go exactly. So that's pretty cool something so even a guy that's in magic that's in the magic that's in the comedy that is a performer was still taken back by with those guys doing oh yeah and I mean it, like I heard him. Chris rock and Kevin Hart report at Dave Chapelle standup show and they both look each other in there like our ships terrible comparative Dave Chapelle reaches goes up there. He talks in the higher you talk to God and their data delegate start when he was 14. Like he's had years and years of practice, but he also was the highest-paid entertainer one time. In turn, and turn it down and walked all walk away from everything because because he didn't want to do it anymore. I've gone down the YouTube rabbit hole researching why he quit undergoing words like you got away and have you seen a recent photo of Dave Chapelle. I have not even muscular guy. Now he he gained all his weight and he has all his muscle now and then Alexa would happen. He said well when you take care of yourself you you gain weight and II didn't know that you were supposed to look a certain way and not the real so yeah so you care of himself actually think I'm have a relationship with his children. I respect him a lot more now hello school know me ask you as you talk to rabbit holes because I think a lot of us get stuck going down rabbit holes on a very regular basis. I know that I was at the dentist today and is talking to the girl is working my teeth and were just talking about how we as I say always so pretty, yes, very, with Prudential Heights God is very pretty. If you have the prettiest person picking your ears like a little use if possible. I like a lot to tell me, always is the nicest person employed at the blind and beautiful too, but like hey did you have popcorn, like the answer had pop linked to inner-city life yeah, but we're talking about how as a society we did. We now it is were so bored with anything that were doing things we used to do regularly, and not think anything of like going to the grocery store standing in line. Now we pick up our phones are plain on our phones because we don't have the patience to sit through and ended do nothing for a few moments that's true which is which is really too bad. I mean I is I think that where that were all kind of going down rabbit holes just with that with that. I mean, how we times have you been standing in line at, you know, at the grocery store been board looked at something and then 25 minutes later you're standing up. You know, after you paid for your groceries waiting to get in your car because you're trying to figure out what how does this fit into the philosophy of life. Plus your life like you read Fahrenheit 451. I have not. Years...]]>7261word,bswithbob,business,chris,college,communication,goals,grow,growth,hypnotist,jones,justtalking,listening,microcast,one,oneword,patience,religion,talking,traveltruefullhttps://www.spreaker.com/episode/e11-wisconsin-great-river-road-meghan-jensen--19978432www.WiGRR.com
Wisconsin DNR Website https://dnr.wi.gov/

Megan: We’re very fortunate in this area to have the natural resources we do with the Mississippi River here. We’ve got excellent fishing. We have fishing year-round. There’s always something. The hunting is great in this area. We’ve got really good deer hunting in this area. We’ve got really good duck and goose hunting. It’s a really cool area, not to mention that the scenery is pretty decent to look at as well.

Bob: Megan Jensen, a Wisconsin Conservation Warden with the Wisconsin DNR is my guest on the Wisconsin Great River Road Podcast. So, tell me about being safe when it comes to deer hunting season.

Megan: When we look at the deer hunting season, obviously we have the archery season and the gun season. [With] archery season, there’s usually not as many folks out in the woods, and the season is over a longer period of time. But [with] the gun deer season, usually we’re getting a more concentrated number of folks out in the woods, and they’re hunting with firearms. One of the biggest concerns is their safety. We do have the blaze orange or the blaze pink requirement for those hunters. Anyone who is hunting during a gun deer season has to wear at least 50 percent of the blaze orange or the blaze pink. And in all of our hunter education courses, we always talk about the acronym TABK. Those are the four primary rules of firearm safety. The first one is T, [which is] treat every firearm as if it’s loaded. The A is, always point your muzzle in a safe direction. B [is], be sure of your target and what’s beyond. The K is, keep your finger off the trigger until you’re ready to shoot.

Bob: That’s always some good advice right there. How is hunting along the Wisconsin Great River Road different from hunting in state or on the other side of the state?

Megan: As a warden, I’ve worked along the Mississippi River for my entire career. Over here along the Mississippi River, we’ve got really good hunting, and we’ve got a variety of hunting. Not only do we have really good deer hunting over in this area, a couple of our counties – Buffalo County and Trempealeau County – are really destination deer hunting counties for a lot of folks not just from within Wisconsin, but really from multiple states. I frequently do get calls from folks from other states asking about hunting opportunities on the public land in Trempealeau County just because this area is known for their nice-sized bucks and the plentiful deer herd. We are also along the Mississippi River Flyway for ducks and geese, so we have great waterfowl hunting here as well, which just really makes this a hunter’s paradise because there is a little bit of something for everyone. We also have good small game hunting and turkey hunting and other hunting activities. I think we’re very fortunate along the river here to have all the hunting activities that we do, and opportunities that we have.

Bob: Living along the Wisconsin Great River Road, of course we’ve got the opportunity to fish year-round with the Mississippi River being there. What kind of advice would you give to a fisherman?

Megan: The first piece of advice I give to anyone who is going out fishing or hunting is to make sure you take a peek at the regulations for that year. Things do change from year to year here, and it’s important for folks to know what the regulations are because at the end of the day, it’s up to the fisherman and the hunter to read what the regulations are for the body of water they’re going out on, and the state that they’re in. Here along the Mississippi, one of the biggest things I like to remind folks of is that there’s a state line along the Mississippi River that we share with Minnesota and Iowa there. If folks are fishing on the non-Wisconsin side of the river, they need to follow the regulations for the state for which they’re fishing in. For example, if someone is fishing in the La Crosse area on the Wisconsin side, they would follow Wisconsin regulations. If they’re fishing on the Minnesota side of the river, they would have to follow the regulations put out by Minnesota.

Bob: Megan, how do we find out more information about the Wisconsin DNR?

Megan: The Wisconsin DNR has an awesome website. Just about anything you want to know can be found on that website. Encourage folks to go online and just type in “wisconsindnr” [dnr.wi.gov] and take a look at our website. Another resource we have is a “Hunt Wild Wisconsin App.” It’s a free app that people can download on their smartphones. It’s a really good resource. It has an interactive map on there that has overlays of where the public land is so they know if it’s public land or private land where they’re at. They can also look up regulations for the different species. They can look up shooting hours, so that’s a really good resource.]]>https://api.spreaker.com/episode/19978432Mon, 11 Nov 2019 21:43:41 +0000Produced by Podcast For HireTo find out more about the Wisconsin Great River Road please check out the website www.WiGRR.com Wisconsin DNR Website https://dnr.wi.gov/ Megan: We’re very fortunate in this area to have the natural resources we do with the Mississippi River here....www.WiGRR.com
Wisconsin DNR Website https://dnr.wi.gov/

Megan: We’re very fortunate in this area to have the natural resources we do with the Mississippi River here. We’ve got excellent fishing. We have fishing year-round. There’s always something. The hunting is great in this area. We’ve got really good deer hunting in this area. We’ve got really good duck and goose hunting. It’s a really cool area, not to mention that the scenery is pretty decent to look at as well.

Bob: Megan Jensen, a Wisconsin Conservation Warden with the Wisconsin DNR is my guest on the Wisconsin Great River Road Podcast. So, tell me about being safe when it comes to deer hunting season.

Megan: When we look at the deer hunting season, obviously we have the archery season and the gun season. [With] archery season, there’s usually not as many folks out in the woods, and the season is over a longer period of time. But [with] the gun deer season, usually we’re getting a more concentrated number of folks out in the woods, and they’re hunting with firearms. One of the biggest concerns is their safety. We do have the blaze orange or the blaze pink requirement for those hunters. Anyone who is hunting during a gun deer season has to wear at least 50 percent of the blaze orange or the blaze pink. And in all of our hunter education courses, we always talk about the acronym TABK. Those are the four primary rules of firearm safety. The first one is T, [which is] treat every firearm as if it’s loaded. The A is, always point your muzzle in a safe direction. B [is], be sure of your target and what’s beyond. The K is, keep your finger off the trigger until you’re ready to shoot.

Bob: That’s always some good advice right there. How is hunting along the Wisconsin Great River Road different from hunting in state or on the other side of the state?

Megan: As a warden, I’ve worked along the Mississippi River for my entire career. Over here along the Mississippi River, we’ve got really good hunting, and we’ve got a variety of hunting. Not only do we have really good deer hunting over in this area, a couple of our counties – Buffalo County and Trempealeau County – are really destination deer hunting counties for a lot of folks not just from within Wisconsin, but really from multiple states. I frequently do get calls from folks from other states asking about hunting opportunities on the public land in Trempealeau County just because this area is known for their nice-sized bucks and the plentiful deer herd. We are also along the Mississippi River Flyway for ducks and geese, so we have great waterfowl hunting here as well, which just really makes this a hunter’s paradise because there is a little bit of something for everyone. We also have good small game hunting and turkey hunting and other hunting activities. I think we’re very fortunate along the river here to have all the hunting activities that we do, and opportunities that we have.

Bob: Living along the Wisconsin Great River Road, of course we’ve got the opportunity to fish year-round with the Mississippi River being there. What kind of advice would you give to a fisherman?

Megan: The first piece of advice I give to anyone who is going out fishing or hunting is to make sure you take a peek at the regulations for that year. Things do change from year to year here, and it’s important for folks to know what the regulations are because at the end of the day, it’s up to the fisherman and the hunter to read what the regulations are for the body of water they’re going out on, and the state that they’re in. Here along the Mississippi, one of the biggest things I like to remind folks of is that there’s a state line along the Mississippi...]]>29935,deer,dnr,fishing,game,great,highway,hunt,hunting,jensen,meghan,minnesota,mississippi,river,road,safe,turkey,wigrr,wild,wisconsinfalsefullhttps://www.spreaker.com/episode/e10-wisconsin-great-river-road-alan-nugent--19632057www.WiGRR.com
Stockholm website: stockholmwisconsin.com

Stockholm Pies website: stockholmpieandgeneralstore.com

Alan: All along the Great River Road – in Stockholm, Pepin, Maiden Rock – fall is absolutely the most spectacular time of year to come here. It’s beautiful all year. But fall, because of the mix of hardwoods and these beautiful bluffs and the reflection on the water, and the way the road weaves along the shore of Lake Pepin, there is not a more beautiful fall destination

Bob: Where is Stockholm?

Alan: On the Mississippi River. We’re in an area we call ‘The West Coast of Wisconsin.’ Do you know where Red Wing, Minnesota is?

Bob: Yup.

Alan: We are 17 miles downriver from Red Wing on the Wisconsin side.

Bob: What are some of the fun things to do there?

Alan: Here, it’s a lot about the scenery, and it’s a lot about the shopping and the food. Stockholm is a town of 66 people, but there are about 15 little shops, galleries, boutiques, cafes, and of course our pie shop. It’s kind of like a movie set. The other little villages along the area are filled with all kinds of cool stuff and great restaurants and shops. Then there’s the bluffs and the river and the lake. It’s incredible.

Bob: Did you say 66 people?

Alan: Sixty-six people, yeah.

Bob: I couldn’t imagine just having 66 [people]. Is it a block long?

Alan: Basically, it’s a block wide and a block long. It’s two streets wide, and there’s one street that divides at the highway and the county road that goes out of town. [It’s] the smallest village in the smallest county in Wisconsin. And it’s become one of the top day trip destinations in the region.

Bob: What makes it a day trip destination, do you think?

Alan: The drive has a lot to do with it. It’s just a mind-blowingly beautiful drive along the bluffs and the river. I don’t remember what year it was – it was in 2012 or 2013, something like that – The Huffington Post did a big competition for the most beautiful drive in America. Our stretch beat out Highway 1 and the Kona Highway for the most beautiful drive in America.

Bob: Which part of the drive – the entire Wisconsin Great River Road?

Alan: It is all beautiful, but what’s considered the most scenic section is actually between Bay City, which is just outside of Red Wing, to Pepin. And literally, the most beautiful six miles are Maiden Rock to Stockholm.

Bob: Is that why you decided to move there?

Alan: Exactly. It started as a second home in the area, which is how a lot of people start because it’s the opposite direction of the traffic for second homes in the Twin Cities. And it is magnificently beautiful – it’s all the food options and everything else.

Bob: So how did you start the Stockholm Pie Company and General Store?

Alan: Well, the Stockholm Pie Company started almost 11 years ago now. My sister, who lived in Chicago, moved here. She had come to visit my spouse and I, and [she] fell in love with it, just like the rest of us around here. And lo and behold, it turned out that we had this little tiny space in the building that we had just bought where an art gallery was. We thought, what the heck? So we put in the kitchen, and it was supposed to be a little weekend gig for her. It didn’t last to the weekend gig very long. It soon expanded and expanded. It originally started in a space that was about 250 square feet, and it now encompasses about 3,000 square feet. It seats about 60. [There are] multiple production kitchens. We also have a second location in Red Wing. It caught on, is the gentlest way to put it. We were kind of discovered by the Road Food Guide, which then led us to Splendid Table and Gourmet Magazine. It just keeps going on and on from there.

Bob: What I think is great is you can seat 60 people in a town of 66.

Alan: Isn’t that amazing? And our performing arts center will hold 120, so how many places have a performing arts center with twice the capacity of the town?

Bob: I’m guessing Stockholm, Wisconsin, is probably the only place in the world that has that.

Alan: Probably.

Bob: What do you like best about living in a river town?

Alan: A lot of it has to do with the scenic element of it – the bluffs, the views. It is truly magical. There’s really nothing else like it the way we are situated – not just on the river, but where the river becomes Lake Pepin. It gets very wide here. It’s actually the widest natural spot on the Mississippi. It has created this environment of bluff and water that doesn’t exist anywhere else. And there is a whole series of little villages in Bay City, Maiden Rock, Stockholm, [and] Pepin. Tourism kind of took root in Stockholm, and it’s kind of spreading along the ‘West Coast of Wisconsin.’

Bob: Does Stockholm have a website?

Alan: It does: stockholmwisconsin.com

Bob: Does Stockholm Pies have a website?

Alan: It does: stockholmpieandgeneralstore.com]]>https://api.spreaker.com/episode/19632057Tue, 22 Oct 2019 16:36:15 +0000Produced by Podcast For HireTo find out more about the Wisconsin Great River Road please check out the website www.WiGRR.com Stockholm website: stockholmwisconsin.com Stockholm Pies website: stockholmpieandgeneralstore.com Alan: All along the Great River Road – in...www.WiGRR.com
Stockholm website: stockholmwisconsin.com

Stockholm Pies website: stockholmpieandgeneralstore.com

Alan: All along the Great River Road – in Stockholm, Pepin, Maiden Rock – fall is absolutely the most spectacular time of year to come here. It’s beautiful all year. But fall, because of the mix of hardwoods and these beautiful bluffs and the reflection on the water, and the way the road weaves along the shore of Lake Pepin, there is not a more beautiful fall destination

Bob: Where is Stockholm?

Alan: On the Mississippi River. We’re in an area we call ‘The West Coast of Wisconsin.’ Do you know where Red Wing, Minnesota is?

Bob: Yup.

Alan: We are 17 miles downriver from Red Wing on the Wisconsin side.

Bob: What are some of the fun things to do there?

Alan: Here, it’s a lot about the scenery, and it’s a lot about the shopping and the food. Stockholm is a town of 66 people, but there are about 15 little shops, galleries, boutiques, cafes, and of course our pie shop. It’s kind of like a movie set. The other little villages along the area are filled with all kinds of cool stuff and great restaurants and shops. Then there’s the bluffs and the river and the lake. It’s incredible.

Bob: Did you say 66 people?

Alan: Sixty-six people, yeah.

Bob: I couldn’t imagine just having 66 [people]. Is it a block long?

Alan: Basically, it’s a block wide and a block long. It’s two streets wide, and there’s one street that divides at the highway and the county road that goes out of town. [It’s] the smallest village in the smallest county in Wisconsin. And it’s become one of the top day trip destinations in the region.

Bob: What makes it a day trip destination, do you think?

Alan: The drive has a lot to do with it. It’s just a mind-blowingly beautiful drive along the bluffs and the river. I don’t remember what year it was – it was in 2012 or 2013, something like that – The Huffington Post did a big competition for the most beautiful drive in America. Our stretch beat out Highway 1 and the Kona Highway for the most beautiful drive in America.

Bob: Which part of the drive – the entire Wisconsin Great River Road?

Alan: It is all beautiful, but what’s considered the most scenic section is actually between Bay City, which is just outside of Red Wing, to Pepin. And literally, the most beautiful six miles are Maiden Rock to Stockholm.

Bob: Is that why you decided to move there?

Alan: Exactly. It started as a second home in the area, which is how a lot of people start because it’s the opposite direction of the traffic for second homes in the Twin Cities. And it is magnificently beautiful – it’s all the food options and everything else.

Bob: So how did you start the Stockholm Pie Company and General Store?

Alan: Well, the Stockholm Pie Company started almost 11 years ago now. My sister, who lived in Chicago, moved here. She had come to visit my spouse and I, and [she] fell in love with it, just like the rest of us around here. And lo and behold, it turned out that we had this little tiny space in the building that we had just bought where an art gallery was. We thought, what the heck? So we put in the kitchen, and it was supposed to be a little weekend gig for her. It didn’t last to the weekend gig very long. It soon expanded and expanded. It originally started in a space that was about 250 square feet, and it now encompasses about 3,000 square feet. It seats about 60. [There are] multiple production kitchens. We also have a second location in Red Wing. It caught on, is the gentlest way to put it. We were kind of discovered by the Road Food...]]>334alan,arts,beautiful,fall,great,lacrosse,leaves,microcast,mississippi,nugget,pies,population66,river,road,stockholm,stockholmpies,wigrr,wisconsinfalsefullhttps://www.spreaker.com/episode/lpef-gold-star-educators-podcast-series-jeanne-halderson--19568370hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Jeanne Halderson is a 7th-grade language arts and social studies teacher at Longfellow Middle School.

Transcription is for seo purposes and is not 100% accurate.
Welcome to Goldstar educators, a podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time that I never take me love seventh grade and I look back on my favorite year of my entire schooling came through college that great is still my favorite year to Jean Halderson is a Cooley pod. Teachers seventh grade teacher. By the way, teaches social studies and language arts at Longfellow middle school. I really don't think that the public knows all the things of the La Crosse public education foundation does to help out our students. There are so many things that that I know for me the foundation I weave my way of thinking if I got to be a better way to see something a person always involves money right because I needed some kind of cheerio I need some kind of experience and it wasn't everything that the regular school budget could pay for and sell because I'm one of those dreamer type teachers and I dream about what you I would write grants and there's someone out there that believe that there is something more creative and innovative to. That's why the foundation works and I'm guessing that most people don't know all of the amazing things that happened in our school district because of the foundation. Tell me about one of the grants you've written to you lately when I've been writing grants. I've been writing on, or all three. No school so that everybody benefits. One of the things that I wrote a grant for was green screens for the classrooms and for the library so that kids could take their iPads and use the green screen technology just like they do is you know the weatherman and they could transfer themselves to different countries they could pretend like they were different people and so it really fit every single on subject matter and so the foundation has provided green screens for all three schools. We have the green screen captains where the kids can put the whole green screen cast and I and you disappear gloves we have mass and really unique way for kids to show what they know in their learning about some kind of content. So when I went to school. What I would do is I would have to do a worksheet write the teacher give me a worksheet or textbook, and our kids are doing things that are creative and innovative when I find it you know a lot of people say why would you teach seventh grade their starting to get mouthy and all the things people say when you teach seventh grade, but if you teach seventh grade in a way that is created and exciting kids. I am to read and they get into their learning increase in don't even realize how much they're doing and that's what the green screens have done for our kids. It allowed them to share what they know in ways other than worksheets and in the process really learn more and become more engaged with each other what the random act of kindness that the La Crosse public education foundation does not. So I'm in addition to my role as a teacher, I am a volunteer with Rhonda Longfellow middle school food pantry and so we have so many kids with so many me and I think that's another hidden secret that not everybody knows about you. There is no we have kids that come to school and they don't have food. They don't have afterschool sacks. One of the things that we had been aside right away that middle school kids don't have is some of your basic necessities that many parents just think everyone should have the random acts of kindness we've been able to make sure that all of our kids have underwear all of our kids. All of Our Girls Have Undergarments and so Usually It's Something That Most People Just Assume That Everybody Has Underwear, but They Don't Know What We Do without the Reading Acts of Kindness. What I Love about the La Crosse Public Education Foundation Is Their Sole Mission Is to Make School Better for Kids in the Car As a Teacher Who Has Called upon the Foundation Many Many Times I Just Can't Think Them More and I Appreciate so Much That Their Mission Is to Help All Is Not What Is Cost Public Schools Is a Workable Cost of Public Education for the Foundations of Hands-On Private Fundraising to Provide Grants to Teachers and Money for Rent the Backs of Crime Is to Address Students the Green off the Coast with Self-Esteem and Academic Success. To Donate, Please Visit La Crosse Education Foundation.org That's La Crosse Education Foundation.Award the Goldstar Educators Podcast Is a Podcast for Hire.com Production]]>https://api.spreaker.com/episode/19568370Fri, 18 Oct 2019 12:16:15 +0000Produced by Podcast For HireGreat things are happening every day in La Crosse public schools. Hear first- hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time. To make a donation please...hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Jeanne Halderson is a 7th-grade language arts and social studies teacher at Longfellow Middle School.

Transcription is for seo purposes and is not 100% accurate.
Welcome to Goldstar educators, a podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time that I never take me love seventh grade and I look back on my favorite year of my entire schooling came through college that great is still my favorite year to Jean Halderson is a Cooley pod. Teachers seventh grade teacher. By the way, teaches social studies and language arts at Longfellow middle school. I really don't think that the public knows all the things of the La Crosse public education foundation does to help out our students. There are so many things that that I know for me the foundation I weave my way of thinking if I got to be a better way to see something a person always involves money right because I needed some kind of cheerio I need some kind of experience and it wasn't everything that the regular school budget could pay for and sell because I'm one of those dreamer type teachers and I dream about what you I would write grants and there's someone out there that believe that there is something more creative and innovative to. That's why the foundation works and I'm guessing that most people don't know all of the amazing things that happened in our school district because of the foundation. Tell me about one of the grants you've written to you lately when I've been writing grants. I've been writing on, or all three. No school so that everybody benefits. One of the things that I wrote a grant for was green screens for the classrooms and for the library so that kids could take their iPads and use the green screen technology just like they do is you know the weatherman and they could transfer themselves to different countries they could pretend like they were different people and so it really fit every single on subject matter and so the foundation has provided green screens for all three schools. We have the green screen captains where the kids can put the whole green screen cast and I and you disappear gloves we have mass and really unique way for kids to show what they know in their learning about some kind of content. So when I went to school. What I would do is I would have to do a worksheet write the teacher give me a worksheet or textbook, and our kids are doing things that are creative and innovative when I find it you know a lot of people say why would you teach seventh grade their starting to get mouthy and all the things people say when you teach seventh grade, but if you teach seventh grade in a way that is created and exciting kids. I am to read and they get into their learning increase in don't even realize how much they're doing and that's what the green screens have done for our kids. It allowed them to share what they know in ways other than worksheets and in the process really learn more and become more engaged with each other what the random act of kindness that the La Crosse public education foundation does not. So I'm in addition to my role as a teacher, I am a volunteer with Rhonda Longfellow middle school food pantry and so we have so many kids with so many me and I think that's another hidden secret that not everybody knows about you. There is no we have kids that come to school and they don't have food. They...]]>318acts,children,community,education,foundation,goldstar,grant,halderson,jeanee,kindness,lacrosse,longfellow,lpef,podcastforhire,public,random,school,sdlax,strengthening,teacherfalsefullhttps://www.spreaker.com/episode/lpef-gold-star-educators-podcast-series-carrie-wuensch-harden--19568148hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Transcription is for seo purposes and is not 100% accurate.
Carrie Wuensch-Harden is the Library Media Specialist (Librarian) and High Performance Learning Teacher at Hamilton-SOTA

Welcome to Goldstar educators podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time when I get to my librarian Carrie Woods. Harden is a library media specialist. The librarian and high performance learning teacher at Hamilton soda care is been a frequent grant recipient with the La Crosse public education foundation. Carrie tell me about some of the things that you've done with the grant she received from the La Crosse public education foundation hundred 90 different grant in one half brained where we really grant washable ball and washable throwing things in Thailand felt their washed were reunited in the queue to get and I really think the why were we doing it and it's a great thing to have the kids eat their lunches which are phenomenal. By the way, and then instead of the landfill and in the garbage they put it like it when it's ready to have breakfast at Hamilton and had lunch at Hamilton underrates food is good for school lunch. We racking lunch ladies and actually worked with Shannon who is one of our main lines ladies on and she was so open and he was all about. What with our kids. What made you think about using a La Crosse public education foundation grant for that we support it with gloves we could put it within our community and his team to do a great job of talking about what is available and a form to fill out and said that baby is now and then I would look at the place and so what you tell about the random acts of kindness program usually goes through our community services team with administration. For that something where if we need we don't have to write up a grand or beg and plead we can just go to IKEA and say hey we had this need. How can you help me and they are still giving and caring just like our kids which is great because some kids just don't have what they need and then it may be shameful. But if we can just give it to them applies or she do it or you know there is great. What else do I need to know. You know that the cost of the education foundation has been a fantastic job of supporting our school that you need to know that because of that I really been able to change how I keep company with technology and is always something on the back burner for me that I'm like okay the money for that. But I can apply for a grant and maybe it could be in my future so I know that it's a possibility. If not, I know, I think that it's not something that can happen if the media that can happen in my mind and I like that yet, but that is not what is the cost public schools is a workable cost public education about the foundations of hands on five fundraising to provide grants to teachers and money for random acts of crime is to address students leave that create obstacles with self-esteem and academic success. To learn to donate please visit La Crosse education foundation.org that's La Crosse education foundation.award the Goldstar educators podcast is a podcast for hire.com production]]>https://api.spreaker.com/episode/19568148Fri, 18 Oct 2019 12:07:26 +0000Produced by Podcast For HireGreat things are happening every day in La Crosse public schools. Hear first- hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time. To make a donation please...hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Transcription is for seo purposes and is not 100% accurate.
Carrie Wuensch-Harden is the Library Media Specialist (Librarian) and High Performance Learning Teacher at Hamilton-SOTA

Welcome to Goldstar educators podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time when I get to my librarian Carrie Woods. Harden is a library media specialist. The librarian and high performance learning teacher at Hamilton soda care is been a frequent grant recipient with the La Crosse public education foundation. Carrie tell me about some of the things that you've done with the grant she received from the La Crosse public education foundation hundred 90 different grant in one half brained where we really grant washable ball and washable throwing things in Thailand felt their washed were reunited in the queue to get and I really think the why were we doing it and it's a great thing to have the kids eat their lunches which are phenomenal. By the way, and then instead of the landfill and in the garbage they put it like it when it's ready to have breakfast at Hamilton and had lunch at Hamilton underrates food is good for school lunch. We racking lunch ladies and actually worked with Shannon who is one of our main lines ladies on and she was so open and he was all about. What with our kids. What made you think about using a La Crosse public education foundation grant for that we support it with gloves we could put it within our community and his team to do a great job of talking about what is available and a form to fill out and said that baby is now and then I would look at the place and so what you tell about the random acts of kindness program usually goes through our community services team with administration. For that something where if we need we don't have to write up a grand or beg and plead we can just go to IKEA and say hey we had this need. How can you help me and they are still giving and caring just like our kids which is great because some kids just don't have what they need and then it may be shameful. But if we can just give it to them applies or she do it or you know there is great. What else do I need to know. You know that the cost of the education foundation has been a fantastic job of supporting our school that you need to know that because of that I really been able to change how I keep company with technology and is always something on the back burner for me that I'm like okay the money for that. But I can apply for a grant and maybe it could be in my future so I know that it's a possibility. If not, I know, I think that it's not something that can happen if the media that can happen in my mind and I like that yet, but that is not what is the cost public schools is a workable cost public education about the foundations of hands on five fundraising to provide grants to teachers and money for random acts of crime is to address students leave that create obstacles with self-esteem and academic success. To learn to donate please visit La Crosse education foundation.org that's La Crosse education foundation.award the Goldstar educators podcast is a podcast for hire.com production]]>238acts,carrie,children,community,education,foundation,goldstar,grant,hamilton,kindness,lacrosse,lpef,podcastforhire,public,random,school,sdlax,strengthening,teacher,wuensch-hardenfalsefullhttps://www.spreaker.com/episode/lpef-gold-star-educators-podcast-series-steve-johnston--19568124hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Transcription is for seo purposes and is not 100% accurate.
Steve Johnston teaches engineering and digital electronics at Logan High School.

Welcome to Goldstar educators podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time to get a lifeline here will just without their support and at that week you could do some of the things that none of the project would've been available Steve Johnson as an engineering and digital electronics teacher at Logan high school. I think our kids are super blessed to have things like engineering and digital electronics and things like that now available to them in high school. What kind of grants has a lacrosse public education foundation but able to help you with a great deal with a number project done. One of the first one grant I wrote was for a remote operated underwater vehicle basically made out of PVC pipe and bilge pump microcontrollers that had a WebCam and we would go down to the bottom like all put cool or a lake so I don't want the first one to get them. We moved to another project called their unmanned aerial vehicle and we partnered with their inland power to design the vehicle and what happened to your own power to send a helicopter out quarterly to take a look at powerline education going over and so on. We thought well let's try to make a grown would do that you expect of powerline and go through that difficult terrain that we moved to another when we partnered with the train Ingersoll-Rand through design and build a vehicle for you. You've probably heard about the Google car right and use vehicles that are driver left and they have a semi that goes between two plants quite a and they're wondering if there's any way they could automate that we decided to take a look at a vehicle that was capable of thinking that the environment and navigating without human input. We decided had be powered by solar energy, so is really neat design activity for the kids and we ended up designing a vehicle that is about the size of go-cart is what what would be so is this about the scale of force solely on what things you tell me the high school students designed every one of these things you're talking about. Yeah, yeah. We were very fortunate to be in a community where we have unity support in the form of local engineers and businesses and industries that will come in and be partner with and give the kid that that's the question over the top that they need. As far as finding out how to do a lot of these projects have been posted online for the defendant from start. How we document the engineering design process and picture the kids doing different things as well as all our successes and failures like the Kelly kids fail forward and if you're going to fail fail early, though failure is just something that we have to accept and in a job and learn from. So when we make a mistake for something doesn't work we learn from it and then use that to fail forward move forward in the process. We just don't want to fail late in the process used project that we've done no II think it's the key point is districts can't just don't have the budgets to support a lot of these things so I was out. Organizations like the La Crosse public education foundation, I and other community partners. I mean none of these things would've happened. These kids wouldn't have got those experiences and it's a really sad thing because I think that if they don't happen because no movement. Some of these stem related careers. As you can be really nice paying job was things are happening in the cross public schools is a workable cost public education foundation. The foundation depends on five fundraising to provide grants to teachers and money for random acts of kindness to address students leave that create obstacles to attendance, self-esteem and academic success. To learn more and to donate please visit La Crosse education foundation.org that's La Crosse education foundation.award the Goldstar educators podcast is a podcast for hire.com production]]>https://api.spreaker.com/episode/19568124Fri, 18 Oct 2019 11:45:14 +0000Produced by Podcast For HireGreat things are happening every day in La Crosse public schools. Hear first- hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time. To make a donation please...hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Transcription is for seo purposes and is not 100% accurate.
Steve Johnston teaches engineering and digital electronics at Logan High School.

Welcome to Goldstar educators podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time to get a lifeline here will just without their support and at that week you could do some of the things that none of the project would've been available Steve Johnson as an engineering and digital electronics teacher at Logan high school. I think our kids are super blessed to have things like engineering and digital electronics and things like that now available to them in high school. What kind of grants has a lacrosse public education foundation but able to help you with a great deal with a number project done. One of the first one grant I wrote was for a remote operated underwater vehicle basically made out of PVC pipe and bilge pump microcontrollers that had a WebCam and we would go down to the bottom like all put cool or a lake so I don't want the first one to get them. We moved to another project called their unmanned aerial vehicle and we partnered with their inland power to design the vehicle and what happened to your own power to send a helicopter out quarterly to take a look at powerline education going over and so on. We thought well let's try to make a grown would do that you expect of powerline and go through that difficult terrain that we moved to another when we partnered with the train Ingersoll-Rand through design and build a vehicle for you. You've probably heard about the Google car right and use vehicles that are driver left and they have a semi that goes between two plants quite a and they're wondering if there's any way they could automate that we decided to take a look at a vehicle that was capable of thinking that the environment and navigating without human input. We decided had be powered by solar energy, so is really neat design activity for the kids and we ended up designing a vehicle that is about the size of go-cart is what what would be so is this about the scale of force solely on what things you tell me the high school students designed every one of these things you're talking about. Yeah, yeah. We were very fortunate to be in a community where we have unity support in the form of local engineers and businesses and industries that will come in and be partner with and give the kid that that's the question over the top that they need. As far as finding out how to do a lot of these projects have been posted online for the defendant from start. How we document the engineering design process and picture the kids doing different things as well as all our successes and failures like the Kelly kids fail forward and if you're going to fail fail early, though failure is just something that we have to accept and in a job and learn from. So when we make a mistake for something doesn't work we learn from it and then use that to fail forward move forward in the process. We just don't want to fail late in the process used project that we've done no II think it's the key point is districts can't just don't have the budgets to support a lot of these things so I was out. Organizations like the La Crosse public education foundation, I and other community partners. I mean none of these things would've happened. These kids wouldn't have got those experiences...]]>262acts,children,community,education,foundation,goldstar,grant,johnston,kindness,lacrosse,logan,lpef,podcastforhire,public,random,school,sdlax,steve,strengthening,teacherfalsefullhttps://www.spreaker.com/episode/lpef-gold-star-educators-podcast-series-pahoua-vang--19567884hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Transcription is for seo purposes and is not 100% accurate.

PaHoua is a pre-k teacher at Hintgen

Welcome to Goldstar educators, a podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time where care Paola Vang is a pre-kindergarten teacher at Hinton elementary school. Do you have a teacher that you try to emulate the teacher how are you like me trying to care about me, who I've had the chance to talk to a bunch of teachers now about the La Crosse public education foundation and the stories that they tell me are amazing. But what you're doing with the grant that you received. That's pretty dang amazing as well kill the community out there like to be a long involvement can grant out there that will help me so they can Really help out bring Terry from the community teaching the kids about how being pretty direct experience and motivate them to be creative and lifelong learning. That's awesome so you also have the La Crosse public education foundation help you with another grant for a crake fire training for training and for Carol learned that a crake around and will offer you the packet foundation skills working in a playful way, especially skills that you are going like Crawley, Jan Ballantine, Carol, you don't think now you are going really really important foundational skill go for what can you tell about the read the backs of kindness that the La Crosse public education foundation does I can to call on basic pain. 394 in order to provide any public education foundation. We would be able to heal and put all of the bank guard. In Karbala think our school foundation. We would really go with that was because public schools do the work of the cross public education foundation. The foundation depends on five fundraising to provide grants to teachers and money for random acts of kindness to address students leave that create obstacles to attendance, self-esteem and academic success, to learn and to donate please visit La Crosse education foundation.org that's La Crosse education foundation.award the Goldstar educators podcast is a podcast for hire.com production]]>https://api.spreaker.com/episode/19567884Fri, 18 Oct 2019 11:39:01 +0000Produced by Podcast For HireGreat things are happening every day in La Crosse public schools. Hear first- hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time. To make a donation please...hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Transcription is for seo purposes and is not 100% accurate.

PaHoua is a pre-k teacher at Hintgen

Welcome to Goldstar educators, a podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time where care Paola Vang is a pre-kindergarten teacher at Hinton elementary school. Do you have a teacher that you try to emulate the teacher how are you like me trying to care about me, who I've had the chance to talk to a bunch of teachers now about the La Crosse public education foundation and the stories that they tell me are amazing. But what you're doing with the grant that you received. That's pretty dang amazing as well kill the community out there like to be a long involvement can grant out there that will help me so they can Really help out bring Terry from the community teaching the kids about how being pretty direct experience and motivate them to be creative and lifelong learning. That's awesome so you also have the La Crosse public education foundation help you with another grant for a crake fire training for training and for Carol learned that a crake around and will offer you the packet foundation skills working in a playful way, especially skills that you are going like Crawley, Jan Ballantine, Carol, you don't think now you are going really really important foundational skill go for what can you tell about the read the backs of kindness that the La Crosse public education foundation does I can to call on basic pain. 394 in order to provide any public education foundation. We would be able to heal and put all of the bank guard. In Karbala think our school foundation. We would really go with that was because public schools do the work of the cross public education foundation. The foundation depends on five fundraising to provide grants to teachers and money for random acts of kindness to address students leave that create obstacles to attendance, self-esteem and academic success, to learn and to donate please visit La Crosse education foundation.org that's La Crosse education foundation.award the Goldstar educators podcast is a podcast for hire.com production]]>265acts,children,community,education,foundation,goldstar,grant,hintgen,kindness,lacrosse,lpef,pahoua,podcastforhire,public,random,school,sdlax,strengthening,teacher,vangfalsefullhttps://www.spreaker.com/episode/lpef-gold-star-educators-podcast-series-mandi-wolfgram--19421794hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Transcription is for seo purposes and is not 100% accurate.

Amanda (Mandi) Wolfgram, music teacher at North Woods International School.

Welcome to Goldstar educators, a podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time when I can let anybody care for our nation. While citizens to meet the needs of Amanda Mandi Wolfgram music teacher from Northwoods international school has used La Crosse public education foundation to get grants quite a few times over the last 20 years of being a teacher we find is the best thing about the La Crosse public education foundation on learning many possible. What are some of the things you've seen the La Crosse public education foundation do for children in the long years, 12, 13,000 by October 13 years of school after school board game clouds on stock transfer instruments from all over the world can be using & being able to have experiences on stock and some grants so our sound system so that I can can be better heard in our planning process bigger ones that I've received and in collaboration with all of the only trees in the district and see actually have a sentence equally needs that travels to all of the schools I've recanted 3rd to 5th grade or fourth and fifth grade gets to wearing ukulele in our school districts because of that grants one last year we received larger grants to provide African drums from school districts for all of the school finance_15 g that they had access to all you lands on one of the teachers just run a grants Volkswagen, masking drumming group communal spiritual class Hindustan assembly for the cans and Wrangler actually can get some training while we can leave those drum circles more authentically notice most Mandi from heaven using abuse that I've done with the teachers, there's a lot of passion with the teachers of the school District of La Crosse. I would hundred percent security in quick links also show popular care again now because I am such a fabulous staff both in the music staff. All of the schools in Florence my ankle. One of the things I keep hearing about with the La Crosse public education foundation is the random act of kindness read and accept payments is such a special thing that LPL provides for because it really leads to the schools to know what are the greatest needs of your kids about family finance had worked with Amy and her creamy realistically focusing me think how many wonderful things are happening across public schools through the work of the cross public education foundation. The foundation depends on private fundraising to provide grants to teachers and money for random acts of kindness to address students leave grid obstacles to attendance, self-esteem and academic success. To learn more and to donate please visit La Crosse education foundation.org that's La Crosse education foundation.award the Goldstar educators podcast is a podcast for hire.com production]]>https://api.spreaker.com/episode/19421794Wed, 09 Oct 2019 12:53:16 +0000Produced by Podcast For HireGreat things are happening every day in La Crosse public schools. Hear first- hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time. To make a donation please...hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Transcription is for seo purposes and is not 100% accurate.

Amanda (Mandi) Wolfgram, music teacher at North Woods International School.

Welcome to Goldstar educators, a podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time when I can let anybody care for our nation. While citizens to meet the needs of Amanda Mandi Wolfgram music teacher from Northwoods international school has used La Crosse public education foundation to get grants quite a few times over the last 20 years of being a teacher we find is the best thing about the La Crosse public education foundation on learning many possible. What are some of the things you've seen the La Crosse public education foundation do for children in the long years, 12, 13,000 by October 13 years of school after school board game clouds on stock transfer instruments from all over the world can be using & being able to have experiences on stock and some grants so our sound system so that I can can be better heard in our planning process bigger ones that I've received and in collaboration with all of the only trees in the district and see actually have a sentence equally needs that travels to all of the schools I've recanted 3rd to 5th grade or fourth and fifth grade gets to wearing ukulele in our school districts because of that grants one last year we received larger grants to provide African drums from school districts for all of the school finance_15 g that they had access to all you lands on one of the teachers just run a grants Volkswagen, masking drumming group communal spiritual class Hindustan assembly for the cans and Wrangler actually can get some training while we can leave those drum circles more authentically notice most Mandi from heaven using abuse that I've done with the teachers, there's a lot of passion with the teachers of the school District of La Crosse. I would hundred percent security in quick links also show popular care again now because I am such a fabulous staff both in the music staff. All of the schools in Florence my ankle. One of the things I keep hearing about with the La Crosse public education foundation is the random act of kindness read and accept payments is such a special thing that LPL provides for because it really leads to the schools to know what are the greatest needs of your kids about family finance had worked with Amy and her creamy realistically focusing me think how many wonderful things are happening across public schools through the work of the cross public education foundation. The foundation depends on private fundraising to provide grants to teachers and money for random acts of kindness to address students leave grid obstacles to attendance, self-esteem and academic success. To learn more and to donate please visit La Crosse education foundation.org that's La Crosse education foundation.award the Goldstar educators podcast is a podcast for hire.com production]]>254acts,children,community,education,foundation,goldstar,grant,kindness,lacrosse,lpef,mandi,northwoods,podcastforhire,public,random,school,sdlax,strengthening,teacher,wolfgramfalsefullhttps://www.spreaker.com/episode/lpef-gold-star-educators-podcast-series-rick-blasing--19421745hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Transcription is for seo purposes and is not 100% accurate.

Rick Blasing, counselor at Lincoln Middle School.

welcome to Goldstar educators podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time, every educator may have different replacing as a counselor at Lincoln middle school at a counselor if I had a friend that you know what I made a difference today and I'm actually seeing the results within that same 24 hour period. Whether it's helping with the family. The student kid situation. Sometimes you can see immediate results, and after very rewarding. After some something going on in terms of conflict or, or something of that nature. Rick tell me about how you got drawn into the La Crosse public education foundation. I was made aware that at one point come by the advertising and one of the board members approached me because I had them the privilege of being a student counselor, advisor, and we don't hold different assemblies for different things got beakers and understood real quickly that La Crosse public education foundation is like a aspiring for encouraging educators instead of the jumpstart that situation, it became clear to me that yes there providing funding but I thought at the bike providing the creative fuel for all the extraordinary possibilities of what a teacher could do with that funding and I just start applying for some grants and some different speakers in the different assemblies and things and they been nothing but supportive IT across the board. Their support of an adventure that the distal wide-ranging will to leave a couple of the grants you've received from the La Crosse public education foundation will over the years as a counselor in student counselor, advisor with my mission is to contribute to the environment of the school, the well-being of the students, and more importantly increasingly, much more so in recent years. In recent decades, let's say, helping families and neighborhoods whose children come to our school so there's a direct connection there. So some of the things we've done have been inspirational speakers, people are coming to talk about. Keep your eyes and the prize and plowing ahead in life. Even if your situation at home or elsewhere isn't perfect. At the time that is not who you are is a student that your future is ahead of you and we can create your own life that some speakers have been to discuss the challenge of folks who may be have not been advanced have not had the advantage. Most recently I met them. Judge Kristi Yang. He was born in a refugee camp in Thailand and now he is an elected judge in the city of Milwaukee. Kristi Yang actually agreed to come to our school. La Crosse public education foundation funded that she talked to her students he taught from high school students and she also talked educators this quite amazing that there is an example that that funding, providing that for everyone here. It sounds like the La Crosse public education foundation does a lot of things for a lot of different people. I am amazed when I look at the list of the different grants awarded how wide-ranging they are. I think it empowers teachers. It really does. It encourages and empowers them. What I see those wonderful outside of the box kind of ideas get. It provides that that inspiration and encouragement to go for I am honored and I would say that I'm so grateful for the La Crosse public education foundation for the funding that are supporting for these these wonderful ideas I can say it jumpstart to get those ideas off the drawing boards and insidious limitations. One just things are happening a little cross public schools through the work of the La Crosse public education foundation. The foundation depends on private fundraising to provide grants to teachers and money for random act of kindness to address students leave grid obstacles to attendance, self-esteem and academic success. To learn more and to donate please visit La Crosse education foundation.org that's La Crosse education foundation.award the Goldstar educators podcast is a podcast for hire.com production]]>https://api.spreaker.com/episode/19421745Wed, 09 Oct 2019 12:45:58 +0000Produced by Podcast For HireGreat things are happening every day in La Crosse public schools. Hear first- hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time. To make a donation please...hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Transcription is for seo purposes and is not 100% accurate.

Rick Blasing, counselor at Lincoln Middle School.

welcome to Goldstar educators podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time, every educator may have different replacing as a counselor at Lincoln middle school at a counselor if I had a friend that you know what I made a difference today and I'm actually seeing the results within that same 24 hour period. Whether it's helping with the family. The student kid situation. Sometimes you can see immediate results, and after very rewarding. After some something going on in terms of conflict or, or something of that nature. Rick tell me about how you got drawn into the La Crosse public education foundation. I was made aware that at one point come by the advertising and one of the board members approached me because I had them the privilege of being a student counselor, advisor, and we don't hold different assemblies for different things got beakers and understood real quickly that La Crosse public education foundation is like a aspiring for encouraging educators instead of the jumpstart that situation, it became clear to me that yes there providing funding but I thought at the bike providing the creative fuel for all the extraordinary possibilities of what a teacher could do with that funding and I just start applying for some grants and some different speakers in the different assemblies and things and they been nothing but supportive IT across the board. Their support of an adventure that the distal wide-ranging will to leave a couple of the grants you've received from the La Crosse public education foundation will over the years as a counselor in student counselor, advisor with my mission is to contribute to the environment of the school, the well-being of the students, and more importantly increasingly, much more so in recent years. In recent decades, let's say, helping families and neighborhoods whose children come to our school so there's a direct connection there. So some of the things we've done have been inspirational speakers, people are coming to talk about. Keep your eyes and the prize and plowing ahead in life. Even if your situation at home or elsewhere isn't perfect. At the time that is not who you are is a student that your future is ahead of you and we can create your own life that some speakers have been to discuss the challenge of folks who may be have not been advanced have not had the advantage. Most recently I met them. Judge Kristi Yang. He was born in a refugee camp in Thailand and now he is an elected judge in the city of Milwaukee. Kristi Yang actually agreed to come to our school. La Crosse public education foundation funded that she talked to her students he taught from high school students and she also talked educators this quite amazing that there is an example that that funding, providing that for everyone here. It sounds like the La Crosse public education foundation does a lot of things for a lot of different people. I am amazed when I look at the list of the different grants awarded how wide-ranging they are. I think it empowers teachers. It really does. It encourages and empowers them. What I see those wonderful outside of the box kind of ideas get. It provides that that inspiration and encouragement to go for I am honored and I would say...]]>241acts,blasing,children,community,education,foundation,goldstar,grant,kindness,lacrosse,lincoln,lpef,podcastforhire,public,random,rick,school,sdlax,strengthening,teacherfalsefullhttps://www.spreaker.com/episode/lpef-gold-star-educators-podcast-series-tracy-taylor-johnson--19421607hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Transcription is for seo purposes and is not 100% accurate.

Tracy Taylor-Johnson, third-grade teacher at Summit Environmental
School.

welcome to Goldstar educators podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time in your class,
yelp like hearing stories about the dead. Now that they were large as they showed you one day that I was born Tracy Taylor Johnson is 1/3 grade teacher at Summit environmental school. Trish is been a teacher for 32 years everything I know that what we are learning important and you and you can do it Tracy. It's great to know that there's people out there that are willing to help out teacher such as yourself, like the La Crosse public education foundation. Tell me your thoughts on the La Crosse public education foundation of people act. All during my day during the year. I wish I had wanted to do the time that I could gather other teachers that the conversation about our supported things that I think are important for many other teachers, then such a fabulous court. During my career, certainly, and in fact that the kids enter into school now graduated out of the grants you've written is there one that stands out is closer to your heart than any of the other ones. I think that first translate relic was about Milwaukee, and teach teachers about, what we do. Said they have been exposed to trauma what we can expect and how we can regulate them and help them know that we are going to love and support them and keep them safe at school. That's a huge issue right now is that kids need to feel safe at school. Don't all my gosh yes I respond cool, thanks for you do for the kids and I probably don't hear that very often, but I feel very department that I have written grants La Crosse to make a different class about forgiveness, how to deal with strong emotion and so actually for all of the cockpit floor and go through all of the different writing letter for somebody or somebody can't go back and talk about all learned about forgiveness as one that was a great cult that was also wonderful things are happening across public schools through the work of the cross public education foundation. The foundation depends on private fundraising to provide grants to teachers and money for random act of kindness to address students leave grid obstacles to attendance, self-esteem and academic success. To learn more and to donate please visit La Crosse education foundation.org that's La Crosse education foundation.award the Goldstar educators podcast is a podcast for hire.com production]]>https://api.spreaker.com/episode/19421607Wed, 09 Oct 2019 12:41:03 +0000Produced by Podcast For HireGreat things are happening every day in La Crosse public schools. Hear first- hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time. To make a donation please...hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

Transcription is for seo purposes and is not 100% accurate.

Tracy Taylor-Johnson, third-grade teacher at Summit Environmental
School.

welcome to Goldstar educators podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time in your class,
yelp like hearing stories about the dead. Now that they were large as they showed you one day that I was born Tracy Taylor Johnson is 1/3 grade teacher at Summit environmental school. Trish is been a teacher for 32 years everything I know that what we are learning important and you and you can do it Tracy. It's great to know that there's people out there that are willing to help out teacher such as yourself, like the La Crosse public education foundation. Tell me your thoughts on the La Crosse public education foundation of people act. All during my day during the year. I wish I had wanted to do the time that I could gather other teachers that the conversation about our supported things that I think are important for many other teachers, then such a fabulous court. During my career, certainly, and in fact that the kids enter into school now graduated out of the grants you've written is there one that stands out is closer to your heart than any of the other ones. I think that first translate relic was about Milwaukee, and teach teachers about, what we do. Said they have been exposed to trauma what we can expect and how we can regulate them and help them know that we are going to love and support them and keep them safe at school. That's a huge issue right now is that kids need to feel safe at school. Don't all my gosh yes I respond cool, thanks for you do for the kids and I probably don't hear that very often, but I feel very department that I have written grants La Crosse to make a different class about forgiveness, how to deal with strong emotion and so actually for all of the cockpit floor and go through all of the different writing letter for somebody or somebody can't go back and talk about all learned about forgiveness as one that was a great cult that was also wonderful things are happening across public schools through the work of the cross public education foundation. The foundation depends on private fundraising to provide grants to teachers and money for random act of kindness to address students leave grid obstacles to attendance, self-esteem and academic success. To learn more and to donate please visit La Crosse education foundation.org that's La Crosse education foundation.award the Goldstar educators podcast is a podcast for hire.com production]]>265acts,children,community,education,elementry,foundation,goldstar,grant,kindness,lacrosse,lpef,podcastforhire,random,school,sdlax,strengthening,summit,taylor-johnson,teacher,tracyfalsefullhttps://www.spreaker.com/episode/lpef-gold-star-educators-podcast-series-tim-sprain--19421521hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

 Tim Sprain, science teacher at Lincoln Middle School.

Transcription is for seo purposes and is not 100% accurate.

welcome to Goldstar educators podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time frame that we are in a place where people are all about likely caught the drift was like we're untouched reckless in night. Tim sprain is a science teacher at Lincoln middle school and one of the lead teachers of theater program throughout the district of La Crosse, Tim, tell me about how the La Crosse public education foundation helps you out on a daily basis. All my goodness will first of all, they give me that current finance and support emotionally educator the foundation had lifted me up emotionally and financially to a place where I can actually feel I can really do my job effectively again. Leah was 10 years ago and they put the tools in my hands that are up-to-date and ready to be in the student can. It's something that if there is ever an idea that we have. We can go to them and they'll be like yes Brad we go to administration and other limited budgets right now so it's hard to get everything we need to have excellent in our school without the public foundation is essential that look, education foundation is here and what makes La Crosse a wonderful place to live and send your kids to public school. What you tell me about the random act of kindness that they have all my like that that one thing that I have shed tears on a regular basis and the impact that our families in the class. We have a transient population. We have several people that are homeless. We have people that are looking for freedom refugee. We have people that speak multiple languages look cool. The region is a beacon of hope for families and often times they come to the La Crosse public schools to get the education they need for their student and we not only care for them in a way that ensures excellent education, but we also show that they have what they need basic needs food, clothing, random acts of kindness have really put legitimate groups on the feet of kids jacket food in there in the mouse to get through this rough time. Every staff member in our school are always looking out for the kids and we always find that there are needs that cannot be met at home because of situations and we can direct those funds into specific student needs to man a chance to talk a little bit about how the La Crosse public education foundation helps out students, but they also reach outside of the classroom and how about students above and beyond with some extracurricular activities and things to help out with that as well. Don't say absolutely and it got public education foundation will need to impact not just the sports activities, whether it's a new set of uniforms or some equipment or not. Even when we get this brand-new sound system so that people that have hearing impairments can come in and enjoy. Here are shows clearly in the audience members and have a more enjoyable experience watching those shows and watching those sporting events and feel like they're part of that community because La Crosse public education foundation that we can add that I think indicate and fill that idea of what you can't go out many of the listeners. Everybody has to leave the children become adults and other leaders in our community that are doing the same thing they're giving their making buildings are designing Riverside North there designing the old Kmart people that are making a huge difference in our community. La Crosse is a beautiful, wonderful things are happening a little cross public schools through the work of the cross public education foundation. The foundation depends on private fundraising to provide grants to teachers and money for random act of kindness to address students leave grid obstacles to attendance, self-esteem and academic success. To learn more and to donate please visit La Crosse education foundation.org that's La Crosse education foundation.award the Goldstar educators podcast is a podcast for hire.com production]]>https://api.spreaker.com/episode/19421521Wed, 09 Oct 2019 12:33:39 +0000Produced by Podcast For HireGreat things are happening every day in La Crosse public schools. Hear first- hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time. To make a donation please...hand from teachers on the front lines about how the La Crosse Public Education Foundation is strengthening the community, one student at a time.

To make a donation please visit our website https://lacrosseeducationfoundation.org/

 Tim Sprain, science teacher at Lincoln Middle School.

Transcription is for seo purposes and is not 100% accurate.

welcome to Goldstar educators podcast from the La Crosse public education foundation. Great things are happening every day lacrosse public schools hear first-hand from teachers that are on the front lines about how this nonprofit education foundation is strengthening our community, one student at a time frame that we are in a place where people are all about likely caught the drift was like we're untouched reckless in night. Tim sprain is a science teacher at Lincoln middle school and one of the lead teachers of theater program throughout the district of La Crosse, Tim, tell me about how the La Crosse public education foundation helps you out on a daily basis. All my goodness will first of all, they give me that current finance and support emotionally educator the foundation had lifted me up emotionally and financially to a place where I can actually feel I can really do my job effectively again. Leah was 10 years ago and they put the tools in my hands that are up-to-date and ready to be in the student can. It's something that if there is ever an idea that we have. We can go to them and they'll be like yes Brad we go to administration and other limited budgets right now so it's hard to get everything we need to have excellent in our school without the public foundation is essential that look, education foundation is here and what makes La Crosse a wonderful place to live and send your kids to public school. What you tell me about the random act of kindness that they have all my like that that one thing that I have shed tears on a regular basis and the impact that our families in the class. We have a transient population. We have several people that are homeless. We have people that are looking for freedom refugee. We have people that speak multiple languages look cool. The region is a beacon of hope for families and often times they come to the La Crosse public schools to get the education they need for their student and we not only care for them in a way that ensures excellent education, but we also show that they have what they need basic needs food, clothing, random acts of kindness have really put legitimate groups on the feet of kids jacket food in there in the mouse to get through this rough time. Every staff member in our school are always looking out for the kids and we always find that there are needs that cannot be met at home because of situations and we can direct those funds into specific student needs to man a chance to talk a little bit about how the La Crosse public education foundation helps out students, but they also reach outside of the classroom and how about students above and beyond with some extracurricular activities and things to help out with that as well. Don't say absolutely and it got public education foundation will need to impact not just the sports activities, whether it's a new set of uniforms or some equipment or not. Even when we get this brand-new sound system so that people that have hearing impairments can come in and enjoy. Here are shows clearly in the audience members and have a more enjoyable experience watching those shows and watching those sporting events and feel like they're part of that community because La Crosse public education foundation that we can add that I think indicate and fill that idea of what you can't go out many of the listeners. Everybody has to leave the children become adults and other leaders in our community that are...]]>271acts,children,community,education,foundation,goldstar,grant,kindness,lacrosse,lincoln,lpef,podcastforhire,public,random,school,sdlax,sprain,strengthening,teacher,timfalsefullhttps://www.spreaker.com/episode/e9-wisconsin-great-river-road-mr-festival--19339318www.WiGRR.com
Irishfest- https://www.irishfestlacrosse.org
Riverfest- https://riverfestlacrosse.com
Rotary Lights- https://www.rotarylights.org
Country Boom- https://www.countryboom.com

Bob: I’ve lived in La Crosse since 1992, and I’ve had the opportunity to do a lot of different things. One of the persons I’m pleased to know is Mr. Festival. Those of you who don’t know who Mr. Festival is, it’s Pat Stephens. Pat is involved in everything – well, almost everything. Pat, thanks for being on with us this month for the Great River Road Podcast. Tell me about some of the things you’re involved in.

Pat: Well, in the summer months, of course, you have Riverfest, which is right on the Mississippi River in Riverside Park in La Crosse. It’s always a huge success [and] a lot of fun – [it’s] a great family festival as well. That’s followed just a couple weeks later with Country Boom that’s held at Maple Grove Country Club just outside of La Crosse. That’s growing significantly. [There are] probably 20,000 to 25,000 people in attendance out there. It’s a great country [music] fest. We get into August, and then we’ve got Irishfest. It’s a little bit better and more improved each and every year, so that keeps us busy. Oktoberfest comes around at the end of September, then we take a little break as we get into Rotary Lights, [which is] the largest holiday display in the Midwest. It starts the day after Thanksgiving. There’s never a dull moment.

Bob: I was going to say, what do you do in your spare time, Pat? Is there such a thing as spare time when it comes to being Pat Stephens?

Pat: Not really, because beyond the festivals there’s a whole host of other community things that I try to take a leadership role with as well, so there’s never a dull moment.

Bob: How did you get involved with helping out the community?

Pat: I think it all started back in high school. I was very active and involved in all sorts of clubs and organizations, and [I was] class president and all those sorts of things. When I got to the University of [Wisconsin]-La Crosse as a student, I immediately got involved with one of the social fraternities, Delta Sigma Phi. We got extremely involved with things on campus, with student government, with getting a fraternity house and putting on a couple concerts on campus as well. It just kind of carried over after we graduated so we could continue that involvement.

Bob: What do you like best about living on the Wisconsin Great River Road?

Pat: Oh, my goodness. I drove back from the Twin Cities yesterday and took the Great River Road on the Wisconsin side. When we went up for the weekend, we went on the Minnesota side, which is also very beautiful. I had my two older sisters with me in the car, and they had never been on the Great River Road while in the Milwaukee area, so they just tremendously enjoyed it. We stopped in a lot of the small towns. The people are friendly. The architecture that some of those towns have maintained is simply beautiful. The water is always something to watch. They were so fascinated with the barge traffic, which they had never seen, either. You just kind of take it for granted as a daily activity.

Bob: Let’s kind of look at that a little bit, because I think a lot of people that don’t live in this beautiful area where we live don’t tend to know what they’re missing.

Pat: There is nothing like it. I enjoy driving people who come to La Crosse for the first time. It’s amazing how many people on the east side of the state have never discovered Wisconsin’s western coast. They get over here, and generally they’re in awe of the bluffs, the river, [and] the beautiful forests that we have. And of course, we have all sorts of amenities in our areas using the rivers: canoeing, kayaking, the bike trails, the hiking trails. There’s a lot to offer over here. That’s why we call it home.

Bob: How do people get involved in some of the festivals that you’re involved in as Mr. Festival?

Pat: Usually your ambassadors, your current volunteers are your best recruiters. They have the best networking to get friends and family involved. It’s something that they themselves enjoy. In addition to that, of course, all of the festivals have websites. And I think to my knowledge, all of the websites have a place to put comments if you’d like to volunteer and help with a particular cause.]]>https://api.spreaker.com/episode/19339318Thu, 03 Oct 2019 14:20:29 +0000Produced by Podcast For HireTo find out more about the Wisconsin Great River Road please check out the website www.WiGRR.com Irishfest- https://www.irishfestlacrosse.org Riverfest- https://riverfestlacrosse.com Rotary Lights- https://www.rotarylights.org Country Boom-...www.WiGRR.com
Irishfest- https://www.irishfestlacrosse.org
Riverfest- https://riverfestlacrosse.com
Rotary Lights- https://www.rotarylights.org
Country Boom- https://www.countryboom.com

Bob: I’ve lived in La Crosse since 1992, and I’ve had the opportunity to do a lot of different things. One of the persons I’m pleased to know is Mr. Festival. Those of you who don’t know who Mr. Festival is, it’s Pat Stephens. Pat is involved in everything – well, almost everything. Pat, thanks for being on with us this month for the Great River Road Podcast. Tell me about some of the things you’re involved in.

Pat: Well, in the summer months, of course, you have Riverfest, which is right on the Mississippi River in Riverside Park in La Crosse. It’s always a huge success [and] a lot of fun – [it’s] a great family festival as well. That’s followed just a couple weeks later with Country Boom that’s held at Maple Grove Country Club just outside of La Crosse. That’s growing significantly. [There are] probably 20,000 to 25,000 people in attendance out there. It’s a great country [music] fest. We get into August, and then we’ve got Irishfest. It’s a little bit better and more improved each and every year, so that keeps us busy. Oktoberfest comes around at the end of September, then we take a little break as we get into Rotary Lights, [which is] the largest holiday display in the Midwest. It starts the day after Thanksgiving. There’s never a dull moment.

Bob: I was going to say, what do you do in your spare time, Pat? Is there such a thing as spare time when it comes to being Pat Stephens?

Pat: Not really, because beyond the festivals there’s a whole host of other community things that I try to take a leadership role with as well, so there’s never a dull moment.

Bob: How did you get involved with helping out the community?

Pat: I think it all started back in high school. I was very active and involved in all sorts of clubs and organizations, and [I was] class president and all those sorts of things. When I got to the University of [Wisconsin]-La Crosse as a student, I immediately got involved with one of the social fraternities, Delta Sigma Phi. We got extremely involved with things on campus, with student government, with getting a fraternity house and putting on a couple concerts on campus as well. It just kind of carried over after we graduated so we could continue that involvement.

Bob: What do you like best about living on the Wisconsin Great River Road?

Pat: Oh, my goodness. I drove back from the Twin Cities yesterday and took the Great River Road on the Wisconsin side. When we went up for the weekend, we went on the Minnesota side, which is also very beautiful. I had my two older sisters with me in the car, and they had never been on the Great River Road while in the Milwaukee area, so they just tremendously enjoyed it. We stopped in a lot of the small towns. The people are friendly. The architecture that some of those towns have maintained is simply beautiful. The water is always something to watch. They were so fascinated with the barge traffic, which they had never seen, either. You just kind of take it for granted as a daily activity.

Bob: Let’s kind of look at that a little bit, because I think a lot of people that don’t live in this beautiful area where we live don’t tend to know what they’re missing.

Pat: There is nothing like it. I enjoy driving people who come to La Crosse for the first time. It’s...]]>257countryboom,great,help,irishfest,lacrosse,microcast,mrfestival,pat,river,riverfest,road,rotarylights,stephens,volunteer,wigrr,wisconsinfalsefullhttps://www.spreaker.com/episode/e12-chris-jones-communication-goals--19244442https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.

This episode we start to talk about communication, what else do we hit on? Listen to the podcast to seewhere the conversation takes you.]]>https://api.spreaker.com/episode/19244442Thu, 26 Sep 2019 15:52:56 +0000Produced by Podcast For Hirehttps://www.hypnotistchrisjones.com/ Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance,...https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.

This episode we start to talk about communication, what else do we hit on? Listen to the podcast to seewhere the conversation takes you.]]>4931word,bswithbob,business,chris,college,communication,goals,hypnotist,jones,justtalking,listening,microcast,newlywed,one,oneword,religion,stacey,talking,travel,wordtruefullhttps://www.spreaker.com/episode/great-rivers-united-way-campaign--19139021Give, Advocate, Volunteer
For more information about the Great Rivers United Way please check out our website www.gruw.org or call 608-796-1400]]>https://api.spreaker.com/episode/19139021Wed, 18 Sep 2019 13:13:33 +0000Produced by Podcast For HireLive United Give, Advocate, Volunteer For more information about the Great Rivers United Way please check out our website www.gruw.org or call 608-796-1400Give, Advocate, Volunteer
For more information about the Great Rivers United Way please check out our website www.gruw.org or call 608-796-1400]]>167advocate,boshcka,campaign,gary,gifting,give,great,greatriversunitedway,gruw,lacrosse,live,matt,nonprofit,podcast,rivers,rudy,united,unitedway,volunteer,wayfalsefullhttps://www.spreaker.com/episode/s11-chris-jones-1-word-honeymoon-and-more--19038210https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.

This episode we start to talk about Chris Jones and where he went on his honeymoon, money and the first time we met. Listen to where the conversation takes you.]]>https://api.spreaker.com/episode/19038210Sun, 08 Sep 2019 12:55:47 +0000Produced by Podcast For Hirehttps://www.hypnotistchrisjones.com/ Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance,...https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.

This episode we start to talk about Chris Jones and where he went on his honeymoon, money and the first time we met. Listen to where the conversation takes you.]]>6521word,bswithbob,business,chris,college,goals,honeymoon,hypnotist,jones,justtalking,love,marriage,microcast,newlywed,one,oneword,religion,stacey,travel,wordtruefullhttps://www.spreaker.com/episode/e8-wisconsin-great-river-road-stonefield-historic-site--18919834www.WiGRR.com to find out about Stonefield Historic Site visit https://stonefield.wisconsinhistory.org/
https://www.facebook.com/stonefieldhistoricsite/

Susan: You know, there is something about the Mississippi River that just makes such a connection with people from all over the world. And we do get visitors from all over the world. We are just like in the heart of this beautiful area. We love to be a part of the Great River Road, and we are happy that we are one of the Interpretive Centers on the highway.

Bob: The Wisconsin Great River Road Podcast. This time, [I’m] speaking with Susan Caya-Slusser. Susan is with the Wisconsin Historical Society. I visited the Stonefield historic site, and I’ll tell you what: That place was history alive. Susan, that place is amazing.

Susan: It is. Yes, Stonefield is one of 12 historic sites operated by the Wisconsin Historical Society. It’s kind of a hidden gem down in Cassville, Wisconsin. It’s located right on the Great River Road. If you want to get to Cassville, there are so many things to do. There is even a car ferry. Yes, we need to get more people down there because there’s so much to see and so much to do once you get in the area.

Bob: When we were walking through Stonefield – and there are a bunch of old farm implement in there – to be that close to some of that stuff and to look to see how big it was and to know what it does, that’s pretty cool. The little placard told me the story.

Susan: Yes. So how Stonefield came to be is, it started in 1948. There was a great renewal and interest in our farming history. Folks were moving off the farm [and] they were moving into the cities. We wanted to make sure we didn’t lose this rich history, so that was what started it all. And Stonefield opened up for the first time in 1953.

Bob: I couldn’t believe how cool the Stonefield site was. Was that the original Cassville where all the buildings are and the main street and you’re walking around the schoolhouses?

Susan: When you come into Stonefield, there are different components that you’ll get to go on tour. There the homestead of Nelson Dewey. There is an entrance into what was Governor Nelson Dewey’s barn – this large, beautiful stone barn. There’s the State Ag [Agricultural] Museum. There’s a 1901 progressive farmhouse. But then you walk through this beautiful covered bridge that was built in 1964, and it takes you into a recreated village. The cool thing about it is a lot of the buildings that you’re seeing are old schoolhouses from across Wisconsin that have been repurposed. To recreate a village, what would it have been like for a farmer in 1900? This is the recreation in the people’s minds of the Wisconsin Historical Society and UW Extension what a farming village would have been like in 1900. If you visited the schoolhouse, that was actually the Muddy Hollow schoolhouse that was just up the road from where we sit today.

Bob: I was thinking if my kids were in there, they’d be like. ‘How do you get Wi-Fi in here?’

Susan: We are thrilled and we are fortunate that we get school visitors from not just Wisconsin, but also Illinois and Iowa that come and visit us in Stonefield. It is wonderful to be able to compare and contrast how things have changed over time, even to the boys sitting on one side of classroom and girls sitting on the other, even to the point where the boys and girls have to use separate doors. It’s just a way to take the kids back and make them think, and also hopefully make them appreciate what they have today.

Bob: You mentioned just a minute ago about appreciating things that you have. I’m guessing anybody that walks through the State Agricultural Museum that looked at the old metal tires [and] the old iron tires, they would appreciate immediately the rubber tires we get to drive on today.

Susan: Oh, yes. You kind of see a progressive change over time as you move through the State Agricultural Museum, even to one of the first that we have, we have a 1932 Allis Chalmers tractor parked way back in the corner. If you look at it, it actually has tires from an airplane.

Bob: Is that why they’re bald?

Susan: Yes. That is why they are big and bald the way they are. One of our claims to fame is that we have America’s oldest tractor. We have the McCormick Auto-Mower. The tractor we have is one of two prototypes made to exhibit at the World’s Fair in Paris in 1900.

Bob: Besides the beauty of seeing Stonefield in its natural state, I’m assuming you guys probably have different events going on through the year.

Susan: Yes. In June we do Agricultural Appreciation Day, tying in with June Dairy Month. In September we have our annual Great River Road Fall Fest. This one is a favorite of mine because it really brings the village to life – the sounds, the smell, the horse and tractors. It just really takes you back to a different time. One of our most popular events is in October, and that is what we call our “Safe and Spooky Event.” This is put on by the Friends of Stonefield and Nelson Dewey State Park – it’s our volunteer group. What happens is the whole village is transformed. Different volunteer groups come into the village, and all the buildings get transformed to be a little more spooky and eerie for Halloween. You will see everything and anyone at “Safe and Spooky Halloween.” All costumes are welcome.

Bob: Susan, how do people find out more about Stonefield, the Wisconsin Historic Site?

Susan: There are two ways I would recommend. The first is just our webpage, which is stonefield.wisconsinhistory.org. The second is we have a very active Facebook page, which is just Stonefield Historic Site. That’s where you can find out more information about our events. There’s something for everyone when you come and visit Stonefield.]]>https://api.spreaker.com/episode/18919834Mon, 26 Aug 2019 16:24:48 +0000Produced by Podcast For HireTo find out more about the Wisconsin Great River Road please check out the website www.WiGRR.com to find out about Stonefield Historic Site visit https://stonefield.wisconsinhistory.org/ https://www.facebook.com/stonefieldhistoricsite/ Susan: You...www.WiGRR.com to find out about Stonefield Historic Site visit https://stonefield.wisconsinhistory.org/
https://www.facebook.com/stonefieldhistoricsite/

Susan: You know, there is something about the Mississippi River that just makes such a connection with people from all over the world. And we do get visitors from all over the world. We are just like in the heart of this beautiful area. We love to be a part of the Great River Road, and we are happy that we are one of the Interpretive Centers on the highway.

Bob: The Wisconsin Great River Road Podcast. This time, [I’m] speaking with Susan Caya-Slusser. Susan is with the Wisconsin Historical Society. I visited the Stonefield historic site, and I’ll tell you what: That place was history alive. Susan, that place is amazing.

Susan: It is. Yes, Stonefield is one of 12 historic sites operated by the Wisconsin Historical Society. It’s kind of a hidden gem down in Cassville, Wisconsin. It’s located right on the Great River Road. If you want to get to Cassville, there are so many things to do. There is even a car ferry. Yes, we need to get more people down there because there’s so much to see and so much to do once you get in the area.

Bob: When we were walking through Stonefield – and there are a bunch of old farm implement in there – to be that close to some of that stuff and to look to see how big it was and to know what it does, that’s pretty cool. The little placard told me the story.

Susan: Yes. So how Stonefield came to be is, it started in 1948. There was a great renewal and interest in our farming history. Folks were moving off the farm [and] they were moving into the cities. We wanted to make sure we didn’t lose this rich history, so that was what started it all. And Stonefield opened up for the first time in 1953.

Bob: I couldn’t believe how cool the Stonefield site was. Was that the original Cassville where all the buildings are and the main street and you’re walking around the schoolhouses?

Susan: When you come into Stonefield, there are different components that you’ll get to go on tour. There the homestead of Nelson Dewey. There is an entrance into what was Governor Nelson Dewey’s barn – this large, beautiful stone barn. There’s the State Ag [Agricultural] Museum. There’s a 1901 progressive farmhouse. But then you walk through this beautiful covered bridge that was built in 1964, and it takes you into a recreated village. The cool thing about it is a lot of the buildings that you’re seeing are old schoolhouses from across Wisconsin that have been repurposed. To recreate a village, what would it have been like for a farmer in 1900? This is the recreation in the people’s minds of the Wisconsin Historical Society and UW Extension what a farming village would have been like in 1900. If you visited the schoolhouse, that was actually the Muddy Hollow schoolhouse that was just up the road from where we sit today.

Bob: I was thinking if my kids were in there, they’d be like. ‘How do you get Wi-Fi in here?’

Susan: We are thrilled and we are fortunate that we get school visitors from not just Wisconsin, but also Illinois and Iowa that come and visit us in Stonefield. It is wonderful to be able to compare and contrast how things have changed over time, even to the boys sitting on one side of classroom and girls sitting on the other, even to the point where the boys and girls have to use separate doors. It’s just a way to take the kids back and make them think, and also hopefully make them appreciate what they have today.

Bob: You mentioned just a...]]>357bob,bswithbob,caya-slusser,dewey,great,highway35,historic,historical,mississippi,nelson,river,riverroad,road,schmidt,site,society,stonefield,susan,wisconsin,wisconsingreatriverroadfalsefullhttps://www.spreaker.com/episode/e7-wisconsin-great-river-road-elmaro-vineyards--18641087www.WiGRR.com to find out about Elmaro Vineyard check out http://elmarovineyard.com/

Lynita Delaney: The name is Elmaro Vineyard, but I don’t care what they call us. It doesn’t matter to me. It’s like holding a wine glass. Do I care if somebody holds the bowl with the wine glass? Uh-uh. That’s up to them how they want to hold the wine glass, and it’s up to them what they want to call us. We’re getting to be [where] more folks just say ‘Elmaro,’ and they’ll know where it is and that’s good. It’s like Kleenex for facial tissues – it’s a good thing. One of the things we’ve always talked about is letting people feel special for a day, because people here in the Midwest have a lot of stress and have a lot of things going on in their lives. If they can come here and feel special, listen to music, have someone wait on them, drink a glass of wine and eat a cheese plate or whatever for a day, we’ve succeeded.

Bob: I’m going to tell you that when my wife and I went out to Elmaro, and I explained to you that I wasn’t a wine drinker [and] that I’d stolen a bottle of wine as a kid and drank too much of it and didn’t like it. Elmaro changed my view on wine because I had two glasses of wine. I had a glass of the cranberry and I had the Duet, and they were both fantastic. Then we shared the local cheese and meat tray, and it was delicious. Every piece of that – everything that you just explained – encompassed our time. We enjoyed ourselves. It was at peace. It was a beautiful day. We got to be outside. We got to see the surroundings and your beautiful farm, and we tasted your great-tasting wine. It was an awesome day.

Lynita: That’s what we’re going for: just to let people have somewhere that they can feel like a queen for a day or a king for a day.

Bob: You guys have won a lot of awards. What different awards has Elmaro won?

Lynita: We’re always striving for a little more, and to do it a little better, and we’re learning all the time. We have had one wine that won a sweepstakes out at Long Beach, and that is a suburb of L.A., and that we won the sweepstakes. The sweepstakes means we’re the best white wine in their competition according to the judges. That one we were really thrilled about after we learned what a sweepstakes was, because we didn’t know. When the lady who won the best red wine sweepstakes called me and congratulated me, I was like, ‘Oh, that’s nice. Thank you, and congrats to you, too.’ She said, ‘You don’t get it. We’ve tried 40 years to get a sweepstakes, and we finally got one, and you’ve got one now, too.’ We’d only been making wine four or five years when that happened. We were pretty thrilled.

Bob: How did you come up with the name of Elmaro?

Lynita: It happened in 1976. Mark and his mom and dad had farmed together, and when they incorporated they had to come up with a name. Mark’s dad said, ‘Let’s use all our names together,’ so it was Elaine, Mark, and Robert, which turned into Elmaro. It was Elmaro Farms for many years. When we built the winery we were trying to come up with a name, and we thought about Tremplo and Riverview and all sorts of things. Finally, Mark said, ‘Why don’t we use the name of the farm? It sounds like a winery.’ So we used Elmaro [and] we had a story behind it. We did some research to make sure it didn’t mean anything in Spanish, and then I was picking grapes with a kid out in Oregon for an experience trip for me. He started laughing when I told him what the name of the winery was. I said, ‘No, no, no. We checked and it doesn’t mean anything in Spanish.’ Elmaro, where he’s from, is slang, which means a child you can’t handle or someone who drank too much and you can’t control them. They’re elmaro.

Bob: Are you guys happy to be on the Great River Road?

Lynita: Yes, yes. The Great River Road is a great spot. We actually did some research before we built. We knew a winery had to attract 2 percent of the population in a 50-mile radius in order to survive. That’s where we started with the research. We also did research on how many cars go by Highway 35 on the Great River Road, and how many of them might stop based on how many cars were going by. That’s how we got here.

Bob: Is Elmaro open year-round?

Lynita: Yes. Thank goodness for the locals. Because we’re open during the winter Thursday through Sunday, the locals are what keep us alive. In fact, one day – and it’s very important to be open when we say we will be. One day, there was a blizzard on Sunday this winter, and everybody stayed home who worked here, except for me. Because I live walking distance away, I came down and opened the winery, and I had three guests all day. But those three guests had driven from Holmen, which is 20 miles away, and from Dodge, which is 10, 15 miles away on a bad road, to get here. If they would have come to the door and found out nobody was here, that would have been terrible. So yeah, you have to be open when you say you are.

Bob: When is Elmaro open?

Lynita: From the first of April to the first of January, we have summer hours, and those are every day except Monday. On weekdays it’s noon to 6. On Friday and Saturday it’s 10 a.m. to 7 p.m. On Sunday we’re not open in the morning because I don’t want it to be an excuse for kids not to go to church, so we’re open at noon and we close at 5 on Sunday.

Bob: What a fun conversation with Lynita from Elmaro Vineyards, located on the Wisconsin Great River Road, Highway 35 north of Trempealeau, Wisconsin. [It’s] a wonderful place to visit, chill out, and enjoy a sip of some great wine. Check out their website at elmarovineyard.com, or find them on Facebook at facebook.com/elmarovineyard.]]>https://api.spreaker.com/episode/18641087Thu, 25 Jul 2019 18:32:09 +0000Produced by Podcast For HireTo find out more about the Wisconsin Great River Road please check out the website www.WiGRR.com to find out about Elmaro Vineyard check out http://elmarovineyard.com/ Lynita Delaney: The name is Elmaro Vineyard, but I don’t care what they call us....www.WiGRR.com to find out about Elmaro Vineyard check out http://elmarovineyard.com/

Lynita Delaney: The name is Elmaro Vineyard, but I don’t care what they call us. It doesn’t matter to me. It’s like holding a wine glass. Do I care if somebody holds the bowl with the wine glass? Uh-uh. That’s up to them how they want to hold the wine glass, and it’s up to them what they want to call us. We’re getting to be [where] more folks just say ‘Elmaro,’ and they’ll know where it is and that’s good. It’s like Kleenex for facial tissues – it’s a good thing. One of the things we’ve always talked about is letting people feel special for a day, because people here in the Midwest have a lot of stress and have a lot of things going on in their lives. If they can come here and feel special, listen to music, have someone wait on them, drink a glass of wine and eat a cheese plate or whatever for a day, we’ve succeeded.

Bob: I’m going to tell you that when my wife and I went out to Elmaro, and I explained to you that I wasn’t a wine drinker [and] that I’d stolen a bottle of wine as a kid and drank too much of it and didn’t like it. Elmaro changed my view on wine because I had two glasses of wine. I had a glass of the cranberry and I had the Duet, and they were both fantastic. Then we shared the local cheese and meat tray, and it was delicious. Every piece of that – everything that you just explained – encompassed our time. We enjoyed ourselves. It was at peace. It was a beautiful day. We got to be outside. We got to see the surroundings and your beautiful farm, and we tasted your great-tasting wine. It was an awesome day.

Lynita: That’s what we’re going for: just to let people have somewhere that they can feel like a queen for a day or a king for a day.

Bob: You guys have won a lot of awards. What different awards has Elmaro won?

Lynita: We’re always striving for a little more, and to do it a little better, and we’re learning all the time. We have had one wine that won a sweepstakes out at Long Beach, and that is a suburb of L.A., and that we won the sweepstakes. The sweepstakes means we’re the best white wine in their competition according to the judges. That one we were really thrilled about after we learned what a sweepstakes was, because we didn’t know. When the lady who won the best red wine sweepstakes called me and congratulated me, I was like, ‘Oh, that’s nice. Thank you, and congrats to you, too.’ She said, ‘You don’t get it. We’ve tried 40 years to get a sweepstakes, and we finally got one, and you’ve got one now, too.’ We’d only been making wine four or five years when that happened. We were pretty thrilled.

Bob: How did you come up with the name of Elmaro?

Lynita: It happened in 1976. Mark and his mom and dad had farmed together, and when they incorporated they had to come up with a name. Mark’s dad said, ‘Let’s use all our names together,’ so it was Elaine, Mark, and Robert, which turned into Elmaro. It was Elmaro Farms for many years. When we built the winery we were trying to come up with a name, and we thought about Tremplo and Riverview and all sorts of things. Finally, Mark said, ‘Why don’t we use the name of the farm? It sounds like a winery.’ So we used Elmaro [and] we had a story behind it. We did some research to make sure it didn’t mean anything in Spanish, and then I was picking grapes with a kid out in Oregon for an experience trip for me. He started laughing when I told him what the name of the winery was. I said, ‘No, no, no. We checked and it doesn’t mean anything in Spanish.’ Elmaro, where he’s from, is slang, which means a child you can’t handle or someone who drank too much and you can’t control them....]]>370bswithbob,drinks,elmaro,farm,great,highway35,local,mississippi,podcastforhire,river,road,tastings,trempealeau,vine,vineyard,wigrr,wine,winery,winesamples,wisconsinfalsefullhttps://www.spreaker.com/episode/s10-chris-jones-1-word-marriage--18639758https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.

This episode we start to talk about Chris Jones getting married and where he is going on his honeymoon. Listen to where the conversation takes you.]]>https://api.spreaker.com/episode/18639758Thu, 25 Jul 2019 15:27:24 +0000Produced by Podcast For Hirehttps://www.hypnotistchrisjones.com/ Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance,...https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.

This episode we start to talk about Chris Jones getting married and where he is going on his honeymoon. Listen to where the conversation takes you.]]>9011word,bswithbob,business,chris,college,goals,hypnotist,jones,justtalking,love,marriage,microcast,newlywed,one,oneword,religion,stacey,teaching,travel,wordfalsefullhttps://www.spreaker.com/episode/s9-chris-jones-1-word-death-and-masterbation--18373033https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.

This episode we start to talk about Chris Jones losing one of his high school friends, and how he took the door off his bedroom. Listen to where the conversation takes you.]]>https://api.spreaker.com/episode/18373033Tue, 25 Jun 2019 17:00:14 +0000Produced by Podcast For Hirehttps://www.hypnotistchrisjones.com/ Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance,...https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.

This episode we start to talk about Chris Jones losing one of his high school friends, and how he took the door off his bedroom. Listen to where the conversation takes you.]]>7771word,bswithbob,business,chris,college,death,goals,hypnotist,jones,justtalking,masterbation,microcast,one,oneword,religion,teaching,travel,wordtruefullhttps://www.spreaker.com/episode/e6-wisconsin-great-river-road-chad-breuer-wyalusing-state-park--18311148www.WiGRR.com to find out about Wyalusing State Park find them at https://dnr.wi.gov/topic/parks/name/wyalusing/

Bob: Chad Breuer is the Property Supervisor of Wyalusing State Park. Wyalusing is kind of a different name. Where does the name come from, Chad?

Chad Breuer: It comes from the Native American word meaning ‘Where the old, or the Holy Man, dwells.’ I think what sets us apart is just where we’re located. We have the river, the confluence, the bluffs. And that’s why the park was formed back in 1917.

Bob: [It’s] over 100 years old. What kind of changes have been made in those 100 years, Chad?

Chad: Well, we’ve added camping. We’ve added more electrical sites. One hundred years ago, people were relying on rustic tent camping. Now, people like to still camp and get out, but [they also want] some of those luxuries of having, in case rain comes in, that camper, the grill or the oven, and the refrigerator to keep food cold. To be honest, my wife likes to sleep in a bed at night, so it’s those little things that a camper has that a tent doesn’t. We have sites for campers and a site for tent camping. A lot of people still tent camp. It’s very popular yet year-round; we even have people come in the winter and tent camp, so that’s pretty neat to get out and talk to those folks.

Bob: Do you have showers?

Chad: Yes, absolutely. We have two campgrounds. One [is] on the Wisconsin Ridge; that’s the older campground. It overlooks the bluff, and at night you can see the lights of Prairie du Chien. Then we have another campground – Homestead campground – that’s located a little more interior of the park. [It’s] a little more secluded, [and they’re] beautiful sites. [There is] a brand-new shower building, [and it’s] a beautiful shower building. We have about 109 campsites between the two campgrounds.

Bob: I’m assuming since you’re on the backwaters that kayaking is probably a pretty big thing to do there as well.

Chad: Absolutely. We have a canoe trail. We have a canoe trail that kind of heads south from the park, and you can head north out of the park. Our friends group, the Friends of Wyalusing, is a nonprofit group that works just to support the park. They support programs in the park, especially like our naturalist positions. They have canoes they rent every day. You can come up to our concession stand and rent the canoes from the Friends [of Wyalusing]. And that money stays right back here with the park by supporting our naturalist program by giving us the opportunity to hire someone to put on programs throughout the summer.

Bob: You mentioned a canoe trail. What is a canoe trail?

Chad: We’ve got signs up so people don’t … You get in the backwaters in the refuge there, and people could get lost. This way, we have signs up just marking a path, a route, for people to canoe so they don’t get lost if they’re not from the area.

Bob: If somebody hasn’t been to Wyalusing before, what would be the definite ‘you’ve got to see this’ moment there?

Chad: The big thing you have to see is Point Lookout. That’s why the park was identified; it’s where the confluence [of] where the Wisconsin [River] flows into the Mississippi [River]. We’ve got some great lookouts all along the park in the bluffs. If you want to come down and you want to spend some time, go to these lookouts and walk some of the trails and see the bluffs. If you’ve never seen it, it’s just spectacular. We’re 800 feet above the river, so it’s just spectacular views from up on the points.

Bob: Being on the Wisconsin Great River Road has a lot of perks. What are some of the perks that you find for Wyalusing being on the Great River Road?

Chad: I think anybody who’s traveling, this is definitely a destination stop. People are going to travel the Great River Road, and this is just a destination stop for people. They might not camp, but they’re going to come spend a few hours here seeing the park [and] going to the lookouts. They can look over the bluffs into Prairie du Chien, into Iowa and Marquette, [and] Pikes Peak State Park. If you’re traveling the Great River Road, this is a destination stop.

Bob: Where can people go, Chad, to find out more information about the park?

Chad: Definitely go online to the Wisconsin DNR [website] and type in ‘Wyalusing State Park.’ That’s a great way to start. It’s going to talk about the park and what we have to offer.

Bob: The big question is, you said type in ‘Wyalusing.’ How do you spell Wyalusing?

Chad: [It’s spelled] W-Y-A-L-U-S-I-N-G.

Bob: Is there anything I’m missing, Chad, that I should be asking you about?

Chad: On the Great River Road – correct me if I’m wrong – we’re talking about Highway 35?

Bob: Yup.

Chad: Then there’s a smaller property just south of Wyalusing, [and that’s] Nelson Dewey State Park. That is adjacent to historic Stonefield Village. When you do travel the Great River Road, make some time to stop at Nelson Dewey also. We have hiking trails, [but] not as many. We don’t have the boat landing, but you still have really neat lookouts down there. A lot of people go down there and they hit the lookouts, then they can go across the road and they’re at historic Stonefield Village.]]>https://api.spreaker.com/episode/18311148Tue, 18 Jun 2019 20:57:07 +0000Produced by Podcast For HireTo find out more about the Wisconsin Great River Road please check out the website www.WiGRR.com to find out about Wyalusing State Park find them at https://dnr.wi.gov/topic/parks/name/wyalusing/ Bob: Chad Breuer is the Property Supervisor of...www.WiGRR.com to find out about Wyalusing State Park find them at https://dnr.wi.gov/topic/parks/name/wyalusing/

Bob: Chad Breuer is the Property Supervisor of Wyalusing State Park. Wyalusing is kind of a different name. Where does the name come from, Chad?

Chad Breuer: It comes from the Native American word meaning ‘Where the old, or the Holy Man, dwells.’ I think what sets us apart is just where we’re located. We have the river, the confluence, the bluffs. And that’s why the park was formed back in 1917.

Bob: [It’s] over 100 years old. What kind of changes have been made in those 100 years, Chad?

Chad: Well, we’ve added camping. We’ve added more electrical sites. One hundred years ago, people were relying on rustic tent camping. Now, people like to still camp and get out, but [they also want] some of those luxuries of having, in case rain comes in, that camper, the grill or the oven, and the refrigerator to keep food cold. To be honest, my wife likes to sleep in a bed at night, so it’s those little things that a camper has that a tent doesn’t. We have sites for campers and a site for tent camping. A lot of people still tent camp. It’s very popular yet year-round; we even have people come in the winter and tent camp, so that’s pretty neat to get out and talk to those folks.

Bob: Do you have showers?

Chad: Yes, absolutely. We have two campgrounds. One [is] on the Wisconsin Ridge; that’s the older campground. It overlooks the bluff, and at night you can see the lights of Prairie du Chien. Then we have another campground – Homestead campground – that’s located a little more interior of the park. [It’s] a little more secluded, [and they’re] beautiful sites. [There is] a brand-new shower building, [and it’s] a beautiful shower building. We have about 109 campsites between the two campgrounds.

Bob: I’m assuming since you’re on the backwaters that kayaking is probably a pretty big thing to do there as well.

Chad: Absolutely. We have a canoe trail. We have a canoe trail that kind of heads south from the park, and you can head north out of the park. Our friends group, the Friends of Wyalusing, is a nonprofit group that works just to support the park. They support programs in the park, especially like our naturalist positions. They have canoes they rent every day. You can come up to our concession stand and rent the canoes from the Friends [of Wyalusing]. And that money stays right back here with the park by supporting our naturalist program by giving us the opportunity to hire someone to put on programs throughout the summer.

Bob: You mentioned a canoe trail. What is a canoe trail?

Chad: We’ve got signs up so people don’t … You get in the backwaters in the refuge there, and people could get lost. This way, we have signs up just marking a path, a route, for people to canoe so they don’t get lost if they’re not from the area.

Bob: If somebody hasn’t been to Wyalusing before, what would be the definite ‘you’ve got to see this’ moment there?

Chad: The big thing you have to see is Point Lookout. That’s why the park was identified; it’s where the confluence [of] where the Wisconsin [River] flows into the Mississippi [River]. We’ve got some great lookouts all along the park in the bluffs. If you want to come down and you want to spend some time, go to these lookouts and walk some of the trails and see the bluffs. If you’ve never seen it, it’s just spectacular. We’re 800 feet above the river, so it’s just spectacular views from up on the points.

Bob: Being on the Wisconsin Great River Road has a lot of perks. What are some of the perks that you...]]>342biking,boating,camping,canoe,dnr,fun,great,highway35,hiking,kayak,mississippi,mississippiriver,outdoor,park,river,road,state,trails,wisconsin,wyalusingfalsefullhttps://www.spreaker.com/episode/e1-scott-white-guaranteed-rate--18311101www.rate.com\Scott white or part. Just give me a call. I'm available on nights and weekends. My cell number is 608 386-5665 my customers my clients the people that I work for always welcome to call me at that number I can help people get things done on the weekend that others in helping you to save money on your home loan since 1997. Give Scott white from guaranteed rate of call today to help you to get your home]]>https://api.spreaker.com/episode/18311101Tue, 18 Jun 2019 20:48:26 +0000Produced by Podcast For HireHelping you to save money on your home loan since 1997. Give Scott white from guaranteed rate a call today to help you to get your home I'm Scott white I'm a mortgage lender with guaranteed rate I've been working as a lender, IT 97 helping people get...www.rate.com\Scott white or part. Just give me a call. I'm available on nights and weekends. My cell number is 608 386-5665 my customers my clients the people that I work for always welcome to call me at that number I can help people get things done on the weekend that others in helping you to save money on your home loan since 1997. Give Scott white from guaranteed rate of call today to help you to get your home]]>1831st,about,buyer,buying,guaranteed,guaranteedrate,home,homebuyer,homes,house,learn,rate,scott,selling,time,whitefalsefullhttps://www.spreaker.com/episode/s8-chris-jones-1-word-birthday--18114596https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.

This episode we start to talk about Chris Jones turning 33 and how his life has gone to this point and we always hit a rabbit hole and start talking about that. Listen to where the conversation takes you.]]>https://api.spreaker.com/episode/18114596Wed, 29 May 2019 18:14:05 +0000Produced by Podcast For Hirehttps://www.hypnotistchrisjones.com/ Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance,...https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard, and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Teller, Scam School, and the Adam Carolla Show.

This episode we start to talk about Chris Jones turning 33 and how his life has gone to this point and we always hit a rabbit hole and start talking about that. Listen to where the conversation takes you.]]>9601word,33,believe,birthday,bswithbob,business,chris,college,goals,hypnotist,jones,microcast,old,one,oneword,religion,teaching,travel,word,yearstruefullhttps://www.spreaker.com/episode/e5-wisconsin-great-river-road-raena-parsons--17921183www.WiGRR.com to find out about the Genoa Fish Hatchery find them at https://www.facebook.com/GenoaNFH This month on the Great River Road microcast we feature the Genoa Fish Hatchery. So, When is the Great River Road Interpretive Center open?

Raena Parsons: Monday through Friday, 8 a.m. to 3 p.m. We just opened this weekend for the weekends from 10:30 to 2:30 p.m.

Bob: Are you guys the only fish hatchery? Or are there more fish hatcheries around?

Raena: There are only two federal fish hatcheries within Wisconsin.

Bob: What exactly happens at the Genoa Fish Hatchery? We drive by it all the time, but it’s usually 55 or 60 miles an hour. You kind of glance over and you see some pools, but I’m not really sure what they’re for. I’m guessing that most of the people listening right now have no idea what those even are.

Raena: It varies by the time of year. We have 20 different ponds on station, ranging in size from one-tenth of one acre to 33 acres. We also have six raceways and seven intensive rearing buildings that make Genoa capable of collection, culturing, and rearing cold, cool, and warm-water fish species. On station, we rear anywhere from 15 to 20 different species of fish. The outdoor ponds are a great habitat for the fish in the summer when the water can warm up. Some of the ponds we use for broodstock production, and broodstock are spawning fish. They’re our own broodstock. We keep the little, small fish, and then we put them out there when they’re adults, and then they actually spawn and lay eggs. Right now, you can actually come down to the hatchery and see the smallmouth bass creating nests. They actually create nests along the shore, and then they spawn in those nests. Our largest pond, which is the 33-acre pond, is for our broodstock minnows. We actually raise our own minnows on station to feed our other fish, so it reduces our cost associated with fish food.

Bob: Can anybody go by and check out the Genoa Fish Hatchery?

Raena: Yes. Actually, the majority of the facility here is open to the public. There are a couple of facilities that are isolation facilities and quarantined for ill or diseased fishes or wild fish that we bring into the station, or eggs, that isn’t open to the public because of biosecurity concerns. But the rest of the station is actually open 7 a.m. until dusk. People can come and walk around the dike roads. The main buildings are going to be open 8 a.m. until about 3 p.m. You can into most of the buildings here on the station. But a good way to figure out where you can go or can’t go is actually to stop in the interpretive center, and we have a self-guided map that you can take, and it talks about what’s in each of the buildings and what changes in each of the ponds because the species of fish you’re going to see in the pond is going to change throughout the year depending upon what we have on station and what gets moved where.

Bob: Can I bring a fishing pole?

Raena: No, you cannot. We actually don’t permit any kind of fishing on station, except for special events. We do do a couple of kids fishing events here on station. We have a kids’ ice fishing day that we do in the winter that’s really popular. We did that one last February, and we actually had more than 450 people come to that event.

Bob: What do you think of the Great River Road?

Raena: I think it’s really a fantastic opportunity to see the region. To have this to go along and see all these different cities and towns is really fantastic.

Bob: With the Genoa Fish Hatchery being on the Great River Road, does that help with the traffic of people that stop in and check it out because it is on such a beautiful, scenic byway?

Raena: It is, and that’s actually part of the way that this facility was funded. That’s where the first original funding came from, through the Highways Commission, because Genoa actually bisects the highway. We have property on both sides of Highway 35, and we get a lot of people who come through here. This year, I think we’re going to get a really large increase of the number of visitors we get here because we have this great, new interpretive center that opened last June. Now it’s open every weekend. We have our volunteers who come in and work. Then I’m hoping this summer we’ll have some special events that happen on the weekends as well for the public, including guided tours and then some touch tanks.

Bob: Raena, what will somebody find for the first time that they go to the interpretive center?

Raena: Coming into the interpretive center, there’s a great map of the Great River Road. That’s the first thing people see. They can explore other options that are on the Great River Road. Upstairs on the main level, if you park in the parking lot, there’s a mezzanine that goes out and you can look over some of our ponds. We also have a green, living roof that’s visited by all four pollinators and bees. Downstairs, we have three main exhibit halls – one on the Mississippi River as a trade highway. Then we have one that talks about the fish and wildlife resources of the area. We have one dedicated to the Battle of Bad Axe, and then one that talks about the Mississippi River commerce. We also have two freshwater aquariums downstairs. We have a stream aquarium, and then a large, deeper water aquarium with sturgeon and catfish and perch and all sorts of stuff.

Bob: Is there a cost at all?

Raena: No, the entire facility is free. The interpretive center is free, and then coming to the hatchery is also free.]]>https://api.spreaker.com/episode/17921183Wed, 15 May 2019 17:30:24 +0000Produced by Podcast For HireTo find out more about the Wisconsin Great River Road please check out the website www.WiGRR.com to find out about the Genoa Fish Hatchery find them at https://www.facebook.com/GenoaNFH This month on the Great River Road microcast we feature the Genoa...www.WiGRR.com to find out about the Genoa Fish Hatchery find them at https://www.facebook.com/GenoaNFH This month on the Great River Road microcast we feature the Genoa Fish Hatchery. So, When is the Great River Road Interpretive Center open?

Raena Parsons: Monday through Friday, 8 a.m. to 3 p.m. We just opened this weekend for the weekends from 10:30 to 2:30 p.m.

Bob: Are you guys the only fish hatchery? Or are there more fish hatcheries around?

Raena: There are only two federal fish hatcheries within Wisconsin.

Bob: What exactly happens at the Genoa Fish Hatchery? We drive by it all the time, but it’s usually 55 or 60 miles an hour. You kind of glance over and you see some pools, but I’m not really sure what they’re for. I’m guessing that most of the people listening right now have no idea what those even are.

Raena: It varies by the time of year. We have 20 different ponds on station, ranging in size from one-tenth of one acre to 33 acres. We also have six raceways and seven intensive rearing buildings that make Genoa capable of collection, culturing, and rearing cold, cool, and warm-water fish species. On station, we rear anywhere from 15 to 20 different species of fish. The outdoor ponds are a great habitat for the fish in the summer when the water can warm up. Some of the ponds we use for broodstock production, and broodstock are spawning fish. They’re our own broodstock. We keep the little, small fish, and then we put them out there when they’re adults, and then they actually spawn and lay eggs. Right now, you can actually come down to the hatchery and see the smallmouth bass creating nests. They actually create nests along the shore, and then they spawn in those nests. Our largest pond, which is the 33-acre pond, is for our broodstock minnows. We actually raise our own minnows on station to feed our other fish, so it reduces our cost associated with fish food.

Bob: Can anybody go by and check out the Genoa Fish Hatchery?

Raena: Yes. Actually, the majority of the facility here is open to the public. There are a couple of facilities that are isolation facilities and quarantined for ill or diseased fishes or wild fish that we bring into the station, or eggs, that isn’t open to the public because of biosecurity concerns. But the rest of the station is actually open 7 a.m. until dusk. People can come and walk around the dike roads. The main buildings are going to be open 8 a.m. until about 3 p.m. You can into most of the buildings here on the station. But a good way to figure out where you can go or can’t go is actually to stop in the interpretive center, and we have a self-guided map that you can take, and it talks about what’s in each of the buildings and what changes in each of the ponds because the species of fish you’re going to see in the pond is going to change throughout the year depending upon what we have on station and what gets moved where.

Bob: Can I bring a fishing pole?

Raena: No, you cannot. We actually don’t permit any kind of fishing on station, except for special events. We do do a couple of kids fishing events here on station. We have a kids’ ice fishing day that we do in the winter that’s really popular. We did that one last February, and we actually had more than 450 people come to that event.

Bob: What do you think of the Great River Road?

Raena: I think it’s really a fantastic opportunity to see the region. To have this to go along and see all these different cities and towns is really fantastic.

Bob: With the Genoa Fish Hatchery being on the Great River Road, does that help with the traffic of people that stop in and check it out...]]>348bob,fish,fishing,genoa,great,greatriverroad,hatchery,microcast,mississippi,mississippiriver,mussels,national,parsons,raena,river,riverroad,road,schmidt,wisconsin,wisconsingreatriverroadfalsefullhttps://www.spreaker.com/episode/e1-viterbo-servant-leadership-conference-coming--17881183www.viterbo.edu/2019Conference for more information.]]>https://api.spreaker.com/episode/17881183Thu, 09 May 2019 16:07:23 +0000Produced by Podcast For HireFor the past five years, Viterbo University has held a Conference on Servant Leadership for individuals who aspire to be servant leaders in nonprofit organizations, business, government, health care, ministry, and education. This year's conference...www.viterbo.edu/2019Conference for more information.]]>8042019,center,conference,ethics,generation,keynote,leader,leaders,leadership,margaret,millennials,reinhart,servant,servantleadership,thibodeau,tom,university,viterbo,weber,wheatleyfalsefullhttps://www.spreaker.com/episode/e7-chris-jones-1-word-how-did-you-get-your-start--17768617https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Tellar, Scam School, and the Adam Carolla Show.

This episode Chris talks about his start into the business. Also his college job. Can you guess what it is?]]>https://api.spreaker.com/episode/17768617Tue, 30 Apr 2019 17:15:05 +0000Produced by Podcast For Hirehttps://www.hypnotistchrisjones.com/ Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard and Mel live. Since his first TV appearance,...https://www.hypnotistchrisjones.com/

Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Tellar, Scam School, and the Adam Carolla Show.

This episode Chris talks about his start into the business. Also his college job. Can you guess what it is?]]>5061word,anyone,believe,branding,bswithbob,business,chris,college,day,firsttime,hypnotist,jones,microcast,new,one,oneword,stripper,travel,wordfalsefullhttps://www.spreaker.com/episode/e12-eco-gardens-by-washburn-llc-podcast-merge-with-second-nature--17511129(608) 629-5975
ecogardensbywashburn.com

good news for Sarah Washburn from Eco Gardens by Washburn you basically you still have your company but your company is also changing to another company explained to me that I decided to actually married eco-garden with second nature. It reads Creek so second nature meets Creek just like eco-garden is fine with everything I could say landscaping services and customer service at the coolest thing about second nature reads Creek in an actual place. They have a nursery. They've got a great gift shop. You can go there to meet with the designers where at eco-garden club. I basically came to use Delphi merging with second nature meets Creek there just 7 miles south of the Rockwell inmates town. I really welcome anybody to contact that they are at 608295975 or you can email me personally at my email address is designed@packetnaturemeetscreek.com what's on the services to second nature offers the offer, landscape design, meaning newly established homes or we can come in and redo the landscape that maybe you just want to change up or we can certainly help with the erosion problem and then install of your landscape design. Definitely doing that once we get shall installed in your plant. Their love in it and you're doing good Watering. We can always come by and perform some plant maintenance for you but it just get spring or fall cleanup or maybe once every two weeks. If you want to do it yourself just that you know what this is what I'm looking for for the favorite color and plant. They we can find the perfect plant at the nursery is also I know that in the past to talk about some of the things that you did with Eagle Gardens by Washburn like helping people put in different gardens and such. Is that something that you guys are still doing yes absolutely. If it's something like a perennial plant garden or a wildflower garden or a native plant native plantings in your hillside. That type of thing a vegetable garden even know probably love to help you out want to become guards by Washburn decide to go together with second nature that reads Creek to merge together and play because there's only one of me emerged because you got the same vision we share the same work ethic and she had a commitment to quality, really. Both companies have that merging with second nature reads Creek is more attention to detail and more attention to our clients need simply because it got more people more time and there's a physical place to go and I think that really helpful]]>https://api.spreaker.com/episode/17511129Fri, 26 Apr 2019 17:25:12 +0000Produced by Podcast For HireEco Gardens by Washburn is now a part of Second Nature at Reads Creek (608) 629-5975 ecogardensbywashburn.com good news for Sarah Washburn from Eco Gardens by Washburn you basically you still have your company but your company is also changing to...(608) 629-5975
ecogardensbywashburn.com

good news for Sarah Washburn from Eco Gardens by Washburn you basically you still have your company but your company is also changing to another company explained to me that I decided to actually married eco-garden with second nature. It reads Creek so second nature meets Creek just like eco-garden is fine with everything I could say landscaping services and customer service at the coolest thing about second nature reads Creek in an actual place. They have a nursery. They've got a great gift shop. You can go there to meet with the designers where at eco-garden club. I basically came to use Delphi merging with second nature meets Creek there just 7 miles south of the Rockwell inmates town. I really welcome anybody to contact that they are at 608295975 or you can email me personally at my email address is designed@packetnaturemeetscreek.com what's on the services to second nature offers the offer, landscape design, meaning newly established homes or we can come in and redo the landscape that maybe you just want to change up or we can certainly help with the erosion problem and then install of your landscape design. Definitely doing that once we get shall installed in your plant. Their love in it and you're doing good Watering. We can always come by and perform some plant maintenance for you but it just get spring or fall cleanup or maybe once every two weeks. If you want to do it yourself just that you know what this is what I'm looking for for the favorite color and plant. They we can find the perfect plant at the nursery is also I know that in the past to talk about some of the things that you did with Eagle Gardens by Washburn like helping people put in different gardens and such. Is that something that you guys are still doing yes absolutely. If it's something like a perennial plant garden or a wildflower garden or a native plant native plantings in your hillside. That type of thing a vegetable garden even know probably love to help you out want to become guards by Washburn decide to go together with second nature that reads Creek to merge together and play because there's only one of me emerged because you got the same vision we share the same work ethic and she had a commitment to quality, really. Both companies have that merging with second nature reads Creek is more attention to detail and more attention to our clients need simply because it got more people more time and there's a physical place to go and I think that really helpful]]>184by,creek,customer,design,eco,ecogardens,garden,gardens,landscape,landscaper,nature,reads,sara,second,washburnfalsefullhttps://www.spreaker.com/episode/e8-invisible-fence-brand-of-the-tristates-62000-fences--17650034Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Karla: Sixty-two thousand Invisible Fence Brand systems were installed in 2018. Just think if there is one dog in each one of those houses, that means there are 62,000 dogs that are safe. They’re estimating that right now there are over 2 million dogs that are safe.

Bob: Because of Invisible Fence products.

Karla: Correct.

Bob: What makes Invisible Fence Brand products different and better than what the other people are selling?

Karla: I guess I would say the technology and our engineering. We’ve been around the longest, so we’ve got the most as far as research and technology into our products. We stand behind our products. The technology, I can tell you it’s patented. If you were to buy a cellphone today and wanted to compare it to a cellphone that maybe another company has, it might be a cellphone from 1993, that technology – analog versus digital versus smartphone. We’ve just come a long way, and we spend a lot of time and effort to make sure that what we put out there is safe for the pets.

Bob: When we talk, we say Invisible Fence Brand rather than just Invisible Fence. Is that because you guys are kind of the Kleenex of the invisible fences?

Karla: Yes. We are not a category. We are a brand.

Bob: What does that mean?

Karla: What you’re alluding to is that Kleenex is a brand. But if you say, ‘I need to blow my nose,’ you don’t say, ‘Can I have a facial tissue?’ You say, ‘Can I get a Kleenex?’ Why we add brand to that is to differentiate ourselves. We are a brand. We are not a category.

Bob: But you’re the top brand of the category that’s named after you.

Karla: Correct.

Bob: Is Invisible Fence Brand the first?

Karla: Yes, and it was invented by Mr. Peck, who was a traveling salesman. He got tired of seeing dogs dead on the side of the road and thought there had to be a better way. In the early 70s, if you were in the rural area and driving down the road, it wasn’t uncommon to see a dog dead on the side of the road. It just wasn’t. You don’t see very many dead animals on the side of the road like that anymore – not domesticated dogs or cats. You might see a deer, but I mean you just don’t see that anymore. And if you do see it, there’s someone there.

Bob: Is that because people have taken more care for their animals now, or because of the Invisible Fence Brand products?

Karla: I think that’s an encompassing question. I think it’s both. I think as time has gone on, we find value in our pets and we spend the money to keep them safe.

Bob: How do we find Invisible Fence Brand?

Karla: [The website is] invisiblefence.com.]]>https://api.spreaker.com/episode/17650034Mon, 15 Apr 2019 19:53:23 +0000Produced by Podcast For HireInvisible Fence Brand of the TriStates / E8 - 62,000 Fences Invisible Fence Brand of the Tri-States 319 Northstar RoadWI 54636 (608) 399-1266 https://tri-states.invisiblefence.com...Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Karla: Sixty-two thousand Invisible Fence Brand systems were installed in 2018. Just think if there is one dog in each one of those houses, that means there are 62,000 dogs that are safe. They’re estimating that right now there are over 2 million dogs that are safe.

Bob: Because of Invisible Fence products.

Karla: Correct.

Bob: What makes Invisible Fence Brand products different and better than what the other people are selling?

Karla: I guess I would say the technology and our engineering. We’ve been around the longest, so we’ve got the most as far as research and technology into our products. We stand behind our products. The technology, I can tell you it’s patented. If you were to buy a cellphone today and wanted to compare it to a cellphone that maybe another company has, it might be a cellphone from 1993, that technology – analog versus digital versus smartphone. We’ve just come a long way, and we spend a lot of time and effort to make sure that what we put out there is safe for the pets.

Bob: When we talk, we say Invisible Fence Brand rather than just Invisible Fence. Is that because you guys are kind of the Kleenex of the invisible fences?

Karla: Yes. We are not a category. We are a brand.

Bob: What does that mean?

Karla: What you’re alluding to is that Kleenex is a brand. But if you say, ‘I need to blow my nose,’ you don’t say, ‘Can I have a facial tissue?’ You say, ‘Can I get a Kleenex?’ Why we add brand to that is to differentiate ourselves. We are a brand. We are not a category.

Bob: But you’re the top brand of the category that’s named after you.

Karla: Correct.

Bob: Is Invisible Fence Brand the first?

Karla: Yes, and it was invented by Mr. Peck, who was a traveling salesman. He got tired of seeing dogs dead on the side of the road and thought there had to be a better way. In the early 70s, if you were in the rural area and driving down the road, it wasn’t uncommon to see a dog dead on the side of the road. It just wasn’t. You don’t see very many dead animals on the side of the road like that anymore – not domesticated dogs or cats. You might see a deer, but I mean you just don’t see that anymore. And if you do see it, there’s someone there.

Bob: Is that because people have taken more care for their animals now, or because of the Invisible Fence Brand products?

Karla: I think that’s an encompassing question. I think it’s both. I think as time has gone on, we find value in our pets and we spend the money to keep them safe.

Bob: How do we find Invisible Fence Brand?

Karla: [The website is] invisiblefence.com.]]>182falsefullhttps://www.spreaker.com/episode/e7-invisible-fence-brand-of-the-tristates-freedom--17650027Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Bob: So right now my dog, Tony, is looking in the garbage.

Karla: Great example. So Tony is going to dig in the garbage, which we’re not going to let him because he’s not going to. But I have solutions for that. We have indoor shields, which are avoidance products, so I can keep Tony out of the garbage. I can teach him to stay out of the garbage.

Bob: But if I put it in the garbage, then I’ll be throwing it away.

Karla: No, you’re not. You’re not going to put it in the garbage. We’re going to put it by the garbage. We might put it in the garbage can, but in the bottom. And because Tony could really use a friend and another dog in your house …

Bob: You’re not getting me to get another dog.

Karla: Let’s say Tony needs a buddy. Okay, so Tony, you get another dog, and that dog stays away from the garbage. You could set it up so it just affects Tony and not the other dog. Or, let’s say Tony and the other dog want to compete for each other’s food. Like I see on the floor here you have his dog bowls. We could put an Invisible Fence Brand Shields there, and I can have it set up different pets, different roles. I can have it set up so they can’t get at each other’s food while they’re eating dinner.

Bob: You mentioned for two dogs it’s a great solution. But what about somebody who has multiple dogs, like eight or nine or 10? Or 15, like you do?

Karla: I use them all the time

Bob: Are they that versatile that you’re able to give them that many different … Okay, this dog can do this, this dog can’t do that …

Karla: Or both these dogs can do this. Like for instance, in my basement I have two of my dogs that think the basement should be a great place to hide and go potty. So right now I have it set up so those two dogs can’t go down into the basement. But I have other of my dogs that can go down to the basement and it doesn’t even affect them. It doesn’t bother them.

Bob: So when all your dogs go downstairs, those two don’t go downstairs?

Karla: Correct.

Bob: They can’t even go down the steps.

Karla: Nope.

Bob: Is it something that’s gaudy that’s going to stand out?

Karla: Oh, gosh no. You can’t even see mine. I have it hidden on the steps.

Bob: Is it the size of a hockey puck?

Karla: I have one the size of a hockey puck. I have one the size of a salad plate. I have another that’s as long as a step and about 2 feet wide – like a plank. You could put it in a doorway. You can step on it. If you had someone who is handicapped in your home, they could wheel across it with a wheelchair. It’s great. I can keep dogs out of whole rooms. I can connect those together. I have two stinky sharpeis right now that used to love to go in by the grand piano and lick the piano while she was playing and it was gross and grossing her out. She didn’t want them licking her grand piano, so we set those up and we linked them together. Now they can’t get in there. It’s great. But they can sit outside that room and watch her and listen to her play the piano.

Bob: How big of a broadcast area do those have?

Karla: Quite large. That’s a huge room. It’s an open concept room. It’s huge. I have four of them linked together.

Bob: So those are some of the products. Can you also put some of the Invisible Fence Brand wire in the house too to keep it …?

Karla: If I want to, but I don’t need to.

Bob: Is that something that if somebody having a new build, could they incorporate that into the … Or putting a new floor into the kitchen?

Karla: Absolutely. We have done that. The other product that I haven’t talked a lot about but I’m really starting to fall in love with is our Doorman product. It’s a dog door.

Bob: Do you hire somebody to open the door for the dog?

Karla: No, but that’s kind of what it is.

Bob: I have children for that.

Karla: I do, too, but mine all left. Yours will leave eventually, too. Anyhow, I can do it in glass.

Bob: How?

Karla: We partner with another company.

Bob: So with the glass that I have on my backdoor right there?

Karla: Yeah, I can do that.

Bob: I don’t have to get a new door?

Karla: No. And then Tony could let himself in and out as he wanted to. And you can control it as well. You can say, ‘Okay, Tony. You know what? It’s 9 o’clock at night. You are done going outside and barking at the neighbor dog.’ So you can set it up so he can’t do that.

Bob: That’s pretty cool.

Karla: Or you can say, ‘You know what? It’s 6 o’clock in the morning. You want to go out and pee? Great. I’m not getting up with you.’ You can set it so the door will let him out at 6 in the morning.

Bob: So it can go right in the existing glass?

Karla: Yes, I can do that.

Bob: That’s pretty cool.

Karla: Isn’t it?

Bob: That’s a newer product?

Karla: We have had it for awhile, but we partner with another company that helps us get that in the glass. It’s not cheap, but at the end of the day, you want it to be sturdy. You want it to be stable, and you want it to be effective where your dog can go in and out. It’s peace of mind. I can do walls, too, with it.

Bob: I would figure you would probably have to do a wall.

Karla: And I can do regular doors, too.

Bob: I know that you’ve helped out my neighbor with her dog. She’s got a pass-through door for her dog.

Karla: Correct. That’s not a Doorman, but she has a Pet Safe Door. We sell those, too.

Bob: So basically there are solutions for anybody. How about any budget?

Karla: I have solutions for many budgets – yes, I do. We have barking solutions that I can offer. A lot of times when people get an Invisible Fence Brand solution, it’s all-encompassing. A lot of times a lot of problems dogs are having, whether it be barking or digging, I can take care of a lot of those things just by the freedom of them being able to go outside and be a dog.

Bob: How do we find Invisible Fence Brand?

Karla: [The website is] invisiblefence.com.]]>https://api.spreaker.com/episode/17650027Mon, 15 Apr 2019 19:52:01 +0000Produced by Podcast For HireInvisible Fence Brand of the TriStates / E7 - Freedom Invisible Fence Brand of the Tri-States 319 Northstar RoadWI 54636 (608) 399-1266 https://tri-states.invisiblefence.com...Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Bob: So right now my dog, Tony, is looking in the garbage.

Karla: Great example. So Tony is going to dig in the garbage, which we’re not going to let him because he’s not going to. But I have solutions for that. We have indoor shields, which are avoidance products, so I can keep Tony out of the garbage. I can teach him to stay out of the garbage.

Bob: But if I put it in the garbage, then I’ll be throwing it away.

Karla: No, you’re not. You’re not going to put it in the garbage. We’re going to put it by the garbage. We might put it in the garbage can, but in the bottom. And because Tony could really use a friend and another dog in your house …

Bob: You’re not getting me to get another dog.

Karla: Let’s say Tony needs a buddy. Okay, so Tony, you get another dog, and that dog stays away from the garbage. You could set it up so it just affects Tony and not the other dog. Or, let’s say Tony and the other dog want to compete for each other’s food. Like I see on the floor here you have his dog bowls. We could put an Invisible Fence Brand Shields there, and I can have it set up different pets, different roles. I can have it set up so they can’t get at each other’s food while they’re eating dinner.

Bob: You mentioned for two dogs it’s a great solution. But what about somebody who has multiple dogs, like eight or nine or 10? Or 15, like you do?

Karla: I use them all the time

Bob: Are they that versatile that you’re able to give them that many different … Okay, this dog can do this, this dog can’t do that …

Karla: Or both these dogs can do this. Like for instance, in my basement I have two of my dogs that think the basement should be a great place to hide and go potty. So right now I have it set up so those two dogs can’t go down into the basement. But I have other of my dogs that can go down to the basement and it doesn’t even affect them. It doesn’t bother them.

Bob: So when all your dogs go downstairs, those two don’t go downstairs?

Karla: Correct.

Bob: They can’t even go down the steps.

Karla: Nope.

Bob: Is it something that’s gaudy that’s going to stand out?

Karla: Oh, gosh no. You can’t even see mine. I have it hidden on the steps.

Bob: Is it the size of a hockey puck?

Karla: I have one the size of a hockey puck. I have one the size of a salad plate. I have another that’s as long as a step and about 2 feet wide – like a plank. You could put it in a doorway. You can step on it. If you had someone who is handicapped in your home, they could wheel across it with a wheelchair. It’s great. I can keep dogs out of whole rooms. I can connect those together. I have two stinky sharpeis right now that used to love to go in by the grand piano and lick the piano while she was playing and it was gross and grossing her out. She didn’t want them licking her grand piano, so we set those up and we linked them together. Now they can’t get in there. It’s great. But they can sit outside that room and watch her and listen to her play the piano.

Bob: How big of a broadcast area do those have?

Karla: Quite large. That’s a huge room. It’s an open concept room. It’s huge. I have four of them linked together.

Bob: So those are some of the products. Can you also put some of the Invisible Fence Brand wire in the house...]]>341falsefullhttps://www.spreaker.com/episode/e6-invisible-fence-brand-of-the-tristates-consistency--17650020Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Bob: Is it hard to train a dog, train an animal? As you mentioned in another podcast, you can put your Invisible Fence Brand products on other animals. Is it hard to train animals on the product?

Karla: No, not at all. Invisible Fence has spent a lot of money on training us how to train animals. We are certified by animal behavioralists on looking for cues and being able to work with those animals. There have been studies done about our products, and I’m very confident that I know that it’s consistency, and that is the key for any animal in any training.

Bob: When you start off with a puppy and you introduce your puppy to Invisible Fence Brand products, as that dog grows and becomes more a part of the family and integrated with the family, does the Invisible Fence Brand product continue to grow with that animal? Or do they end up outgrowing it?

Karla: Oh, gosh no. It grows with them. It’s for them. Just like you teach your kids how to be potty-trained, once they learn that, that stays with them. [It’s the] same with the ‘nos’ and the ‘yesses’ of the rules for dogs. If it’s consistent, they know the rules. So it grows with them, absolutely.

Bob: We talk about Invisible Fence Brand quite a bit. Is it more than just fences?

Karla: It’s consistency. It’s being part of a family. It’s integrating your dog to teaching them right from wrong. It’s a great tool.

Bob: You had mentioned how the Invisible Fence Brand products will help out multiple dogs. Different dogs have different lifespans. Lifespans are anywhere between 10 and 14 years. If you’re spending money on a product such as Invisible Fence Brand, you’ve got multiple dogs and you’re bringing multiple dogs in and out of your life throughout the course of your lifetime, do I have to keep rebuying the product, or is it going to last me a long time?

Karla: Nope. It will last you a long time. With my animals – and I lost three last year – I’ve reused those collars.

Bob: What about the unit itself for keeping my yard safe?

Karla: Same thing. We went to this house we’d never been to before. They were in our database, and they had a system that they bought in 1984, I think. [We’d] never been there. [We] got there, and their collar wasn’t working. And crazy enough, it was the craziest looking thing I’d ever seen. They had purchased a lifetime warranty, which now a lot of our products just come with a lifetime warranty. But back then, you had to purchase it, and they got a whole new system. And she had – what did she tell me? – 12 dogs on it so far.

Bob: How do we find Invisible Fence Brand?

Karla: [The website is] invisiblefence.com.]]>https://api.spreaker.com/episode/17650020Mon, 15 Apr 2019 19:50:47 +0000Produced by Podcast For HireInvisible Fence Brand of the TriStates / E6 - Consistency Invisible Fence Brand of the Tri-States 319 Northstar RoadWI 54636 (608) 399-1266 https://tri-states.invisiblefence.com...Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Bob: Is it hard to train a dog, train an animal? As you mentioned in another podcast, you can put your Invisible Fence Brand products on other animals. Is it hard to train animals on the product?

Karla: No, not at all. Invisible Fence has spent a lot of money on training us how to train animals. We are certified by animal behavioralists on looking for cues and being able to work with those animals. There have been studies done about our products, and I’m very confident that I know that it’s consistency, and that is the key for any animal in any training.

Bob: When you start off with a puppy and you introduce your puppy to Invisible Fence Brand products, as that dog grows and becomes more a part of the family and integrated with the family, does the Invisible Fence Brand product continue to grow with that animal? Or do they end up outgrowing it?

Karla: Oh, gosh no. It grows with them. It’s for them. Just like you teach your kids how to be potty-trained, once they learn that, that stays with them. [It’s the] same with the ‘nos’ and the ‘yesses’ of the rules for dogs. If it’s consistent, they know the rules. So it grows with them, absolutely.

Bob: We talk about Invisible Fence Brand quite a bit. Is it more than just fences?

Karla: It’s consistency. It’s being part of a family. It’s integrating your dog to teaching them right from wrong. It’s a great tool.

Bob: You had mentioned how the Invisible Fence Brand products will help out multiple dogs. Different dogs have different lifespans. Lifespans are anywhere between 10 and 14 years. If you’re spending money on a product such as Invisible Fence Brand, you’ve got multiple dogs and you’re bringing multiple dogs in and out of your life throughout the course of your lifetime, do I have to keep rebuying the product, or is it going to last me a long time?

Karla: Nope. It will last you a long time. With my animals – and I lost three last year – I’ve reused those collars.

Bob: What about the unit itself for keeping my yard safe?

Karla: Same thing. We went to this house we’d never been to before. They were in our database, and they had a system that they bought in 1984, I think. [We’d] never been there. [We] got there, and their collar wasn’t working. And crazy enough, it was the craziest looking thing I’d ever seen. They had purchased a lifetime warranty, which now a lot of our products just come with a lifetime warranty. But back then, you had to purchase it, and they got a whole new system. And she had – what did she tell me? – 12 dogs on it so far.

Bob: How do we find Invisible Fence Brand?

Karla: [The website is] invisiblefence.com.]]>198falsefullhttps://www.spreaker.com/episode/e5-invisible-fence-brand-of-the-tristates-rules--17650001Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Bob: What are the products Invisible Fence Brand has?

Karla: We have outdoor containment products. We have indoor avoidance products. We have freedom products such as the door, and we have GPS products. We can do so many things. It’s just amazing what we can do.

Bob: I know in the past we’ve talked a little bit about the GPS products. How big of a space can you legitimately contain with an Invisible Fence Brand product?

Karla: As big as you want. It’s very cool. The things that we have up and coming are getting even better. Like I said, the technology is there. But Invisible Fence doesn’t just throw technology out and hope that it works. A lot of our products are in the field testing for five, 10 years before we ever see them.

Bob: You mentioned to me a while back that you had an opportunity to talk with somebody that had used Invisible Fence for a shelter.

Karla: Actually, she’s a rescue. She manages three different rescue groups. One is a national rescue.

Bob: What is her name?

Karla: Lisa.

Bob: So tell me about Lisa.

Karla: We got a chance to meet Lisa. Lisa is a very interesting gal, and I’m hoping I can connect you with her. One of things she’s doing with Invisible Fence Brand products, which is totally awesome … Invisible Fence Brand is a training tool. And a lot of dogs that end up in rescue are [there] because they’ve had some issues. Maybe they potty on the carpet. Maybe they have issues with other dogs being around them as far as eating. Invisible Fence Brand products can help with all those things. And what she does is she uses, with her foster groups, she uses Invisible Fence Brand products to help with those problems. It’s training and it’s consistency, and the cool thing about it is that with every dog that comes into that program, if the new adopters choose to purchase – and that’s up to them – Invisible Fence Brand products, those collars and everything go right with the dog so it stays consistent. A lot of people don’t realize this … She and I had a wonderful conversation about this because I’m a foster mom failure, but I’ve done a lot of rescue. It’s interesting when you put a collar on a dog, it’s almost like, ‘I’m yours.’ That dog is like, ‘I am yours.’ And it’s consistent. So if you’re taking the collar off and putting a different collar on and you’re moving that dog around, it’s very confusing for them. So to put an Invisible Fence Brand collar on and they learn the rules and they learn the consistency, that collar stays with them and goes with them to their new home. It gives them stability. It gives them confidence, and it helps prevent dogs from being returned. So it’s saving lives at the end of the day.

Bob: So it must be important, as it is with a child, it’s important for a dog to have those same feelings.

Karla: Yes, absolutely. Dogs technically have a mentality of a 2- to 3-year-old child.

Bob: I’ve been told I do, too.

Karla: You are a 3-year-old child. It’s been well-documented over and over again. But you know, the cool thing is that dogs have the sense of, ‘I belong to you. This is my family.’ And if they know the rules, the rules are right there.

Bob: How do we find Invisible Fence Brand?

Karla: [The website is] invisiblefence.com.]]>https://api.spreaker.com/episode/17650001Mon, 15 Apr 2019 19:49:45 +0000Produced by Podcast For HireInvisible Fence Brand of the TriStates / E5- Rules Invisible Fence Brand of the Tri-States 319 Northstar RoadWI 54636 (608) 399-1266 https://tri-states.invisiblefence.com...Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Bob: What are the products Invisible Fence Brand has?

Karla: We have outdoor containment products. We have indoor avoidance products. We have freedom products such as the door, and we have GPS products. We can do so many things. It’s just amazing what we can do.

Bob: I know in the past we’ve talked a little bit about the GPS products. How big of a space can you legitimately contain with an Invisible Fence Brand product?

Karla: As big as you want. It’s very cool. The things that we have up and coming are getting even better. Like I said, the technology is there. But Invisible Fence doesn’t just throw technology out and hope that it works. A lot of our products are in the field testing for five, 10 years before we ever see them.

Bob: You mentioned to me a while back that you had an opportunity to talk with somebody that had used Invisible Fence for a shelter.

Karla: Actually, she’s a rescue. She manages three different rescue groups. One is a national rescue.

Bob: What is her name?

Karla: Lisa.

Bob: So tell me about Lisa.

Karla: We got a chance to meet Lisa. Lisa is a very interesting gal, and I’m hoping I can connect you with her. One of things she’s doing with Invisible Fence Brand products, which is totally awesome … Invisible Fence Brand is a training tool. And a lot of dogs that end up in rescue are [there] because they’ve had some issues. Maybe they potty on the carpet. Maybe they have issues with other dogs being around them as far as eating. Invisible Fence Brand products can help with all those things. And what she does is she uses, with her foster groups, she uses Invisible Fence Brand products to help with those problems. It’s training and it’s consistency, and the cool thing about it is that with every dog that comes into that program, if the new adopters choose to purchase – and that’s up to them – Invisible Fence Brand products, those collars and everything go right with the dog so it stays consistent. A lot of people don’t realize this … She and I had a wonderful conversation about this because I’m a foster mom failure, but I’ve done a lot of rescue. It’s interesting when you put a collar on a dog, it’s almost like, ‘I’m yours.’ That dog is like, ‘I am yours.’ And it’s consistent. So if you’re taking the collar off and putting a different collar on and you’re moving that dog around, it’s very confusing for them. So to put an Invisible Fence Brand collar on and they learn the rules and they learn the consistency, that collar stays with them and goes with them to their new home. It gives them stability. It gives them confidence, and it helps prevent dogs from being returned. So it’s saving lives at the end of the day.

Bob: So it must be important, as it is with a child, it’s important for a dog to have those same feelings.

Karla: Yes, absolutely. Dogs technically have a mentality of a 2- to 3-year-old child.

Bob: I’ve been told I do, too.

Karla: You are a 3-year-old child. It’s been well-documented over and over again. But you know, the cool thing is that dogs have the sense of, ‘I belong to you. This is my family.’ And if they know the rules, the rules are right there.

Bob: How do we find Invisible Fence Brand?

Karla: [The website is] invisiblefence.com.]]>237falsefullhttps://www.spreaker.com/episode/e4-wisconsin-great-river-road-scott-sweere--17593703www.WiGRR.com to find out more about the Ellsworth Cooperative Creamery please check out their website https://www.ellsworthcheese.com/

Bob: There are probably a lot of people around the country who don’t know what a cheese curd is. Scott Sweere from Ellsworth Cooperative Creamery. What is a cheese curd?

Scott: A cheese curd is a dairy product that is agitated, warmed, curdled. And with a few of the primary ingredients taken out, it will result in a cheese curd.

Bob: All right, Scott. I’m going to stop you right there, because that’s totally wrong. A cheese curd is delicious. You bite into it and it squeaks. You can take those things in your pocket with you wherever you go. You can smuggle them into a movie theater. Cheese curds are wonderful.

Scott: That sounded a whole lot better than my answer.

Bob: I would have to agree with you. So why are they squeaky, then? If you’re taking all that stuff out of them, what makes them squeaky?

Scott: That’s just the final product. Like I said, it’s a clean, finished product so you don’t have that whey in the way anymore.

Bob: So you’re getting that whey out of the way in order to make it taste as good as it does?

Scott: That’s correct.

Bob: Wonderful. So is that a process that you guys invented? Are cheese curds something that Ellsworth Cooperative Creamery invented?

Scott: No. It’s an ancient story. The story goes that there was a goatherder. He had milk in a leather pouch, and he was traveling. That gave the agitation that he needed. He was also very warm, and that began to curdle that milk. And as that happened, the leather leaked the whey out and left a curd. It was kind of an accident that resulted in a pretty fine product. I love the squeaky cheese.

Bob: Do you like the deep-fried cheese curds?

Scott: As much as my waistline doesn’t, I love them.

Bob: Talking about travel, I know that you’re a motorcyclist. You’ve probably had a lot of chance to cruise up and down the Great River Road. Do you have a specific destination when you hop on your bike?

Scott: If it’s just a quick getaway with the wife, we like to head down to Nelson, stop for some ice cream, maybe a barbeque sandwich, and then it’s a happy ride home. If I’m doing a weekend, we always try to go to La Crosse and enjoy some of the things that are going on there and some of the nightlife. We try to make a few stops along the way. Bucknuckles and what used to be called Hansen’s Hold Up is now Vino Over The Valley. Those are always great stops and very biker-friendly and just off the main road a little bit. The Alma Overlook, we always end up stopping there. It’s nice to stop in Prescott; I always stop there. That’s kind of the beginning of things for me. We run into friends and run into people. It’s more of a starting point; we’ll say, ‘Meet us in Prescott at noon.’ Then we head out from there and then head down. Some of those places that I mentioned are almost like must-stops where we always end up there.

Bob: Just taking in the beauty of what the Wisconsin Great River Road has to offer. I think it’s funny that a guy that works for a cooperative creamery … The first thing you mentioned is ice cream. That must be in your blood. But then you mentioned a couple of other Wisconsin treasures as well such as stopping at a winery and stopping and having some of the nightlife, which beer is a big thing in the State of Wisconsin. You’re kind of tying in a bunch of different Wisconsin products into your trips.

Scott: Absolutely. In fact, I rode with some guys from Minnesota last year pretty extensively. They were always [saying], ‘I want to come to Wisconsin. This is where it’s all happening. There is way more fun going on Wisconsin. Let’s go to your side.’ I’d like to be fair and come over to their side from time to time, but we always end up in Wisconsin.

Bob: Where does somebody find the stuff we’ve been talking about?

Scott: You’ll want to check out ellsworthcheese.com. It’s as simple as that. We have a very simple process online to go through that. But you can always call us here at the store and we can take your information and ship you directly from here as well. Our number is 715-273-4311.

Bob: Only a million pounds of milk a day and 180,000 pounds of cheese curds a day. What are you guys doing with your time?

Scott: Sometimes I kind of wonder that myself. I can’t find any.]]>https://api.spreaker.com/episode/17593703Mon, 15 Apr 2019 17:00:13 +0000Produced by Podcast For HireTo find out more about the Wisconsin Great River Road please check out the website www.WiGRR.com to find out more about the Ellsworth Cooperative Creamery please check out their website https://www.ellsworthcheese.com/ Bob: There are probably a lot...www.WiGRR.com to find out more about the Ellsworth Cooperative Creamery please check out their website https://www.ellsworthcheese.com/

Bob: There are probably a lot of people around the country who don’t know what a cheese curd is. Scott Sweere from Ellsworth Cooperative Creamery. What is a cheese curd?

Scott: A cheese curd is a dairy product that is agitated, warmed, curdled. And with a few of the primary ingredients taken out, it will result in a cheese curd.

Bob: All right, Scott. I’m going to stop you right there, because that’s totally wrong. A cheese curd is delicious. You bite into it and it squeaks. You can take those things in your pocket with you wherever you go. You can smuggle them into a movie theater. Cheese curds are wonderful.

Scott: That sounded a whole lot better than my answer.

Bob: I would have to agree with you. So why are they squeaky, then? If you’re taking all that stuff out of them, what makes them squeaky?

Scott: That’s just the final product. Like I said, it’s a clean, finished product so you don’t have that whey in the way anymore.

Bob: So you’re getting that whey out of the way in order to make it taste as good as it does?

Scott: That’s correct.

Bob: Wonderful. So is that a process that you guys invented? Are cheese curds something that Ellsworth Cooperative Creamery invented?

Scott: No. It’s an ancient story. The story goes that there was a goatherder. He had milk in a leather pouch, and he was traveling. That gave the agitation that he needed. He was also very warm, and that began to curdle that milk. And as that happened, the leather leaked the whey out and left a curd. It was kind of an accident that resulted in a pretty fine product. I love the squeaky cheese.

Bob: Do you like the deep-fried cheese curds?

Scott: As much as my waistline doesn’t, I love them.

Bob: Talking about travel, I know that you’re a motorcyclist. You’ve probably had a lot of chance to cruise up and down the Great River Road. Do you have a specific destination when you hop on your bike?

Scott: If it’s just a quick getaway with the wife, we like to head down to Nelson, stop for some ice cream, maybe a barbeque sandwich, and then it’s a happy ride home. If I’m doing a weekend, we always try to go to La Crosse and enjoy some of the things that are going on there and some of the nightlife. We try to make a few stops along the way. Bucknuckles and what used to be called Hansen’s Hold Up is now Vino Over The Valley. Those are always great stops and very biker-friendly and just off the main road a little bit. The Alma Overlook, we always end up stopping there. It’s nice to stop in Prescott; I always stop there. That’s kind of the beginning of things for me. We run into friends and run into people. It’s more of a starting point; we’ll say, ‘Meet us in Prescott at noon.’ Then we head out from there and then head down. Some of those places that I mentioned are almost like must-stops where we always end up there.

Bob: Just taking in the beauty of what the Wisconsin Great River Road has to offer. I think it’s funny that a guy that works for a cooperative creamery … The first thing you mentioned is ice cream. That must be in your blood. But then you mentioned a couple of other Wisconsin treasures as well such as stopping at a winery and stopping and having some of the nightlife, which beer is a big thing in the State of Wisconsin. You’re kind of tying in a bunch of different Wisconsin products into your trips.

Scott: Absolutely. In fact, I rode with some guys from Minnesota last year pretty extensively. They...]]>280cheese,cooperative,creamery,curds,dairy,day,ellsworth,farm,greatriverroad,mississippi,motorcycle,olemiss,river,squeeky,squeekycheese,trip,wisconsinfalsefullhttps://www.spreaker.com/episode/e12-mchugh-excavating-proud-employees-core-values--17023308https://api.spreaker.com/episode/17023308Fri, 12 Apr 2019 23:10:03 +0000Produced by Podcast For HireDean McHugh talks about his great employees and how they have weekly meetings with all the team members and talk about the 13 core values that the company identified as the ones that they find important. The employees are what make Deans company....253companies,core,dean,employees,excavating,key,mchugh,plumbing,top,valuesfalsefullhttps://www.spreaker.com/episode/e6-chris-jones-1-word-travel-st-pattys-day--17451943https://www.hypnotistchrisjones.com/
Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Tellar, Scam School, and the Adam Carolla Show.

Chris has some exciting things coming in September 2018- follow his newsletter for future updates.

Follow Chris on Facebook and YouTube for exclusive new content.

facebook.com/hypnotistchrisjonesyoutube.com/user/onewordcj]]>https://api.spreaker.com/episode/17451943Wed, 27 Mar 2019 12:16:06 +0000Produced by Podcast For Hirehttps://www.hypnotistchrisjones.com/ Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard and Mel live. Since his first TV appearance,...https://www.hypnotistchrisjones.com/
Chris Jones is well known for his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands with Heidi, Howard and Mel live. Since his first TV appearance, Chris has performed on shows like The Steve Harvey Show, Windy City Live, Good Day Chicago, Penn and Tellar, Scam School, and the Adam Carolla Show.

Chris has some exciting things coming in September 2018- follow his newsletter for future updates.

Follow Chris on Facebook and YouTube for exclusive new content.

facebook.com/hypnotistchrisjonesyoutube.com/user/onewordcj]]>8671word,branding,bswithbob,business,chris,college,day,gordon,hypnotist,jones,microcast,new,one,oneword,orleans,patricks,ramsey,st,travel,wordfalsefullhttps://www.spreaker.com/episode/e11-eco-gardens-by-washburn-llc-podcast-ready-to-plant--17510816https://www.facebook.com/pg/ecogardensbywashburn/posts/
(608) 386-3117
ecogardensbywashburn.com

We had a super cold winter we had temperatures well below zero and I know that I've had some luck last year with my asparagus and my raspberries and strawberries. Is there anything special that I need to do as we reach spring in the summer for those fruit and vegetable plants because of the cold winter that we had actually no. It really isn't anything actually need to do based on the typical temperatures that we had the benefit of getting to know before getting the typical temperatures was that it insulated those plants right when we get rid of the snow and then we get a free that's when we eat are perennials and shrubs that we've planted in some of our trees and some of her back in her garden. I keep coming back to me see that kick the bucket when it doesn't have the root cover the snow. It could mulch covering on something that's in the worry that they don't come back. You had mentioned in an earlier podcast that if you could shovel the ground that it's okay to several of you know, to dig a hole now. Is that also go to planting new vegetables and things like that for my garden. No it's not okay to their thinking vegetable quite yet. Even though you can dig a hole and you can plant things that I get based on perennial like flowering or or cranial grandsons or woody shrubs or even trees. I would definitely steer clear from planting any vegetable and tell that soil really warms up her allotted time, but it's all based on the actual plant itself on the vegetable you planting what soil temperature preferred Andy and get the age of your or your plant it's there. I mean, there's a cool season crops like lettuce and spinach and kale that don't mind being planted outside in the cooler temperatures. You can even get away with plaintiff and onions into cooler soil temperatures. But if you think about like tomatoes or corn or need yet make sure that our cell temperature is definitely warmer and when I say warmer and probably get it and didn't say about 65 to 70°. That might even be pushing it okay. Like a lot of people say that you should wait until Mother's Day or so to start planting her garden so you is that the reason why because of the warmer temperatures yet. It's not the air temperature that were worried about with the new seedlings, it's that it's the soil temperature to keep those roots warm]]>https://api.spreaker.com/episode/17510816Tue, 26 Mar 2019 15:13:00 +0000Produced by Podcast For HireEco Gardens by Washburn https://www.facebook.com/pg/ecogardensbywashburn/posts/ (608) 386-3117 ecogardensbywashburn.com We had a super cold winter we had temperatures well below zero and I know that I've had some luck last year with my asparagus and...https://www.facebook.com/pg/ecogardensbywashburn/posts/
(608) 386-3117
ecogardensbywashburn.com

We had a super cold winter we had temperatures well below zero and I know that I've had some luck last year with my asparagus and my raspberries and strawberries. Is there anything special that I need to do as we reach spring in the summer for those fruit and vegetable plants because of the cold winter that we had actually no. It really isn't anything actually need to do based on the typical temperatures that we had the benefit of getting to know before getting the typical temperatures was that it insulated those plants right when we get rid of the snow and then we get a free that's when we eat are perennials and shrubs that we've planted in some of our trees and some of her back in her garden. I keep coming back to me see that kick the bucket when it doesn't have the root cover the snow. It could mulch covering on something that's in the worry that they don't come back. You had mentioned in an earlier podcast that if you could shovel the ground that it's okay to several of you know, to dig a hole now. Is that also go to planting new vegetables and things like that for my garden. No it's not okay to their thinking vegetable quite yet. Even though you can dig a hole and you can plant things that I get based on perennial like flowering or or cranial grandsons or woody shrubs or even trees. I would definitely steer clear from planting any vegetable and tell that soil really warms up her allotted time, but it's all based on the actual plant itself on the vegetable you planting what soil temperature preferred Andy and get the age of your or your plant it's there. I mean, there's a cool season crops like lettuce and spinach and kale that don't mind being planted outside in the cooler temperatures. You can even get away with plaintiff and onions into cooler soil temperatures. But if you think about like tomatoes or corn or need yet make sure that our cell temperature is definitely warmer and when I say warmer and probably get it and didn't say about 65 to 70°. That might even be pushing it okay. Like a lot of people say that you should wait until Mother's Day or so to start planting her garden so you is that the reason why because of the warmer temperatures yet. It's not the air temperature that were worried about with the new seedlings, it's that it's the soil temperature to keep those roots warm]]>204bob,bswithbob,by,eco,ecogardensbywashburn,garden,gardens,microcast,planting,prune,sara,schmidt,spring,temperature,washburn,weather,winterfalsefullhttps://www.spreaker.com/episode/e3-wisconsin-great-river-road-jim-rand--17298672www.WiGRR.com to find out more about the Lock and Dam system please check out their Facebook page at https://www.facebook.com/usace.saintpaul/

Bob: Jim Rand, Chief of Lock and Dams for the St. Paul District Army Corps of Engineers, joining us this month on the Wisconsin Great River Road Microcast. The first question I have for you, Jim, is, what is a lock and dam?

Jim: A lock and dam has a dual function: to create pools, and to pass traffic. A lock and dam is very similar to a set of stairs. Each lock has its individual stair height. If we break into two parts, there’s a dam, and what that does is that allows us to maintain a 9-foot navigation channel in the upper Mississippi River. That 9-foot channel allows us to pass loaded commercial traffic – barges, towboats is what they’re commonly referred to – up and down the river system from St. Paul all the way down to the Gulf of Mexico.

Bob: So the purpose mainly is for commerce on the river?

Jim: Correct. The dam itself is there to maintain the 9-foot navigation channel, and that will allow us to pass commercial traffic.

Bob: How much traffic goes on the mighty Mississippi River on a typical year?

Jim: Last year, for us, for the St. Paul District, from Lock 10, Guttenberg, Iowa, north, we passed around 107 million tons of commodities.

Bob: And that keeps how many trucks off the road? Do you know?

Jim: I do. One 15-barge tow is equivalent to about 1,050 semis. So if we look at that in a length scenario, a towboat fully loaded with 15 barges is about a quarter-mile long. And those equivalent commodities in semi trucks, it’s just shy of 14 miles, bumper-to-bumper.

Bob: So you’re taking a lot of traffic off the roads. That way, people will be able to get out and enjoy the Great River Road from driving it rather than having to deal with all that traffic from here to there.

Jim: Correct

Bob: Jim, why would somebody want to stop by and see a lock and dam?

Jim: We get a lot of people watching the eagles. We get a lot of otters around the locks, so we have a lot of people watching wildlife. The other thing that they do a lot is, they just stop by to watch boat traffic, and to watch fishermen. We get a lot of the cruise paddlewheelers – the American Queen, Delta Queen, Mississippi Queen. That’s a big event. They put their schedules out well in advance, so we get quite a turnout for those events when those boats pass through. We have several open houses at our locks and dams up and down the river that normally we try to coincide with a local community festival. We allow people on the site so they can see how everything works. We’ll let the kids blow the horn and all that kind of fun stuff. We do allow fishing around our structures from the shore, so we get a lot of fishermen in the spring, summer, fall timeframe. We’ve got a lot of ice fishermen around right now. There’s always quite a bit of action around the lock and dam.

Bob: Jim, as you know, this winter has been a winter of records with all the snow that we’ve had. Once that snow starts to melt, it will obviously find its way to the Mississippi. When that happens, do you open up the locks and the dams and allow all of the water to flow so that way it doesn’t flood?

Jim: The locks and dams in our district are for navigation purposes only. They’re not flood control structures. Congress has given us the authority to maintain these pools at a certain sea elevation. Our lock operators adjust that dam. There are big gates over there – roller and tainter gates – they adjust that plus or minus normally two-tenths of a foot tolerance from the guidance from our Water Control Management Office up in the district. We can hold back to only a certain flow of water – every site is a little different – and then we raise those gates out of the water and it becomes open river.

Bob: What is the life expectancy of the lock and dam structure?

Jim: When they were built in the 30s, the life expectancy was 50 years.

Bob: Obviously, we’ve gone past that.

Jim: Obviously, we’ve gone well past that. We’ve done some significant upgrades to both of our electrical systems, both to our operating systems, to our control houses. Based on our cyclical maintenance, we’ve been able to prolong the lifespan of these structures.

Bob: That’s fantastic you’ve been able to do that and keep the history alive. We talked a little bit earlier about the barges. What about pleasure crafts on the Mississippi River? Are they able to lock through?

Jim: Yes. We’ll lock just about anything through. The paddleboards where people stand up and paddle, we can’t lock those through, and a jet ski that you have to stand up on to operate, the reason being the operator would be in the water in the locking process. We don’t want that.

Bob: Where can people find out more information about how they can see when boats may be going through, or when they can find out when some of the open houses are where they can actually go on and see the insides of a lock and dam?

Jim: The best resource today is probably social media. We advertise all of our open houses through our St. Paul District Corps of Engineers Facebook page. That’s probably the one-stop shop for all of our events that are coming up.

Bob: Is there a place close by each of those locks where you’re able to tie off and maybe see some of the communities like Perrot State Park or Trempealeau Mountain or downtown La Crosse or Prairie du Chien or any of those places?

Jim: Yeah. Most of them have local marinas that rent out slips where you can dock your boat. I’m not sure if you can tie up a boat at Riverside [Park] in La Crosse, but I know Trempealeau, for example, has the Trempealeau Marina. They’ll allow you to tie up there. There are walking paths uptown. I know the Genoa Lock and Dam has tie-off points on the backside of their upper guide wall where recreational boaters can tie off there and go uptown. There are a lot of local resources for a boater to stop and then to walk uptown and check out the local communities.]]>https://api.spreaker.com/episode/17298672Fri, 15 Mar 2019 17:00:11 +0000Produced by Podcast For HireTo find out more about the Wisconsin Great River Road please check out the website www.WiGRR.com to find out more about the Lock and Dam system please check out their Facebook page at https://www.facebook.com/usace.saintpaul/ Bob: Jim Rand, Chief of...www.WiGRR.com to find out more about the Lock and Dam system please check out their Facebook page at https://www.facebook.com/usace.saintpaul/

Bob: Jim Rand, Chief of Lock and Dams for the St. Paul District Army Corps of Engineers, joining us this month on the Wisconsin Great River Road Microcast. The first question I have for you, Jim, is, what is a lock and dam?

Jim: A lock and dam has a dual function: to create pools, and to pass traffic. A lock and dam is very similar to a set of stairs. Each lock has its individual stair height. If we break into two parts, there’s a dam, and what that does is that allows us to maintain a 9-foot navigation channel in the upper Mississippi River. That 9-foot channel allows us to pass loaded commercial traffic – barges, towboats is what they’re commonly referred to – up and down the river system from St. Paul all the way down to the Gulf of Mexico.

Bob: So the purpose mainly is for commerce on the river?

Jim: Correct. The dam itself is there to maintain the 9-foot navigation channel, and that will allow us to pass commercial traffic.

Bob: How much traffic goes on the mighty Mississippi River on a typical year?

Jim: Last year, for us, for the St. Paul District, from Lock 10, Guttenberg, Iowa, north, we passed around 107 million tons of commodities.

Bob: And that keeps how many trucks off the road? Do you know?

Jim: I do. One 15-barge tow is equivalent to about 1,050 semis. So if we look at that in a length scenario, a towboat fully loaded with 15 barges is about a quarter-mile long. And those equivalent commodities in semi trucks, it’s just shy of 14 miles, bumper-to-bumper.

Bob: So you’re taking a lot of traffic off the roads. That way, people will be able to get out and enjoy the Great River Road from driving it rather than having to deal with all that traffic from here to there.

Jim: Correct

Bob: Jim, why would somebody want to stop by and see a lock and dam?

Jim: We get a lot of people watching the eagles. We get a lot of otters around the locks, so we have a lot of people watching wildlife. The other thing that they do a lot is, they just stop by to watch boat traffic, and to watch fishermen. We get a lot of the cruise paddlewheelers – the American Queen, Delta Queen, Mississippi Queen. That’s a big event. They put their schedules out well in advance, so we get quite a turnout for those events when those boats pass through. We have several open houses at our locks and dams up and down the river that normally we try to coincide with a local community festival. We allow people on the site so they can see how everything works. We’ll let the kids blow the horn and all that kind of fun stuff. We do allow fishing around our structures from the shore, so we get a lot of fishermen in the spring, summer, fall timeframe. We’ve got a lot of ice fishermen around right now. There’s always quite a bit of action around the lock and dam.

Bob: Jim, as you know, this winter has been a winter of records with all the snow that we’ve had. Once that snow starts to melt, it will obviously find its way to the Mississippi. When that happens, do you open up the locks and the dams and allow all of the water to flow so that way it doesn’t flood?

Jim: The locks and dams in our district are for navigation purposes only. They’re not flood control structures. Congress has given us the authority to maintain these pools at a certain sea elevation. Our lock operators adjust that dam. There are big gates over there – roller and tainter gates – they adjust that plus or minus normally two-tenths of a foot tolerance from the...]]>348and,army,barge,corps,dam,district,engineers,great,lock,miss,mississippi,ole,pleasure,relaxing,river,road,stpaul,traffic,u.s.,wisconsinfalsefullhttps://www.spreaker.com/episode/e11-mchugh-excavating-don-t-just-do-the-work-to-do-it--17023193https://api.spreaker.com/episode/17023193Tue, 12 Mar 2019 21:10:17 +0000Produced by Podcast For HireAt McHugh Plumbing and Excavating they don't take the job just to take the job, in fact, they have helped clients by steering them in the right direction when needed. The employees are top notch at McHugh Excavating194and,clients,core,dean,employees,excavating,help,mchugh,plumbing,steering,valuesfalsefullhttps://www.spreaker.com/episode/e5-chris-jones-1-word-chicago--17137054https://api.spreaker.com/episode/17137054Wed, 27 Feb 2019 13:20:11 +0000Produced by Podcast For Hire807bob,bswithbob,chicago,chris,drinking,friends,fun,hyde,jones,michelle,microcast,obama,park,president,schmidtfalsefullhttps://www.spreaker.com/episode/e9-eco-gardens-by-washburn-llc-podcast-ready-for-spring--17136196https://www.facebook.com/pg/ecogardensbywashburn/posts/
(608) 386-3117
ecogardensbywashburn.com]]>https://api.spreaker.com/episode/17136196Tue, 26 Feb 2019 22:20:04 +0000Produced by Podcast For HireEco Gardens by Washburn https://www.facebook.com/pg/ecogardensbywashburn/posts/ (608) 386-3117 ecogardensbywashburn.comhttps://www.facebook.com/pg/ecogardensbywashburn/posts/
(608) 386-3117
ecogardensbywashburn.com]]>161bob,bswithbob,by,eco,ecogarden,ecogardens,garden,gardens,microcast,mulch,planting,plants,sara,schmidt,spring,washburn,wateringfalsefullhttps://www.spreaker.com/episode/e2-wisconsin-great-river-road-john-howe--17144255
Bob: Why are we all fascinated with the bald eagle?

John: It’s our national symbol. I think the thing that draws people in and they’re so interested in the details of the eagle is that people typically see bald eagles and you see them flying way up in the air, you might see a nest or you might see them perched along the river.

Bob: John Howe is the Executive Director of the Raptor Resource Project. John, what is that? What is the Raptor Resource Project?

John: The Raptor Resource Project was started back in 1988 by Bob Anderson, and primarily started to captively bred and raise peregrine falcons to help repopulate falcons after the devasting effects of DDT across the country. The work actively monitoring the peregrine falcon population up and down the Mississippi River from northern Minnesota down to Illinois, at about 50 sites that we band peregrine falcons. We’ve got nests. We’ve got nest cams and ways that we share that and help educate people.

Bob: John, why is the Wisconsin Great River Road the home to such a high number of eagles nests and raptors in general?

John: It’s the river that brings them. The Mississippi River is a national flyway for raptors and other waterfowl. It’s amazing. They congregate along that flyway, and it’s part of their instinct to follow that flyway. It’s a major food source for them. It’s a pass way for their migration. It’s a home. It’s being along the Wisconsin boundary of the river and the river floodplain along the Mississippi and the tributaries that come in. That’s where you’re going to find the tide populations and the congregations of these raptors that we love to watch, [including] the bald eagles. We were talking the other day a little bit about the peregrine falcons. At different times of the year there are great opportunities to hear them and see them and watch them in their home territory.

Bob: Where’s the best place on the Wisconsin Great River Road to watch the eagles and the raptors?

John: Right in the season of Bald Eagle Days up and down the river – Ferryville, Prairie du Chien. A lot of the little towns along the river have their Bald Eagle Days celebrations. Really, the way to get hooked into that is seeing it. Up until about this point where we’re watching, for example, bald eagles, we’re watching them grabbing sticks, breaking sticks, perching, and they’re pair bonding and they’re getting ready for egg laying. When that comes up, we’re going to be looking at egg laying. You can’t see that kind of stuff when you’re driving on the highway or even if you’re along the river. We were talking earlier about that fascination with eagles, and the wild popularity with the Eagle Cam is we actually get to see those details about what’s going on.

Bob: Let’s just jump into that right now and ask a little bit more about the Eagle Cam. If we don’t have the opportunity to be on the Wisconsin Great River Road, how can we check out and find out more about eagles and watch them be born and kind of see their habitat?

John: We manage a number of different cams in the area. For bald eagles, the premier eagle cam is the Decorah Eagle Cams. Going to our website, www.raptorresource.org, our cams are there. We also stream them through explore.org.

Bob: Where along the Wisconsin Great River Road is the best place to view eagles and raptors?

John: Between La Crosse all the way down to Prairie du Chien, there’s some great viewing areas. You’re right along the rivers, so it really depends on timing. [There also are] lock and dam areas. The lock and dams typically … That disturbing that happens right at the downstream where you always see the boats and the fishermen, that’s where the eagles are going to be congregating to fish also.

Bob: John, earlier you were mentioning about the Mississippi River Flyway. Are there any cameras you have in the Great River Mississippi Flyway area?

John: One of the original peregrine falcon cams – and probably the best one we have – is the Great Spirit Bluff peregrine falcon cam. That’s also available on our website, as I mentioned before. When you move away from the bluff and look down and see the tundra swans and the pelicans and the eagles during the great migration along the flyway in the Mississippi River. It was a dream, and we ended up putting up a cam down there on an island out on Lake Onalaska. It was a collaborative project with the National Wildlife and Fish Refuge and the Raptor Resource Project. We started that up last fall, and we have one season of watching all the waterfowl and the eagles. We’ve caught falcons, and we’ve caught great horned owls out there. [There is] a lot of neat waterfowl and raptors right out in Lake Onalaska. The audio on the camera, it’s almost like you’re sitting right down there in the middle of the flyway. Birds will do things out there without a human there. You’re going to get to see and hear some things that you would not see or hear if it wasn’t being brought to you by a camera.]]>https://api.spreaker.com/episode/17144255Mon, 25 Feb 2019 15:29:42 +0000Produced by Podcast For HireEpisode 2 of the Wisconsin Great River Road Microcast features Raptor Resource Project execuitive director John Howe. Bob: Why are we all fascinated with the bald eagle? John: It’s our national symbol. I think the thing that draws people in and...
Bob: Why are we all fascinated with the bald eagle?

John: It’s our national symbol. I think the thing that draws people in and they’re so interested in the details of the eagle is that people typically see bald eagles and you see them flying way up in the air, you might see a nest or you might see them perched along the river.

Bob: John Howe is the Executive Director of the Raptor Resource Project. John, what is that? What is the Raptor Resource Project?

John: The Raptor Resource Project was started back in 1988 by Bob Anderson, and primarily started to captively bred and raise peregrine falcons to help repopulate falcons after the devasting effects of DDT across the country. The work actively monitoring the peregrine falcon population up and down the Mississippi River from northern Minnesota down to Illinois, at about 50 sites that we band peregrine falcons. We’ve got nests. We’ve got nest cams and ways that we share that and help educate people.

Bob: John, why is the Wisconsin Great River Road the home to such a high number of eagles nests and raptors in general?

John: It’s the river that brings them. The Mississippi River is a national flyway for raptors and other waterfowl. It’s amazing. They congregate along that flyway, and it’s part of their instinct to follow that flyway. It’s a major food source for them. It’s a pass way for their migration. It’s a home. It’s being along the Wisconsin boundary of the river and the river floodplain along the Mississippi and the tributaries that come in. That’s where you’re going to find the tide populations and the congregations of these raptors that we love to watch, [including] the bald eagles. We were talking the other day a little bit about the peregrine falcons. At different times of the year there are great opportunities to hear them and see them and watch them in their home territory.

Bob: Where’s the best place on the Wisconsin Great River Road to watch the eagles and the raptors?

John: Right in the season of Bald Eagle Days up and down the river – Ferryville, Prairie du Chien. A lot of the little towns along the river have their Bald Eagle Days celebrations. Really, the way to get hooked into that is seeing it. Up until about this point where we’re watching, for example, bald eagles, we’re watching them grabbing sticks, breaking sticks, perching, and they’re pair bonding and they’re getting ready for egg laying. When that comes up, we’re going to be looking at egg laying. You can’t see that kind of stuff when you’re driving on the highway or even if you’re along the river. We were talking earlier about that fascination with eagles, and the wild popularity with the Eagle Cam is we actually get to see those details about what’s going on.

Bob: Let’s just jump into that right now and ask a little bit more about the Eagle Cam. If we don’t have the opportunity to be on the Wisconsin Great River Road, how can we check out and find out more about eagles and watch them be born and kind of see their habitat?

John: We manage a number of different cams in the area. For bald eagles, the premier eagle cam is the Decorah Eagle Cams. Going to our website, www.raptorresource.org, our cams are there. We also stream them through explore.org.

Bob: Where along the Wisconsin Great River Road is the best place to view eagles and raptors?

John: Between La Crosse all the way down to Prairie du Chien, there’s some great viewing areas. You’re right along the rivers, so it really depends on timing. [There also are] lock and dam areas. The lock and dams typically … That disturbing that happens right at the downstream where you always see the boats and the...]]>348bald,bird,birds,bob,bswithbob,camera,eagles,falcons,great,howe,john,microcast,project,raptor,resource,river,road,schmidt,wigrr,wisconsinfalsefullhttps://www.spreaker.com/episode/e10-mchugh-excavating-when-hiring-snow-plowing--17023154https://api.spreaker.com/episode/17023154Wed, 13 Feb 2019 00:10:19 +0000Produced by Podcast For HireDean talks about how he values his employees, how to apply for a job and about snow removal in this months microcast.281apply,dean,employees,excavating,excavation,grateful,job,mchugh,plumbing,removal,snowfalsefullhttps://www.spreaker.com/episode/e1-wisconsin-great-river-road-michael-scott--16986830
Bob Schmidt: I’ve known Michael Scott for a long time. Michael is a history buff, but he’s also a storyteller. I’ve had the chance to see him on some of his different walks that he takes around the City of La Crosse. Michael, what do you like best about living in a river town?

Michael Scott: There’s the history. I’m down at Riverside Park often. That is an international port. I could put my kayak in the Mississippi River right there, and I could go to Key West. I could go to the Caribbean. I could cross the ocean if I was so inclined. It’s such a beautiful place. I came here in 1986, and I just fell in love with the river and the bluffs.

Bob Schmidt: The Great River Roadway is known basically the entire country, and perhaps the entire world. What makes, in your mind, the La Crosse area so unique?

Michael Scott: I’ve traveled the whole length of the Upper Mississippi Wildlife Refuge, and it’s all beautiful. But there is just something about La Crosse, and it could be … Even the native people felt that La Crosse is a sacred place. It’s because three rivers come together – you have the Mississippi, the Black, and the La Crosse River. In Native American culture, that is a sacred place, and they say no mighty wind will blow. Every night I’m down there, I get a sense of that. There is just something special about it. I don’t know if I can put my finger on it exactly, but you know it when you see it.

Bob Schmidt: Michael, you’re a performer and you do a lot of stories and you do a lot of tours. Tell me about some of the things that you do in the City of La Crosse that helps to share the wonderful Mississippi River with those that come to visit.

Michael Scott: It’s called “Dark La Crosse Walk.” We would take visitors through the City of La Crosse and tell them about our seedy underbelly. We would talk about these murders that happened a long time ago. We would talk about the brothels that were here in La Crosse, and there really were a lot of them. I like to point that out in every tour; we just walk them a little bit here and there. Ori Sorensen ran for Mayor in 1913. In his campaign, he claimed to have a list of 40 to 50 brothels that were operating within the City of La Crosse. I tell people we easily could have been nicknamed “Sin City” long before Las Vegas had a hold of it. I also started to do … I call it an active interpiece called “Walking Twain” where we walk along the river and I dress up like Mark Twain. I have the big white hair and the mustache and the white suit. I identify the six different stages along the river, along in the park there. We walk along, and I’ll stop and I’ll do different passages from Mark Twain’s writings. If you want to find out more information, you just need to go to the website footstepsoflacrosse.org.

Bob Schmidt: Michael, I know that you do other tours as well. What are some of the other tours that you personally do?

Michael Scott: The big one is “The Ghosts of Historic La Crosse Walking Tour.” I’m going on my third season from the popularity of the “Dark La Crosse” tours. You know, we figured, ‘Boy, people really like this.’ I am a storyteller, so I knew of several ghost stories in the downtown area. I went to the library, and I said, ‘Let’s do a ghost walking tour, and it will be a fundraiser for the Public Library.’ To build the tour, I went into the archives and found old newspaper accounts of haunting in the downtown. I love it. Over these two seasons, I have met people from all over the world. La Crosse is really becoming a budding tourist location. Lots of people are coming here.

Bob Schmidt: Do you think the Mississippi is one of the things that brings people to the area?

Michael Scott: I think so. I don’t know if I read it or I heard it, but when they ask people from elsewhere – Europe and people from other places around the globe – what they would like to see in America, the Mississippi River is in the top five. And believe me, you don’t want to see the Mississippi River right at the south of us where it’s just barges. You want to see the upper Mississippi River, I think, with the bluffs and inside the refuge that La Crosse sits in the middle of. I don’t think a lot of people realize that La Crosse is pretty much right smack dab in the middle of this huge wildlife refuge, and so there’s all this protected land from Wabasha all the way down to the Quad Cities. There are just so many opportunities for recreation – kayaking and boating and bird watching. We have little sandbars, and you can pull up there and camp for I think 30 days if you wanted to at one spot. It’s free, and they just ask you to keep things clean.]]>https://api.spreaker.com/episode/16986830Fri, 08 Feb 2019 16:27:49 +0000Produced by Podcast For HireEpisode 1 of the Wisconsin Great River Road Microcast features storyteller and historian Michael Scott. Bob Schmidt: I’ve known Michael Scott for a long time. Michael is a history buff, but he’s also a storyteller. I’ve had the chance to see him...
Bob Schmidt: I’ve known Michael Scott for a long time. Michael is a history buff, but he’s also a storyteller. I’ve had the chance to see him on some of his different walks that he takes around the City of La Crosse. Michael, what do you like best about living in a river town?

Michael Scott: There’s the history. I’m down at Riverside Park often. That is an international port. I could put my kayak in the Mississippi River right there, and I could go to Key West. I could go to the Caribbean. I could cross the ocean if I was so inclined. It’s such a beautiful place. I came here in 1986, and I just fell in love with the river and the bluffs.

Bob Schmidt: The Great River Roadway is known basically the entire country, and perhaps the entire world. What makes, in your mind, the La Crosse area so unique?

Michael Scott: I’ve traveled the whole length of the Upper Mississippi Wildlife Refuge, and it’s all beautiful. But there is just something about La Crosse, and it could be … Even the native people felt that La Crosse is a sacred place. It’s because three rivers come together – you have the Mississippi, the Black, and the La Crosse River. In Native American culture, that is a sacred place, and they say no mighty wind will blow. Every night I’m down there, I get a sense of that. There is just something special about it. I don’t know if I can put my finger on it exactly, but you know it when you see it.

Bob Schmidt: Michael, you’re a performer and you do a lot of stories and you do a lot of tours. Tell me about some of the things that you do in the City of La Crosse that helps to share the wonderful Mississippi River with those that come to visit.

Michael Scott: It’s called “Dark La Crosse Walk.” We would take visitors through the City of La Crosse and tell them about our seedy underbelly. We would talk about these murders that happened a long time ago. We would talk about the brothels that were here in La Crosse, and there really were a lot of them. I like to point that out in every tour; we just walk them a little bit here and there. Ori Sorensen ran for Mayor in 1913. In his campaign, he claimed to have a list of 40 to 50 brothels that were operating within the City of La Crosse. I tell people we easily could have been nicknamed “Sin City” long before Las Vegas had a hold of it. I also started to do … I call it an active interpiece called “Walking Twain” where we walk along the river and I dress up like Mark Twain. I have the big white hair and the mustache and the white suit. I identify the six different stages along the river, along in the park there. We walk along, and I’ll stop and I’ll do different passages from Mark Twain’s writings. If you want to find out more information, you just need to go to the website footstepsoflacrosse.org.

Bob Schmidt: Michael, I know that you do other tours as well. What are some of the other tours that you personally do?

Michael Scott: The big one is “The Ghosts of Historic La Crosse Walking Tour.” I’m going on my third season from the popularity of the “Dark La Crosse” tours. You know, we figured, ‘Boy, people really like this.’ I am a storyteller, so I knew of several ghost stories in the downtown area. I went to the library, and I said, ‘Let’s do a ghost walking tour, and it will be a fundraiser for the Public Library.’ To build the tour, I went into the archives and found old newspaper accounts of haunting in the downtown. I love it. Over these two seasons, I have met people from all over the world. La Crosse is really becoming a budding tourist location. Lots of people are coming here.

Bob Schmidt: Do you think the Mississippi is one of the things that brings people to the area?

Michael Scott: I think so. I don’t know if I read it...]]>343americas,byways,commission,great,greatriver,greatriverroad,highway35,history,lacrosse,michael,mississippi,mississippiriver,parkway,river,road,scott,stories,wigreatriverroad,wigrr,wisconsinfalsefullhttps://www.spreaker.com/episode/e8-eco-gardens-by-washburn-llc-podcast--15940824
Yes.

That is so cool and to tell you the truth it is kind of like playing a video game because you can sit there and pick different plants and my client sits right next to me and says you know what maybe I would like something else maybe something more of a purple foliage. So we picked something out and we delete the one plant we put the new plants in. And what's also neat is that you can see each plant as the seasons change to. So like if we put a crab apple in the front yard or something you'd be able to see the beautiful magenta or white flowers in the spring. And then you turn it to fall. And there's not really that big a fall color on a crab apple but switch that around with a sugar maple. Holy buckets is that ever different. One of the coolest parts is that I can actually make the client a movie. So make them a movie in this movie. There are birds and butterflies and you see the wind blowing the grasses. When I design landscapes that have patios with fireplaces or outdoor kitchens you can see the flames of the fire pit illuminated. There's outdoor lighting that lights up music too so you can you can have a little jazzy tune or you can have crickets chirping in the background also designed some landscapes that have ponds in them so there's a little goldfish that are swimming around and this is this is like a video game. And you push the spacebar and it throws fish food and then the fish come up to the surface. Really I can hook this up to a

big screen TV or just glance at it on the computer. I always finish a flash drive so that the client can do this or that.

No you'd mentioned a couple of different things like backyard patios and decks and fish and ponds and things like that is that all stuff that eco gardens does.

I do small paper patios I do very small retaining wall feet walls nothing taller than three feet high and usually not more than 100 feet long. Now the ponds do not do so I leave that up to the professionals when it comes to the other gardens we've talked about.

We've talked about planting gardens and stuff but I know in the past we've had conversation about different types of gardens like pollinator gardens and rain gardens and rock gardens. Is there anything special you need to do to those types of gardens as we turn to the next season leaving your plants and to the spring to benefit the pollinators.

You could give it a really good reading if you know like a rock garden. What I'm kind of thinking is it's hard to leave if you have a lot of leaves that fall onto your garden and then sit and decompose there. What I mean that's turning into organic matter and with organic matter we get growth. So it's a weed seed goes into the organic matter in between a rock that more than likely lead to plants that you don't want there otherwise known as a weed. If you can blow those leaves out or pick them out. But that would be the best thing you can do going into winter for a bit like a rock garden. But your other garden I would invite the leaves fall in their.]]>https://api.spreaker.com/episode/15940824Sat, 26 Jan 2019 22:20:20 +0000Produced by Podcast For HireEco garden by washburn and I've had the opportunity to go through and look at your website and your Facebook stuff and I think it's really cool that you have the software you have the ability to help somebody actually plan their yard using 3-D...
Yes.

That is so cool and to tell you the truth it is kind of like playing a video game because you can sit there and pick different plants and my client sits right next to me and says you know what maybe I would like something else maybe something more of a purple foliage. So we picked something out and we delete the one plant we put the new plants in. And what's also neat is that you can see each plant as the seasons change to. So like if we put a crab apple in the front yard or something you'd be able to see the beautiful magenta or white flowers in the spring. And then you turn it to fall. And there's not really that big a fall color on a crab apple but switch that around with a sugar maple. Holy buckets is that ever different. One of the coolest parts is that I can actually make the client a movie. So make them a movie in this movie. There are birds and butterflies and you see the wind blowing the grasses. When I design landscapes that have patios with fireplaces or outdoor kitchens you can see the flames of the fire pit illuminated. There's outdoor lighting that lights up music too so you can you can have a little jazzy tune or you can have crickets chirping in the background also designed some landscapes that have ponds in them so there's a little goldfish that are swimming around and this is this is like a video game. And you push the spacebar and it throws fish food and then the fish come up to the surface. Really I can hook this up to a

big screen TV or just glance at it on the computer. I always finish a flash drive so that the client can do this or that.

No you'd mentioned a couple of different things like backyard patios and decks and fish and ponds and things like that is that all stuff that eco gardens does.

I do small paper patios I do very small retaining wall feet walls nothing taller than three feet high and usually not more than 100 feet long. Now the ponds do not do so I leave that up to the professionals when it comes to the other gardens we've talked about.

We've talked about planting gardens and stuff but I know in the past we've had conversation about different types of gardens like pollinator gardens and rain gardens and rock gardens. Is there anything special you need to do to those types of gardens as we turn to the next season leaving your plants and to the spring to benefit the pollinators.

You could give it a really good reading if you know like a rock garden. What I'm kind of thinking is it's hard to leave if you have a lot of leaves that fall onto your garden and then sit and decompose there. What I mean that's turning into organic matter and with organic matter we get growth. So it's a weed seed goes into the organic matter in between a rock that more than likely lead to plants that you don't want there otherwise known as a weed. If you can blow those leaves out or pick them out. But that would be the best thing you can do going into winter for a bit like a rock garden. But your other garden I would invite the leaves fall in their.]]>2443d,3dgarden,3dplants,apple,beautiful,bob,bswithbob,crab,eco,ecogardens,ecogardensbywashburn,gardens,leaves,microcast,outdoors,sara,schmidt,trees,walkthru,washburnfalsefullhttps://www.spreaker.com/episode/e4-chris-jones-1-word-resolution--16838975https://api.spreaker.com/episode/16838975Fri, 25 Jan 2019 18:00:11 +0000Produced by Podcast For HireNew Year new resolutions, also talked about marriage, and branding. Got any ideas for Branding Chris Jones? Something that says Chris Jones in 5 words or less. Also we talked about Chris's syurp addiction.5921word,branding,bswithbob,chris,college,hypnotist,jones,like,love,marriage,microcast,new,one,oneword,resolutions,syrup,word,year,yearstruefullhttps://www.spreaker.com/episode/e4-invisible-fence-brand-of-the-tristates-sharing--16712733Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Bob: You mentioned the word ‘system’ a lot of different times. So it’s a full, everything encompassed type of system?

Karla: It can be. You can do a basic system just outside, or you can expand it to do all kinds of things you need to do inside, outside, camping. If I sit and I talk to my fellow dealers when we’re at conferences, it’s really interesting listening to some of the different things people have helped with. I mentioned to you that I helped a gal in a wheelchair with our shields. I just heard from another dealer that had a dog that was obsessed with the vacuum cleaner. We hear this story a lot. The dog will bark and grab the vacuum cleaner. Mom is trying to clean, and isn’t that annoying? They attached a small microshields to the vacuum cleaner. Now the dog leaves the vacuum cleaner alone and doesn’t bark at it anymore. Isn’t that just great? The dog is going, ‘I can’t go over there, so I’ll leave that thing alone.’

Bob: You just said camping a little bit ago. A lot of like to go on trips, like to go to different places. Is the Invisible Fence Brand fence and shield compatible with other places other than home?

Karla: Yes. With our Invisible Fence Brand Shields Rock, we can actually attach some wire to it, and you can actually take it camping with you. You can use it for camping, or let’s say you’re going to grandma’s house and grandma doesn’t like it when your best friend runs through the house and might knock something over.

Bob: That happened a lot when I was a kid, and it was mostly my friends that came over. My mom yelled at me for that.

Karla: But now your best friend is your dog, so they can take that shields with them. Some people will use their shields when they go to the vet or take their dog for a car ride because the dog is so excited and wants to jump between the front seat-backseat, front seat-backseat, front seat-backseat. They’ll take their shields and put it in the front seat so the dog can’t come up to the front, which is a safety issue because if you’re driving and you have a big dog that jumps in your lap, you could get into a car accident.

Bob: Invisible Fence Brand can help with that.

Karla: Oh, my gosh, yes. Like I’ve said before, not just [with] dogs, [but also with] cats, goats, pigs. Some people have more than one Invisible Fence Brand system. For instance, I have some people that have cabins or vacation homes, and they have an Invisible Fence Brand system there. They take their dog between the two systems, and they just share collars between the two.]]>https://api.spreaker.com/episode/16712733Mon, 14 Jan 2019 23:30:32 +0000Produced by Podcast For HireInvisible Fence Brand of the TriStates / E4 - Sharing Invisible Fence Brand of the Tri-States 319 Northstar RoadWI 54636 (608) 399-1266 https://tri-states.invisiblefence.com...Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Bob: You mentioned the word ‘system’ a lot of different times. So it’s a full, everything encompassed type of system?

Karla: It can be. You can do a basic system just outside, or you can expand it to do all kinds of things you need to do inside, outside, camping. If I sit and I talk to my fellow dealers when we’re at conferences, it’s really interesting listening to some of the different things people have helped with. I mentioned to you that I helped a gal in a wheelchair with our shields. I just heard from another dealer that had a dog that was obsessed with the vacuum cleaner. We hear this story a lot. The dog will bark and grab the vacuum cleaner. Mom is trying to clean, and isn’t that annoying? They attached a small microshields to the vacuum cleaner. Now the dog leaves the vacuum cleaner alone and doesn’t bark at it anymore. Isn’t that just great? The dog is going, ‘I can’t go over there, so I’ll leave that thing alone.’

Bob: You just said camping a little bit ago. A lot of like to go on trips, like to go to different places. Is the Invisible Fence Brand fence and shield compatible with other places other than home?

Karla: Yes. With our Invisible Fence Brand Shields Rock, we can actually attach some wire to it, and you can actually take it camping with you. You can use it for camping, or let’s say you’re going to grandma’s house and grandma doesn’t like it when your best friend runs through the house and might knock something over.

Bob: That happened a lot when I was a kid, and it was mostly my friends that came over. My mom yelled at me for that.

Karla: But now your best friend is your dog, so they can take that shields with them. Some people will use their shields when they go to the vet or take their dog for a car ride because the dog is so excited and wants to jump between the front seat-backseat, front seat-backseat, front seat-backseat. They’ll take their shields and put it in the front seat so the dog can’t come up to the front, which is a safety issue because if you’re driving and you have a big dog that jumps in your lap, you could get into a car accident.

Bob: Invisible Fence Brand can help with that.

Karla: Oh, my gosh, yes. Like I’ve said before, not just [with] dogs, [but also with] cats, goats, pigs. Some people have more than one Invisible Fence Brand system. For instance, I have some people that have cabins or vacation homes, and they have an Invisible Fence Brand system there. They take their dog between the two systems, and they just share collars between the two.]]>180animals,brand,bswithbob,business,collars,doggie,easy,fence,invisable,invisiblefence,karla,microcast,pets,share,shareable,system,toppen,trainingfalsefullhttps://www.spreaker.com/episode/e3-invisible-fence-brand-of-the-tristates-shield-products--16712611Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Karla: We’ve done things in homes where we’ve had two dogs tha - t mom and dad want to feed both their dogs at the same time [and] not one in one room and one in the other. We’ve used our shields products so that each dog can’t get into each other’s food, but can eat at the same time. It’s so cool. We have cats and dogs eating next to each other.

Bob: That’s true love right there.

Karla: It really is. We have dogs that aren’t allowed to get into the cat litter, but the cat can get into their cat litter. The cat can’t jump on the counter, but the dog can lay next to the counter. It’s really cool the things that we’re able to do.

Bob: You mentioned ‘best’ a couple of different times, and you want to do the best for our animals, our pets. Do you think Invisible Fence Brand is the best?

Karla: I do. Invisible Fence has spent a lot of money on research. We’re able to tell how often your dog is getting a correction, or if they’re just getting that warning tone, which is totally cool.

Bob: So you’re able to pull up a report saying, ‘Your dog got this?’

Karla: Yeah. When we look at our programmer, we can tell you … What’s really cool about it is when we start that training process we’ll talk about how many they had, and a lot of people … I play a little game, [and I ask], ‘How many times do you think they activated the collar?’ Believe it or not, they’re usually close. With our Perfect Start Plus training, it’s easy for us to teach the dogs on most stimulations so that they’re not at a high level. They’re never meant to be at a high level unless that’s what they need. We don’t want them at a high level.

Bob: Does it change for different breeds?

Karla: No.

Bob: So it depends on the temperament of the dog?

Karla: Absolutely.

Bob: That’s a good thing to know, because I think a lot of people might think that, ‘I have a chihuahua,’ or, ‘I have a mastiff.’ Can you help them both? By the sounds of it, you can.

Karla: I can. They’re customized for each individual dog. It’s not a, ‘Let’s look on a chart and it’s this breed of dog [and] this many pounds. This is what it should be.’ It’s not like that at all. We’re trained by animal behavioralists to look for cues and to understand how that dog is responding to the system. Then we’re using our tools to verify that information that we have.]]>https://api.spreaker.com/episode/16712611Mon, 14 Jan 2019 23:26:36 +0000Produced by Podcast For HireInvisible Fence Brand of the TriStates / E3- Shield Products Invisible Fence Brand of the Tri-States 319 Northstar RoadWI 54636 (608) 399-1266 https://tri-states.invisiblefence.com...Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Karla: We’ve done things in homes where we’ve had two dogs tha - t mom and dad want to feed both their dogs at the same time [and] not one in one room and one in the other. We’ve used our shields products so that each dog can’t get into each other’s food, but can eat at the same time. It’s so cool. We have cats and dogs eating next to each other.

Bob: That’s true love right there.

Karla: It really is. We have dogs that aren’t allowed to get into the cat litter, but the cat can get into their cat litter. The cat can’t jump on the counter, but the dog can lay next to the counter. It’s really cool the things that we’re able to do.

Bob: You mentioned ‘best’ a couple of different times, and you want to do the best for our animals, our pets. Do you think Invisible Fence Brand is the best?

Karla: I do. Invisible Fence has spent a lot of money on research. We’re able to tell how often your dog is getting a correction, or if they’re just getting that warning tone, which is totally cool.

Bob: So you’re able to pull up a report saying, ‘Your dog got this?’

Karla: Yeah. When we look at our programmer, we can tell you … What’s really cool about it is when we start that training process we’ll talk about how many they had, and a lot of people … I play a little game, [and I ask], ‘How many times do you think they activated the collar?’ Believe it or not, they’re usually close. With our Perfect Start Plus training, it’s easy for us to teach the dogs on most stimulations so that they’re not at a high level. They’re never meant to be at a high level unless that’s what they need. We don’t want them at a high level.

Bob: Does it change for different breeds?

Karla: No.

Bob: So it depends on the temperament of the dog?

Karla: Absolutely.

Bob: That’s a good thing to know, because I think a lot of people might think that, ‘I have a chihuahua,’ or, ‘I have a mastiff.’ Can you help them both? By the sounds of it, you can.

Karla: I can. They’re customized for each individual dog. It’s not a, ‘Let’s look on a chart and it’s this breed of dog [and] this many pounds. This is what it should be.’ It’s not like that at all. We’re trained by animal behavioralists to look for cues and to understand how that dog is responding to the system. Then we’re using our tools to verify that information that we have.]]>167animals,brand,bswithbob,business,containment,correction,dog,doggie,dogs,fence,invisible,invisiblefence,karla,microcast,pets,products,research,safe,shield,toppenfalsefullhttps://www.spreaker.com/episode/e2-invisible-fence-brand-of-the-tristates-unconditional-love--16712473Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Bob: People are using their animals as maybe an escape from family or children.

Karla: It’s not an escape. It’s actually, in my opinion, because we are very disconnected from our friends and family because we’re more connected electronically. We’re disconnected physically. Years ago, you used to go visit grandma and grandpa on Sunday after church. Well, nobody does that anymore. So that hug from grandma or your cousins or all those kinds of things that you had is now replaced by an animal. It’s unconditional love, and that’s what we all want. We look for it.

Bob: It boils down to our loved ones. How can Invisible Fence Brand help to nature and nurture that relationship with my best friend?

Karla: It can make a relationship better. You already have a great relationship with your dog, but it can make it so much better. Dogs are like children, and when they misbehave it just makes you angry. A lot of times with Invisible Fence Brand, what you can do is build that relationship by being able to go in the yard and play ball with your dog without them being on a chain. You can garden in your yard, and they can be out there with you and not feel like they’re attached to something. The other thing is that it’s freedom. The other part about it is if you do have problem areas in your home where dogs are naughty – let’s say the garbage can. Invisible Fence has products that when you come home after a long day of work and you really just want to be with your friend, but you’re not cleaning up the mess your friend made, and now you resent them because they don’t really know why they did it; they’re dogs. But we can put shields there, they can stay out of the garbage, you don’t come home to a mess, and you can come home to that unconditional love that one dog that waited all day for you. It’s awesome the different things that we do. It’s just really awesome. It’s cool.

Bob: I think it’s pretty cool the products Invisible Fence Brand has that helps us to achieve that and to show our pets that they’re truly loved. What are some of your favorite products that you guys have?

Karla: I have so many. It’s proving to them that we love them, but it’s also keeping them safe so that we can keep them and love them for as long as we can. That unconditional love doesn’t last forever. We only have them a short period of time, and so we want the absolute best for them, and to keep them safe. Some of our products that we have that I just absolutely love, I love our shields products. I absolutely love them [and] how we can do so many different things with them. When you have two dogs in the house and you’ve got one that pretty much can go anywhere and you’ve got another one that’s really, really naughty, you can make so that the one dog isn’t affected by it and the other dog you’re keeping safe. For instance, my dog, Ella. Ella is very naughty. She is a 14-year-old black lab-basset mix, as you know, and has the most stoic, innocent face of any animal I’ve ever met in my life. Most people look at me and go, ‘Oh, my God. Ella’s naughty?’ I’m like, ‘Oh, she’s the naughtiest dog I have.’ But what’s great about the Invisible Fence shields is that I can keep her out of things that she shouldn’t be into. For instance, we had a cupboard that we didn’t have a shield in. My husband bought a huge tub of chocolate Slim-Fast that he likes to drink in the morning. She got into it.

Bob: And there was a mess all over the place.

Karla: Oh, my gosh. She flung it all over the walls and then licked them. It was just nasty – very, very nasty. And the other part about it was that she also got sick. She could have died from that. That’s chocolate, and it was a huge, 100-ounce powder that she ate almost all of it. Not only did we have the mess, but we had the fear she was going to be sick. She had a tummy ache for a couple days, and then that was it.

Bob: So the shields will work for something like that?

Karla: Yeah. Right now we have the shields set up in that cupboard. She can’t get in there. I have another dog that likes to lay next to that cupboard – a little dachshund named Bucky – and Bucky can lay right next to it and doesn’t even know the shield is there. It doesn’t affect him.]]>https://api.spreaker.com/episode/16712473Mon, 14 Jan 2019 23:07:40 +0000Produced by Podcast For HireInvisible Fence Brand of the TriStates / E2 - Unconditional Love Invisible Fence Brand of the Tri-States 319 Northstar RoadWI 54636 (608) 399-1266 https://tri-states.invisiblefence.com...Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Bob: People are using their animals as maybe an escape from family or children.

Karla: It’s not an escape. It’s actually, in my opinion, because we are very disconnected from our friends and family because we’re more connected electronically. We’re disconnected physically. Years ago, you used to go visit grandma and grandpa on Sunday after church. Well, nobody does that anymore. So that hug from grandma or your cousins or all those kinds of things that you had is now replaced by an animal. It’s unconditional love, and that’s what we all want. We look for it.

Bob: It boils down to our loved ones. How can Invisible Fence Brand help to nature and nurture that relationship with my best friend?

Karla: It can make a relationship better. You already have a great relationship with your dog, but it can make it so much better. Dogs are like children, and when they misbehave it just makes you angry. A lot of times with Invisible Fence Brand, what you can do is build that relationship by being able to go in the yard and play ball with your dog without them being on a chain. You can garden in your yard, and they can be out there with you and not feel like they’re attached to something. The other thing is that it’s freedom. The other part about it is if you do have problem areas in your home where dogs are naughty – let’s say the garbage can. Invisible Fence has products that when you come home after a long day of work and you really just want to be with your friend, but you’re not cleaning up the mess your friend made, and now you resent them because they don’t really know why they did it; they’re dogs. But we can put shields there, they can stay out of the garbage, you don’t come home to a mess, and you can come home to that unconditional love that one dog that waited all day for you. It’s awesome the different things that we do. It’s just really awesome. It’s cool.

Bob: I think it’s pretty cool the products Invisible Fence Brand has that helps us to achieve that and to show our pets that they’re truly loved. What are some of your favorite products that you guys have?

Karla: I have so many. It’s proving to them that we love them, but it’s also keeping them safe so that we can keep them and love them for as long as we can. That unconditional love doesn’t last forever. We only have them a short period of time, and so we want the absolute best for them, and to keep them safe. Some of our products that we have that I just absolutely love, I love our shields products. I absolutely love them [and] how we can do so many different things with them. When you have two dogs in the house and you’ve got one that pretty much can go anywhere and you’ve got another one that’s really, really naughty, you can make so that the one dog isn’t affected by it and the other dog you’re keeping safe. For instance, my dog, Ella. Ella is very naughty. She is a 14-year-old black lab-basset mix, as you know, and has the most stoic, innocent face of any animal I’ve ever met in my life. Most people look at me and go, ‘Oh, my God. Ella’s naughty?’ I’m like, ‘Oh, she’s the naughtiest dog I have.’ But what’s great about the Invisible Fence shields is that I can keep her out of things that she shouldn’t be into. For instance, we had a cupboard that we didn’t have a shield in. My husband bought a huge tub of chocolate Slim-Fast that he likes to drink in the morning. She got into it.

Bob: And...]]>296brand,bswithbob,dog,doggiebusinessllc,dogs,fence,happy,invisible,invisiblefencebrand,karla,love,microcast,pet,toppen,unconditionalfalsefullhttps://www.spreaker.com/episode/e9-mchugh-excavating-proud-of-core-values--15811567
Well I'm proud that this company that my dad started out of the basement of our house when I was 10 years old is still around after 42 years. Lot of people that we've helped over the years with their projects and with their problems there's people some water problems right now and sometimes it's just a little bit of grating in the backyard to get that to go away and sometimes it's not quite so simple and to think be more of a complex issue and I'm proud of helping those people. Probably most importantly I'm proud of all the good paying jobs and all the people that I've been able to support families working here.

Q Over the years keep things local that's that's fantastic. Dean Mikir from ACU excavating. I know that any Web site it says innovative construction solutions of 1976 which is like you said 42 years ago when your father started the company. And what I like about your website is you've actually got a page that's got your core values on there. How often do you see an excavating company with their core values listed right on their website.

Well the core values are something we really believe in by about four or five years ago sat through a seminar on our guys talked about the Ritz Carlton you know that I don't stay there and few do. But we all know what the Ritz Carlton is and we know what their reputation services. And he talked about how they use core values to make sure everybody in the company is always thinking like they want their reputation to be. And we felt at that time that our company demonstrated a lot of the things that a customer would like to see or an employee would like to see in a company. But after listening to that fellow give that seminar we realized we get these things out on paper and so we had several management meetings and that came up with what we thought were the 13 most important values to our company. We define them. We came up with examples of them and we take time every week. Every Monday morning we have a 15 minute conference call that everybody in the company is on and we ROTY through the 13 works out well because at four times in a 52 week year but we rotate through those core values and we have the column Tuesday and the values there and we discuss we're being fair means improving the customer being fair to your fellow employees. We have guys that chime in from all on the job sites and the example they've seen in the last week of what being fair is and like you said there's 13 of them and there is just one of them. But we feel having that reminder and talking about that for 10

to 15 minutes every week keeps that top of mind and keeps everybody in the company from top to bottom hopefully they're producing and acting out what we want to be as a company.]]>https://api.spreaker.com/episode/15811567Sun, 13 Jan 2019 00:10:05 +0000Produced by Podcast For HireDean McHugh from McHugh excavating what are you most proud of. What do you think of McHugh excavating. Well I'm proud that this company that my dad started out of the basement of our house when I was 10 years old is still around after 42 years. Lot...
Well I'm proud that this company that my dad started out of the basement of our house when I was 10 years old is still around after 42 years. Lot of people that we've helped over the years with their projects and with their problems there's people some water problems right now and sometimes it's just a little bit of grating in the backyard to get that to go away and sometimes it's not quite so simple and to think be more of a complex issue and I'm proud of helping those people. Probably most importantly I'm proud of all the good paying jobs and all the people that I've been able to support families working here.

Q Over the years keep things local that's that's fantastic. Dean Mikir from ACU excavating. I know that any Web site it says innovative construction solutions of 1976 which is like you said 42 years ago when your father started the company. And what I like about your website is you've actually got a page that's got your core values on there. How often do you see an excavating company with their core values listed right on their website.

Well the core values are something we really believe in by about four or five years ago sat through a seminar on our guys talked about the Ritz Carlton you know that I don't stay there and few do. But we all know what the Ritz Carlton is and we know what their reputation services. And he talked about how they use core values to make sure everybody in the company is always thinking like they want their reputation to be. And we felt at that time that our company demonstrated a lot of the things that a customer would like to see or an employee would like to see in a company. But after listening to that fellow give that seminar we realized we get these things out on paper and so we had several management meetings and that came up with what we thought were the 13 most important values to our company. We define them. We came up with examples of them and we take time every week. Every Monday morning we have a 15 minute conference call that everybody in the company is on and we ROTY through the 13 works out well because at four times in a 52 week year but we rotate through those core values and we have the column Tuesday and the values there and we discuss we're being fair means improving the customer being fair to your fellow employees. We have guys that chime in from all on the job sites and the example they've seen in the last week of what being fair is and like you said there's 13 of them and there is just one of them. But we feel having that reminder and talking about that for 10

to 15 minutes every week keeps that top of mind and keeps everybody in the company from top to bottom hopefully they're producing and acting out what we want to be as a company.]]>237falsefullhttps://www.spreaker.com/episode/e7-masters-services-chimney-chad-dirty-chimneys-and-cleaning-logs--15793393
So what kind of things need to be done on a regular basis when it comes to having a fireplace or having a chimney no matter where you live.

You should your fireplace and chimney inspected once a year. Main thing is to have your fireplace be in a working order and safe chimney had to dirty chimneys cause issues in a home dirty chimney cause many issues. Number one is there an allergy. Number two is a dirty chimney who accumulate soot and over time it will turn into a dangerous hazard that can cause the chimney fire across the country.

There are many chimney fires due the lack of proper maintenance yearly maintenance on fireplaces and chimney.

No. Can I know that there's a product out there that I can burn in my fireplace that will miraculously clean out my chimney is that something that you would suggest people to do.

It's actually not a bad issue I used to think that it wasn't but that said My blog is not a bad deal to burn every once in a while and your chimney is what it does is it crystallizes. Just like it does and has everything crystallizes soot and it all fall. The problem with that is you're not also seeing you're not also getting the result of a chimney inspection to see if there is any damage that occurred during or during before or after the process. The problem with the law those logs is that you burn you burn that log you clean your chimney. You don't think you need to have a professionally looked at which is exactly the problem with that log is people will have issues with the fireplaces. They say they knock UTM inspected. They're just having the logs burned. And with that burning that thing. Okay. My gym is clean there's nothing wrong with my chimney. Well there can obviously be many things wrong with the chimney that have occurred over time and the false sense of security with burning a log does not replace an annual chimney inspection.

So you say annual chimneys inspections we do.

Reminder emails and calls will leave for people to do that. With that most people that burn enough will do it.]]>https://api.spreaker.com/episode/15793393Sat, 05 Jan 2019 18:40:17 +0000Produced by Podcast For HireGrowing up in Wisconsin I only knew three or four families that actually had wood burning fireplace or coming down to Texas. Everybody had a wood burning fireplace not knowing that. So as I'm driving around with this gentleman who worked for me Tell...
So what kind of things need to be done on a regular basis when it comes to having a fireplace or having a chimney no matter where you live.

You should your fireplace and chimney inspected once a year. Main thing is to have your fireplace be in a working order and safe chimney had to dirty chimneys cause issues in a home dirty chimney cause many issues. Number one is there an allergy. Number two is a dirty chimney who accumulate soot and over time it will turn into a dangerous hazard that can cause the chimney fire across the country.

There are many chimney fires due the lack of proper maintenance yearly maintenance on fireplaces and chimney.

No. Can I know that there's a product out there that I can burn in my fireplace that will miraculously clean out my chimney is that something that you would suggest people to do.

It's actually not a bad issue I used to think that it wasn't but that said My blog is not a bad deal to burn every once in a while and your chimney is what it does is it crystallizes. Just like it does and has everything crystallizes soot and it all fall. The problem with that is you're not also seeing you're not also getting the result of a chimney inspection to see if there is any damage that occurred during or during before or after the process. The problem with the law those logs is that you burn you burn that log you clean your chimney. You don't think you need to have a professionally looked at which is exactly the problem with that log is people will have issues with the fireplaces. They say they knock UTM inspected. They're just having the logs burned. And with that burning that thing. Okay. My gym is clean there's nothing wrong with my chimney. Well there can obviously be many things wrong with the chimney that have occurred over time and the false sense of security with burning a log does not replace an annual chimney inspection.

So you say annual chimneys inspections we do.

Reminder emails and calls will leave for people to do that. With that most people that burn enough will do it.]]>192bob,bswithbob,chad,chimney,chimneychad,chimneysweep,fire,firelog,fireplace,inspection,masters,mastersservices,microcast,murray,place,schmidt,services,sweepfalsefullhttps://www.spreaker.com/episode/e1-blues-city-strength--16594279http://www.bluescitystrength.com/
https://www.facebook.com/bluescitystrength/
A person who has never been to the gym before or when they go to a gym. They leave feeling unsuccessful because they were really kind of felt like they were going to do this and they get to the gym and then there psyched about their goals, are psyched about New Year's resolutions. I signed up for the gym. They're starting to pay a little bit of money to do that and then they get there and they just don't know what to do, and they're just kind of like floating about in a leave and it feels like that really wasn't worth it. I think that that person would definitely be someone well-suited to work with a trainer because we create that relationship with them and their experience Jason Friedman tell me little bit about who you are what I would say that I nobody who is very passionate about training and about fitness and about the daily practice of of movement. Why would somebody want to go to having having a place to go to food, to be able to work on yourself and kind of devote yourself to getting better and doing something worthwhile. When I kinda got into training and decided that I want to pursue this a little bit more seriously as a career. You know, as opposed to just like something that I like to do as a hobby, it was because I really felt like I didn't want to spend my time sitting in it at a desk and plugging away at something that wasn't particularly important to me and I was felt like no matter what was going on in my life that if I was able to get to the gym and I felt good. I felt like I did like II had a little bit of the success that they even if things were not particularly successful in other ways you can become a professional athlete but can everybody become healthier. Yeah for the fitness aspect of people's lives. What I really try to do is meet people wherever they are and try to make fitness or gym life. I guess you could say something that feels really at home. Philly feels really relatable to them. Not overwhelming. Or, you know, scary in any way that this is not like all you know you're you're going to come and get your ass absolutely handed to you by your trainer in your trainer to be yelling at you and making you feel bad about yourself that is the complete opposite of what I think training experience is that you not think it's a it's a relationship that that a trainer and person kind of develop in terms of like what it is that they want to get out of it. And there's anything that I really put out there to folks, it's that anybody can do it and that being healthy and being said of being strong or being able to move is about the practice itself. It's not when folks come in, so often they come in with you know very kind of like rigid goals, but they haven't worked out or moved it all in like 20 years and so they have their sights set on this very like specific idea without any process in order to get them there and that can be very quickly frustrating for people because the results take time and they're very indefinite. They're not like as finite as people think like oh yes I Verizon achieved and made it there. Now I'm done when really it's just about the consistency in the frequency and the practice which is something that you continue to go back to on a regular basis you continuing to work on on your movement, and that's really as in anything. What mastery is just the continued practice of working on it getting better and I find that through. That is how to me where the most success comes from is when somebody adopts this into their life. It fully integrates to come to the gym. They do the work. They leave the feel-good and that they come back and it's a it's a very positive rewarding full circle experience. So in that regard, there is no exact recipe. It is whatever somebody makes is that as long as it's something consistent to someone or some of the things that we can do simply in our house maybe one or watching television or got five minutes in between this meeting in the next meeting. What can we do that simple in our house or in our office. That's actually a I think one of the most important things most important places to pick it up would be at the office or at home. What I would say about the industry now is that as a trainer were tending to see the same injuries again and again and essentially there, sitting injuries, their poor posture injuries and that's because people your training yourself at all times. So the things that you do the most. Your body is adapting into those positions. So if you're kinda slouching at a desk and your wrists are all kind of been to encrypt over because you're banging on the keyboard and you're peering into the into the computer screen like kind of meaning for your neck is out of position and your back is curved. That's training for your body. So then when you stand up and you try to like straighten yourself out. It hurts. It feels kind of like unnatural feels bad and so that's when you know during that time when you're sitting I would say the first thing is get up. Don't sit still for a long extended periods of time. You know half hour 45 minutes really try to limit it, limit it to that is much as you can so that when you get up you you don't have to get up and do a power packed workout every half an hour, but if you get up and stretch and you move you take a quick walk maybe do a few reps of something like 10 good push-ups. 10 good squats, you know, I really some of the more basic foundational movements. It kind of resets your entire system reset your entire posture and so then when you sit back down to work and you have a little bit of awareness in terms of how you're sitting you know, holding your chest open, holding your shoulders, back and down sitting up nice and straight having to know the proper support in your in your lumbar spine that lower back area of the feet firmly planted on the ground and just some general awareness about the where your body is know in time and space. That's also training and can help alleviate a lot of these postural problems with people having so what is publicity strengthen what blue city strength is my business to take somebody's blues away by giving them a good workout. Blue city strength comes from my father. My pop school is a bluesman. He grew up playing the blues and he still does to this day stands out. You know with with some friends who he's grown up with your Chicago is known for the blues. Can anybody workout yeah ever anybody can work out that anybody who can move can do it, or should move and I think that the term working out might create a certain impression in somebody's head like they have to do this for hour and 1/2 dripping wet of sweater things like that and it depends on the person. It depends on who you know what your experience or background is any sort of injuries metal conditions of things that the program would be then uniquely suited for them to help them step-by-step get a little bit better as far as my clientele goes, I will. I work with kids and that I work with folks who are in their 80s folks who are like really serious about going after maybe an advanced certification of some kind or advanced training. You know like marathon prep for a triathlon recently been working with a guy recovering from cancer who you know. It lost a lot of weight and lost a lot of strength and decided he wanted to get control of his life again and wanted to dedicate himself to feeling strong and being physical and so II think it it it just depends anybody could do it to you only work out of a certain Jim or can I call blue city strength for any Jim I really only workout of the gym called the space okay which is run by Annie put rid you know we really work extremely well together and we have great great training staff you know where all training independently so it's a trainer's Jim, I do exclusively work out of the space right now. How do something to hold. The blue city strength, Jason telephone number is 773 301 0344 773-301-0344 I have a website. My website is blue city strength.com, people can reach out to me by email jason@bluecitystrength.com]]>https://api.spreaker.com/episode/16594279Sun, 30 Dec 2018 17:20:59 +0000Produced by Podcast For Hirehttp://www.bluescitystrength.com/ https://www.facebook.com/bluescitystrength/ A person who has never been to the gym before or when they go to a gym. They leave feeling unsuccessful because they were really kind of felt like they were going to do this...http://www.bluescitystrength.com/
https://www.facebook.com/bluescitystrength/
A person who has never been to the gym before or when they go to a gym. They leave feeling unsuccessful because they were really kind of felt like they were going to do this and they get to the gym and then there psyched about their goals, are psyched about New Year's resolutions. I signed up for the gym. They're starting to pay a little bit of money to do that and then they get there and they just don't know what to do, and they're just kind of like floating about in a leave and it feels like that really wasn't worth it. I think that that person would definitely be someone well-suited to work with a trainer because we create that relationship with them and their experience Jason Friedman tell me little bit about who you are what I would say that I nobody who is very passionate about training and about fitness and about the daily practice of of movement. Why would somebody want to go to having having a place to go to food, to be able to work on yourself and kind of devote yourself to getting better and doing something worthwhile. When I kinda got into training and decided that I want to pursue this a little bit more seriously as a career. You know, as opposed to just like something that I like to do as a hobby, it was because I really felt like I didn't want to spend my time sitting in it at a desk and plugging away at something that wasn't particularly important to me and I was felt like no matter what was going on in my life that if I was able to get to the gym and I felt good. I felt like I did like II had a little bit of the success that they even if things were not particularly successful in other ways you can become a professional athlete but can everybody become healthier. Yeah for the fitness aspect of people's lives. What I really try to do is meet people wherever they are and try to make fitness or gym life. I guess you could say something that feels really at home. Philly feels really relatable to them. Not overwhelming. Or, you know, scary in any way that this is not like all you know you're you're going to come and get your ass absolutely handed to you by your trainer in your trainer to be yelling at you and making you feel bad about yourself that is the complete opposite of what I think training experience is that you not think it's a it's a relationship that that a trainer and person kind of develop in terms of like what it is that they want to get out of it. And there's anything that I really put out there to folks, it's that anybody can do it and that being healthy and being said of being strong or being able to move is about the practice itself. It's not when folks come in, so often they come in with you know very kind of like rigid goals, but they haven't worked out or moved it all in like 20 years and so they have their sights set on this very like specific idea without any process in order to get them there and that can be very quickly frustrating for people because the results take time and they're very indefinite. They're not like as finite as people think like oh yes I Verizon achieved and made it there. Now I'm done when really it's just about the consistency in the frequency and the practice which is something that you continue to go back to on a regular basis you continuing to work on on your movement, and that's really as in anything. What mastery is just the continued practice of working on it getting better and I find that through. That is how to me where the most success comes from is when somebody adopts this into their life. It fully integrates to come to the gym. They do the work. They leave the feel-good and that they come back and it's a it's a very positive rewarding full circle experience. So in that regard, there is no exact recipe. It is whatever somebody makes is...]]>551blues,bluescitystrength,bob,bswithbob,city,freidman,jason,microcast,new,personal,podcast,schmidt,strength,trainer,training,workout,yearfalsefullhttps://www.spreaker.com/episode/e7-eco-gardens-by-washburn-llc-podcast--15940813
Well in the winter months garden design is so sustainable landscape design. Getting ready for spring eco garden will also come out and do them like fruit tree pruning. No we're just gearing up and we're going to educational seminars trade shows getting ready to see what new things are coming out the next season. Plus there's always new diseases new pets that we have to learn about to watch for and how to combat them sharpening up the tools and making sure everything's ready to go for the next season as well.

I had the opportunity to walk through a garden with you and I thought that was really cool. Do you offer that as a service where you'll take somebody through and show them things in their yard that you could do this and this is what this plant does and here's why this one would be good for your backyard.

Yes absolutely. There's many people that call me just to come over for ideas so I go over and provide a consultation. And you know even with scheduling like OK Thero and when should I do this.

When should a true that when should they fertilize everything calendar based when it comes to dealing with your garden.

No no I wouldn't say calendar based I would say temperature based. You know we look at the life of the plant or the lifespan of the plant really the temperature makes the big difference.

We're known as the frozen tundra or at least the area of the frozen tundra. When it comes to when the ground freezes and we end up with her Snow is there anything that we can do or what should absolutely be done before our first snow flies Hulsey Lottering.

You don't need to fertilize things because they're going into dormancy. Well not evergreen. You could give a little shot of the light there right now definitely watering that in giving them a very very healthy drink. They need that energy to get down to their roots so that they can survive the winter because we're not probably going to get a whole lot of rain. Maybe we will in the winter as long as your larger plantings get a really healthy drink. Then you can start to say yep I did the best that I could to prepare these plants for winter.

A lot of the big box stores sell bags of mulch is that the kind of mulch that you're talking about and you're talking about mulching.

You can certainly use that but also press clippings and leave would work just fine. And if you have a straw bale around as long as these scenes are disease free and don't have a bunch of mold I'd say use them. And yet you could definitely use like a cedar molds if you like from the big box stores.

No problem when it comes to my asparagus do I cut those down or do I do a lot those winter and then come down in the spring.

Essentially you could do either one Bob. But if you wanna cut them down right now you certainly can. I'd probably cut to about 4 inches above soil level.

What about strawberries do I need to do anything with those.

Give him a good mulch. Get yourself a straw. Clubroom with and look best to be.

Do I want to cut him down at all or just put it right over the top of the leaves and everything I just put it right on top of them because they're going to those they're going to die anyway. When you start raking that stuff off in the spring it'll come right with it.]]>https://api.spreaker.com/episode/15940813Wed, 26 Dec 2018 22:20:22 +0000Produced by Podcast For HireAs we switch from season to season we're lucky in the Midwest to have four distinct seasons. What does eco gardens by Washburn do in the winter months. Well in the winter months garden design is so sustainable landscape design. Getting ready for...
Well in the winter months garden design is so sustainable landscape design. Getting ready for spring eco garden will also come out and do them like fruit tree pruning. No we're just gearing up and we're going to educational seminars trade shows getting ready to see what new things are coming out the next season. Plus there's always new diseases new pets that we have to learn about to watch for and how to combat them sharpening up the tools and making sure everything's ready to go for the next season as well.

I had the opportunity to walk through a garden with you and I thought that was really cool. Do you offer that as a service where you'll take somebody through and show them things in their yard that you could do this and this is what this plant does and here's why this one would be good for your backyard.

Yes absolutely. There's many people that call me just to come over for ideas so I go over and provide a consultation. And you know even with scheduling like OK Thero and when should I do this.

When should a true that when should they fertilize everything calendar based when it comes to dealing with your garden.

No no I wouldn't say calendar based I would say temperature based. You know we look at the life of the plant or the lifespan of the plant really the temperature makes the big difference.

We're known as the frozen tundra or at least the area of the frozen tundra. When it comes to when the ground freezes and we end up with her Snow is there anything that we can do or what should absolutely be done before our first snow flies Hulsey Lottering.

You don't need to fertilize things because they're going into dormancy. Well not evergreen. You could give a little shot of the light there right now definitely watering that in giving them a very very healthy drink. They need that energy to get down to their roots so that they can survive the winter because we're not probably going to get a whole lot of rain. Maybe we will in the winter as long as your larger plantings get a really healthy drink. Then you can start to say yep I did the best that I could to prepare these plants for winter.

A lot of the big box stores sell bags of mulch is that the kind of mulch that you're talking about and you're talking about mulching.

You can certainly use that but also press clippings and leave would work just fine. And if you have a straw bale around as long as these scenes are disease free and don't have a bunch of mold I'd say use them. And yet you could definitely use like a cedar molds if you like from the big box stores.

No problem when it comes to my asparagus do I cut those down or do I do a lot those winter and then come down in the spring.

Essentially you could do either one Bob. But if you wanna cut them down right now you certainly can. I'd probably cut to about 4 inches above soil level.

What about strawberries do I need to do anything with those.

Give him a good mulch. Get yourself a straw. Clubroom with and look best to be.

Do I want to cut him down at all or just put it right over the top of the leaves and everything I just put it right on top of them because they're going to those they're going to die anyway. When you start raking that stuff off in the spring it'll come right with it.]]>241bob,bswithbob,calendar,clippings,eco,ecogardens,ecogardensbywashburn,gardens,grass,lacrosse,microcast,mulch,planting,sara,schmidt,washburn,winterfalsefullhttps://www.spreaker.com/episode/e3-chris-jones-1-word-holidays--16495355https://api.spreaker.com/episode/16495355Tue, 25 Dec 2018 18:00:21 +0000Produced by Podcast For HireEveryone has their thing and my thing is that maybe social skills, but I want to universal across this woman name Holly you not Dr. she studied genocide like going to Rwanda and this is a white woman she is. She went Rwanda and other places where...633bob,bswithbob,chris,chrisjones,christmas,family,holiday,holidays,hypnosis,hypnotist,iloveyou,jones,love,microcast,one,podcast,schmidt,thanksgiving,travel,wordtruefullhttps://www.spreaker.com/episode/e8-mchugh-excavating-longevity-training--15811539
We will concentrate on different things that are relevant to most positions in the company. So like proper chain down for moving equipment or maybe confined space you know being able to safely enter manholes and take air monitor readings and stuff like that so nobody's ever in danger. Those take. Trench safety you know be used properly utilizing trench foxes so that people would be protected from Keyvan. Those are the kind of things that will train in the winter first aid type stuff more generic things that apply at all jobs. Q executing it provides that training to our own employees. In addition to that the two unions have training centers and a lot of our guys will end up going to the training centers if they have any layoff time in the winter for specific classes. For example the laborers will have a grade reading class or a pipeline class. You know the operators may have a class on running excavator running at doughs or things like that. So you know so there is ongoing training. Once people are in those positions but a lot of times people say hey you know what everybody wants experience. How do I get experience. Nobody will hire me. And our answer to that is we have a lot of different positions where a person can start out. A lot of times running one of our gumdrops might be an entry level position. There's a lot of guys here that started running a dump truck and then at some point decide they want to do something different and we're forgoing an opportunity to go into something different. We hire some guys right off the street that

don't have any industry experience. In fact we just hired one here about a month and a half ago. A younger fellow early 20s he has some experience building houses and doing some other somewhat construction related stuff but not earthwork or pipe stuff just a good hard working kid and we thought it's been good and. We put them into Labor's apprenticeship program. So he'll be in the next four years he will. He starts out. On an entry level apprentice type rate. He'll step up over the next four years to. Become a full journeyman in the.

Laborers Union. But in the meantime he'll get about 100 hours of schooling. Each winter. The Laborers Training Center so he's got some. On the job learning. And some. Will learning. As. He learns himself into a trade that should provide him a good living and a good retirement when he's done.]]>https://api.spreaker.com/episode/15811539Thu, 13 Dec 2018 00:10:04 +0000Produced by Podcast For Hirewhen you look at the average amount of time that your people have worked for you deem how how long is the average. We've got a few field guys have been over 15 years. We had some guys that have retired from us here within the last three to five years....
We will concentrate on different things that are relevant to most positions in the company. So like proper chain down for moving equipment or maybe confined space you know being able to safely enter manholes and take air monitor readings and stuff like that so nobody's ever in danger. Those take. Trench safety you know be used properly utilizing trench foxes so that people would be protected from Keyvan. Those are the kind of things that will train in the winter first aid type stuff more generic things that apply at all jobs. Q executing it provides that training to our own employees. In addition to that the two unions have training centers and a lot of our guys will end up going to the training centers if they have any layoff time in the winter for specific classes. For example the laborers will have a grade reading class or a pipeline class. You know the operators may have a class on running excavator running at doughs or things like that. So you know so there is ongoing training. Once people are in those positions but a lot of times people say hey you know what everybody wants experience. How do I get experience. Nobody will hire me. And our answer to that is we have a lot of different positions where a person can start out. A lot of times running one of our gumdrops might be an entry level position. There's a lot of guys here that started running a dump truck and then at some point decide they want to do something different and we're forgoing an opportunity to go into something different. We hire some guys right off the street that

don't have any industry experience. In fact we just hired one here about a month and a half ago. A younger fellow early 20s he has some experience building houses and doing some other somewhat construction related stuff but not earthwork or pipe stuff just a good hard working kid and we thought it's been good and. We put them into Labor's apprenticeship program. So he'll be in the next four years he will. He starts out. On an entry level apprentice type rate. He'll step up over the next four years to. Become a full journeyman in the.

Laborers Union. But in the meantime he'll get about 100 hours of schooling. Each winter. The Laborers Training Center so he's got some. On the job learning. And some. Will learning. As. He learns himself into a trade that should provide him a good living and a good retirement when he's done.]]>286falsefullhttps://www.spreaker.com/episode/e6-bill-temte-favorite-memory-beer-neighborhood--15803060
And the two railroads. But it was self-contained in that. The interesting thing that has happened is since I've moved I've met a number of the northside LaCrosseer by each and one of them comes Oh yeah yeah I think remembered every Sunday afternoon my dad and make me go to your dad's store.

We'd cut through the whole the yards coming from over on the side of the street and going to the store because he wanted the nice juicy Apple for dessert. And so I talked to them about the nature of the neighborhood nature and our site. And I have not had one word of what or anything just one of them that's just the way it was.

We are our own neighborhood community and within that there was the the north the Roosevelt school I'm that editor eventually and in the middle and then the south and then Indian Hill that's what we used to call it by the river mills. What do you think that there was this thing as Northside pride because you hear people say Northside pride way more than you hear people say Southside pride because we were that neighborhood and everybody within our within our neighborhood area you know we didn't. We knew people wrong the whole north side but we were family and we do things with them for each other and stuff.

And that's what the pride and that's what we shared to me by this one lady that tight knit just two days ago again.

So you're quite often now but that neighborhood community and caring and family may have said this.

She said she'd have to go to my dad's and she's after a while I so I could just go in the back door and get in and go back out now.

Have you seen people kind of come together more in your later years and he did in the earlier years.

Because like I said the Northside Pride was a thing and people are still saying that but define find that people are kind of getting along better now than perhaps they used to when it comes to the city of lacrosse.

The nurse said people now know him very easily feel a part of the greater lacrosse. There wasn't that standoffish because again this whole side didn't want everything to do with her side. And we were happy with that.

You'd give me a couple of names of people that were characters in the back in the day like one arm Brown crazy band type and a half.

These are people who lived in this Northside community who were given a name and one name wrong because he lost his arm in a collision with a tree on a slender toboggan on the Indian hill because people had names that didn't mean they were lesser thought of or anything like that.

Well just nicknames and they're the characters that made you into the person that you are because you knew that right.

Yeah. They were characters but they were characters. And you know I didn't put words to put to it but it was just people who didn't get all upset about that name when I was called Billy or Bill or William didn't make any difference and I told the story about how and maybe I need to collectability the hand of a 50 of class reunion. We're sitting there in one of the lovely ladies of our high school class said Billy why didn't you ever ask me out on a date. And I said Derek I'm going to go back to the name. Billy.

Let me ask you this. What's that. What's the memory. If you were to if you were to tell somebody about your childhood what's the biggest memory or the memory that sets out the most.

Probably going fishing to brace prairie sitting in the back of the pickup truck of Phil Vitaliy in the car across the street. It had a place for people up front. Mom and Dad. Phil and Mabel vitality and then those four kids and some amount of the fifth riding the back of the pickup truck up 35 Z and then Z as far as who would go. And we'd stay up there two days a week we do this and we'd stay up there all day and a nice lunch would be prepared for us in the cabin which was the cottage and we'd fish from the bank and get a little older. We would push off in a rowboat. Good safe water and fish all day and then get thrown in the back of the truck and come home. The adults have a little more adult fun time. You can figure that one out. Yes it was. So that's one of the things that really members the more memorable part was Christmas at the tempting family. We read organ and my mother played the carols on the organ and as kids learned to sing at an early age. And my dear Dad would put on a Christmas program in the living room of this little bitty house of ours. The main living area and the mother would sit at the organ and play carols and ask kids. We were the three wise men because we had bathrobes that were checkered looked appropriate. My poor dear sister had to play Mary with the little darling baby and we'd stand there and sing Christmas carols and the neighbors would come in the front door

stand on the step out there with the front door open middle of winter. And that was our gift as a family to the neighbors for Christmas and Christmas tree was a masterpiece every year drilling holes and sticking branches until we discovered how my uncle he would get the biggest haul us with the spaces of all the spaces out and pay them back together and have the most perfect Christmas tree you could ever find. It was make your own tree. And most people just had kind of a scrubby tree and put a lot of tinsel hanging tinsel and stuff. Christmas was very special because that involved first of all Trinity Lutheran. Was a wonderful church for many people the church of the North Side. St. James was a Catholic and Trinity was the Lutheran so Christmas and fishing had tried to have these cottage or the two memories that still live very much with me deep in my heart.

You said that your your uncle worked at the brewery. Was there a brewery on the north side or was it just it was just the Highland girls haven and was there was there any small breweries on the north side that you recall those days.

Ol La Crosse Beer song. I've never heard that before. Well it disappeared many years ago.

That used to be the liquor was drinking beer so any parting words fell anything that you want to share that I know that I had maybe didn't ask.

No I've enjoyed sharing memories of the north side with you and with the people who choose to listen to the things I have to say. It's all done from me in love for the north side and my experiences and growing up there.]]>https://api.spreaker.com/episode/15803060Mon, 10 Dec 2018 22:45:11 +0000Produced by Podcast For Hirelooking through the history of the old lacrosse it's obvious that the cross ended at the South End of the causeway goes north and that was the start of the north side which as we've said before was a community of its own had its own factories and the...
And the two railroads. But it was self-contained in that. The interesting thing that has happened is since I've moved I've met a number of the northside LaCrosseer by each and one of them comes Oh yeah yeah I think remembered every Sunday afternoon my dad and make me go to your dad's store.

We'd cut through the whole the yards coming from over on the side of the street and going to the store because he wanted the nice juicy Apple for dessert. And so I talked to them about the nature of the neighborhood nature and our site. And I have not had one word of what or anything just one of them that's just the way it was.

We are our own neighborhood community and within that there was the the north the Roosevelt school I'm that editor eventually and in the middle and then the south and then Indian Hill that's what we used to call it by the river mills. What do you think that there was this thing as Northside pride because you hear people say Northside pride way more than you hear people say Southside pride because we were that neighborhood and everybody within our within our neighborhood area you know we didn't. We knew people wrong the whole north side but we were family and we do things with them for each other and stuff.

And that's what the pride and that's what we shared to me by this one lady that tight knit just two days ago again.

So you're quite often now but that neighborhood community and caring and family may have said this.

She said she'd have to go to my dad's and she's after a while I so I could just go in the back door and get in and go back out now.

Have you seen people kind of come together more in your later years and he did in the earlier years.

Because like I said the Northside Pride was a thing and people are still saying that but define find that people are kind of getting along better now than perhaps they used to when it comes to the city of lacrosse.

The nurse said people now know him very easily feel a part of the greater lacrosse. There wasn't that standoffish because again this whole side didn't want everything to do with her side. And we were happy with that.

You'd give me a couple of names of people that were characters in the back in the day like one arm Brown crazy band type and a half.

These are people who lived in this Northside community who were given a name and one name wrong because he lost his arm in a collision with a tree on a slender toboggan on the Indian hill because people had names that didn't mean they were lesser thought of or anything like that.

Well just nicknames and they're the characters that made you into the person that you are because you knew that right.

Yeah. They were characters but they were characters. And you know I didn't put words to put to it but it was just people who didn't get all upset about that name when I was called Billy or Bill or William didn't make any difference and I told the story about how and maybe I need to collectability the hand of a 50 of class reunion. We're sitting there in one of the lovely ladies of our high school class said Billy why didn't you ever ask me out on a date. And I said Derek I'm going to go back to the name. Billy.

Let me ask you this. What's that. What's the memory. If you were to if you were to tell somebody about your childhood what's the biggest memory or the memory that sets out the most.

Probably going fishing to brace prairie sitting in the back of the pickup truck of Phil Vitaliy in the car across the street. It had a place for...]]>582falsefullhttps://www.spreaker.com/episode/e6-masters-services-chimney-chad-why-inspect-inventor-clean-burn--15793495
Or are the issue. Does your lining crack up to your smoke shelf above your damper crack up did your damper stop working correctly. No. Are there cracks near back wall sidewalls. Does your Lindvall did it come loose to wear behind the opening of the fireplace that goes up through the wall. Is that sealed properly. That's some of the major parts of why you would want to have it should be inspected.

Now when you say that you know the cracking of things I know there's such a thing as a chimney liner to the chimney liners end up helping out Jimmy liners.

Absolutely. Parko to have a good chimney liner chimney liner can also just be realigned with mortar fire fireplace refractory. He resists and more which is the kind of which is the kind of relining that Master Services does.

Okay what about chimney caps. Sometimes you notice that some people have chimney caps other people don't. Are those something that people should have.

You have a prefabricated fireplace. They all have chimney caps as part of code as part of building. If you have a masonry built style chimney it is not code to have one but highly recommended because water damage is water. What causes damages to the mortar joints in the brickwork inside the fireplace flue.

Now I know that the chair that you're in inv. that you came up with a new product that will help maybe revolutionize the whole fireplace industry.

I invented breakdown. Great a little more decorative to the homeowner but more importantly I designed it for the chimney sweep so that he could break it down and carry in his truck and knocking it all scratched up or be hurt when he's riding in the back with van or truck. So what is the purpose of having a great great creates all the airflow underneath fire to have a good controlled fire going in your fireplace.

We've all been to different places where somebody is trying to start a fire and they're dropping a few four letter words. Smoke is roll back him. Is there is there a proper way to actually get that fire lit and not have the issues of you know the smoke detectors going off like like your grandma's doing some bacon again.

Well obviously there is a learning curve whenever you move into a new house or how you're going to start your fire. I mean there are people who have no gas pipes and there they have holes in it. Start the Fire with gas. I always recommend if you don't have to use a firestarter Barik they come there just little 3 or 4 inch breaks that you can put in underneath the fire or underneath the wood and light those and they'll light up the fire pretty good fairly quickly. But if you're having smoke coming out of the house that's a whole nother issue that may not have nothing to do with how you're starting your fire.

Is that an issue that that master's services can help me with Chad.

Well thanks for asking Bob it is a very big issue in the industry because a lot of people don't know their fireplace and there are so many things gimmee learned by having us show up to where we can show you the best way to light your fire. Now we will not light a fire in your house due to liability reasons but we can tell you how the best way to light a fire in your houses and generally generally it's making sure that your damper is open. We won't know if your fireplace works and if it smokes until you've actually had a fire there's no. Unless there's obvious things that the fireplace was built incorrectly which you can have a perfectly good fireplace and chimney that doesn't burn correctly so you could put a perfect fireplace inside of a monster room and the air pressure in that room isn't pushing up against the back wall to create a raft going up the fireplace. So there are many things that can be done after Markoe ways are different ways to start fires to get it to draft a lot of times you'll realize the smoking issue is only the beginning until the pressure of the House and the and the pressure outside is pulling in the pressure inside pushing that once it's created smoke will stay in firebox and go out the chimney when you first start to fire. Like many people will start the fire too close to the opening of the fireplace not towards the back wall. Well the smoke is just going to go to the point of least resistance so plenaries resistance might be coming into the room because they have the fire to close or they might

be having too much wood to start the fire creating too much smoke for the chimney to handle and then boom you guess its drafting well. But it's also coming into the into the house because you're having to build a fire for that firebox.]]>https://api.spreaker.com/episode/15793495Wed, 05 Dec 2018 18:45:04 +0000Produced by Podcast For HireWhat things are you looking for in a chimney when you go and make making an inspection chimney Chad cracks and chimney invader's cracks. Or are the issue. Does your lining crack up to your smoke shelf above your damper crack up did your damper stop...
Or are the issue. Does your lining crack up to your smoke shelf above your damper crack up did your damper stop working correctly. No. Are there cracks near back wall sidewalls. Does your Lindvall did it come loose to wear behind the opening of the fireplace that goes up through the wall. Is that sealed properly. That's some of the major parts of why you would want to have it should be inspected.

Now when you say that you know the cracking of things I know there's such a thing as a chimney liner to the chimney liners end up helping out Jimmy liners.

Absolutely. Parko to have a good chimney liner chimney liner can also just be realigned with mortar fire fireplace refractory. He resists and more which is the kind of which is the kind of relining that Master Services does.

Okay what about chimney caps. Sometimes you notice that some people have chimney caps other people don't. Are those something that people should have.

You have a prefabricated fireplace. They all have chimney caps as part of code as part of building. If you have a masonry built style chimney it is not code to have one but highly recommended because water damage is water. What causes damages to the mortar joints in the brickwork inside the fireplace flue.

Now I know that the chair that you're in inv. that you came up with a new product that will help maybe revolutionize the whole fireplace industry.

I invented breakdown. Great a little more decorative to the homeowner but more importantly I designed it for the chimney sweep so that he could break it down and carry in his truck and knocking it all scratched up or be hurt when he's riding in the back with van or truck. So what is the purpose of having a great great creates all the airflow underneath fire to have a good controlled fire going in your fireplace.

We've all been to different places where somebody is trying to start a fire and they're dropping a few four letter words. Smoke is roll back him. Is there is there a proper way to actually get that fire lit and not have the issues of you know the smoke detectors going off like like your grandma's doing some bacon again.

Well obviously there is a learning curve whenever you move into a new house or how you're going to start your fire. I mean there are people who have no gas pipes and there they have holes in it. Start the Fire with gas. I always recommend if you don't have to use a firestarter Barik they come there just little 3 or 4 inch breaks that you can put in underneath the fire or underneath the wood and light those and they'll light up the fire pretty good fairly quickly. But if you're having smoke coming out of the house that's a whole nother issue that may not have nothing to do with how you're starting your fire.

Is that an issue that that master's services can help me with Chad.

Well thanks for asking Bob it is a very big issue in the industry because a lot of people don't know their fireplace and there are so many things gimmee learned by having us show up to where we can show you the best way to light your fire. Now we will not light a fire in your house due to liability reasons but we can tell you how the best way to light a fire in your houses and generally generally it's making sure that your damper is open. We won't know if your fireplace works and if it smokes until you've actually had a fire there's no. Unless there's obvious things that the fireplace was built incorrectly which you can have a perfectly good fireplace and chimney that doesn't burn correctly so you could put a perfect fireplace inside of a monster room and the air pressure in that room isn't pushing up against the back wall to create a raft going up the fireplace. So there are many things that can be done after Markoe...]]>312bswithbob,burn,chad,chimney,chimneychad,dallas,fire,fortworth,masters,mastersservices,microcast,murray,podcast,safety,services,texasfalsefullhttps://www.spreaker.com/episode/e2-chris-jones-1-word-balance--16303022https://api.spreaker.com/episode/16303022Tue, 27 Nov 2018 18:00:19 +0000Produced by Podcast For HireChris Jones and the one word podcast, what have you learned when it comes to being on the road. Chris is a lot of learning pretty emotional, learning how so? Like my great call. When I had to cancel Thursday, I told you. Regardless of the longer I'm...6161word,balance,bob,bswithbob,chris,chrisjones,double,doubletake,facebookwatch,howie,jones,mandel,microcast,one,oneword,podcast,schmidt,take,tv,wordtruefullhttps://www.spreaker.com/episode/e6-eco-gardens-by-washburn-llc-podcast--15940799
As far as Blueberry so you can definitely do the mulch thing around the root zone like we talked about putting these green leaves and healthy grass clippings around the root zone and in the spring then that's when you would remove those from the raspberries there are some varieties and you'll have to be careful about some varieties you can just part through and looked all the way to the ground. People that I know that just run their lawnmower right over the raspberries and they come back beautiful the next year. Some raspberry varieties though you may not want to ruin that short fruit tree. Hopefully the apples and big ones are harvested right now but as far as pruning goes fruit trees always prune trees 25 percent or less is that healthy for a mature tree. Winter I think it's the best time of her in those fruit trees. The old adage is you should prune them so that you can throw a hat through it but we want to get that fruit tree enough faith in the inside so that if there is fruit on the inside of both branches then the sunlight can get through them. And it also helps the airflow too.

What about for our perennials and are annuals and our flowers that we plant in our backyards.

Well at this point I would be for an annual is out you may have already started to fall out just because they're starting to feel pretty bad just simply because they take a lot of water. Well I mean they only have so long to live. Being an annual so those I would put in your yard waste bin or put them wherever you put your compost pile as long as they are disease free. It's about perennials so pruning back your perennials some of them maybe you are pretty good. That'd be balm if it got that powdery mildew on it that kind of thing. You can leave some of them and especially like the NHS which would be triple cornflower. There's a lot of seeds and those types of plants like a season and the birds will eat those as long as they're there and throughout the winter you know I say let it stand and drink a lot of lawns in the upper Midwest Sarah I have crippling Charlie and a mine included.

Is there a way to get rid of that or is this a good time of the year to tackle the creeping Charlee issues in our yards.

Yes it is absolutely a great time to try to tackle the creeping tritely problem right now because of the cooler days and the not so intense sunshine the cuticle of the Creeping Charlie Bean that is so waxy right now it is less likely to resist the chemical being put into it. Because our creeping Charlie and our plants are starting to think about going into dormancy.]]>https://api.spreaker.com/episode/15940799Mon, 26 Nov 2018 22:20:11 +0000Produced by Podcast For HireSara Washburn from eco gardens my Washburn with our monthly podcast. So my question is there's a lot of people in the upper Midwest that have blueberries and raspberries and apple trees and strawberries. What kind of things we have to do in the winter...
As far as Blueberry so you can definitely do the mulch thing around the root zone like we talked about putting these green leaves and healthy grass clippings around the root zone and in the spring then that's when you would remove those from the raspberries there are some varieties and you'll have to be careful about some varieties you can just part through and looked all the way to the ground. People that I know that just run their lawnmower right over the raspberries and they come back beautiful the next year. Some raspberry varieties though you may not want to ruin that short fruit tree. Hopefully the apples and big ones are harvested right now but as far as pruning goes fruit trees always prune trees 25 percent or less is that healthy for a mature tree. Winter I think it's the best time of her in those fruit trees. The old adage is you should prune them so that you can throw a hat through it but we want to get that fruit tree enough faith in the inside so that if there is fruit on the inside of both branches then the sunlight can get through them. And it also helps the airflow too.

What about for our perennials and are annuals and our flowers that we plant in our backyards.

Well at this point I would be for an annual is out you may have already started to fall out just because they're starting to feel pretty bad just simply because they take a lot of water. Well I mean they only have so long to live. Being an annual so those I would put in your yard waste bin or put them wherever you put your compost pile as long as they are disease free. It's about perennials so pruning back your perennials some of them maybe you are pretty good. That'd be balm if it got that powdery mildew on it that kind of thing. You can leave some of them and especially like the NHS which would be triple cornflower. There's a lot of seeds and those types of plants like a season and the birds will eat those as long as they're there and throughout the winter you know I say let it stand and drink a lot of lawns in the upper Midwest Sarah I have crippling Charlie and a mine included.

Is there a way to get rid of that or is this a good time of the year to tackle the creeping Charlee issues in our yards.

Yes it is absolutely a great time to try to tackle the creeping tritely problem right now because of the cooler days and the not so intense sunshine the cuticle of the Creeping Charlie Bean that is so waxy right now it is less likely to resist the chemical being put into it. Because our creeping Charlie and our plants are starting to think about going into dormancy.]]>220bob,bswithbob,charlie,creeping,creepingcharlie,eco,ecogardensbywashburn,fruit,gardens,grass,lacrosse,microcast,plants,podcast,sara,schmidt,trees,washburn,weeds,wisconsinfalsefullhttps://www.spreaker.com/episode/e1-invisible-fence-brand-of-the-tri-states-what-is-invisible-fence--16278408Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Time for your invisible fence Brand Microcast at invisible fence. They offer peace of mind had safe friends for a long time. You should know this but you know how to tell you visible think spring is a great containment for dogs. Where can I have been around 45 years cell pumper where I mean it's a containment solution for bulk solutions to help people with insights kinds of things we've we've solved a lot of problems for folks solutions and containment solution with me about containment is basically meaning that were keeping dogs in an area so that they are running into the road or running away or by the neighbor or whatever it may be, or keeping them out of the horse pass terror those kind of things and then yell solutions – we have so many of them. Your dog is naughty and assert Rome. I can keep the monotherapy in the garbage or if they rush the front door when the pizza guy comes or a pee on your Christmas tree. I mean, I can solve all those problems know we have been friends for a long time. You told me about solutions with pigs and cats to make sense to me. Well, you know, just because were considered a dog company but we do things with you knowing to cars like that To go outside. I also have two things that we put on our newest GPS system sold to pay executive roam around in the pigs. We don't lay any wire down so were able to use the satellites in the sky just like your GPS when you're putting your car to go somewhere on the coordinates with the collar and it's able to talk to the pet to tell me you can't go calculation with no recalculating gives him a chance to turn around, though for the dogs. It is an anti-Wenger zone so they can have time to turn around in the same like the earth moves into the satellites move but it gets the dogs opportunity to learn or pigs to go and I really want to do about having done a goat yet, but I'd like to know I want to do about future lot of successes that you had with me over the years. Different animals have had great solutions because of invisible fence. What's a great solution you can share with someone when it comes to mind. It's the one I always think of when someone asked me this question by a gal that had MS and was in a wheelchair had two boxers and the one boxer was younger and was a puppy and this dog would literally excited loved his owner, but would jump on her and pushed her wheelchair and she almost ended up going down the steps because of it. So we were able to use one of our little indoor shields and we were able to put it in the backpack on her wheelchair so the dog couldn't jump on her but she was able to retell the dog so the dog was it for baking from her just jumped on her and it was probably one of the most great things that one of the great things that we've done on being able to see the scalp. Keep her dog meant a lot to her and being able to function with her disability and we were able to help. We done a few different ones like that were we've been able to do things on the ninth had folks that have had cancer that literally can't let their dogs outside in order put them on a chain or anything. Were talking about getting rid of their dogs and we been able to make it so that their dogs can have a great life insulting me which is awesome. So how does somebody get a hold of invisible funds Carla Coleman correctly located right.LLC which is actually six to learn more about an visible fence Brand visit invisible fence.com invisible fence friends are told containment and avoiding solution company for patents V invisible fence micro-cast as a podcast for hire production
Doggie Business LLC
dba Invisible Fence Brand
319 North Star Road | Holmen, WI
608-399-1266]]>https://api.spreaker.com/episode/16278408Wed, 21 Nov 2018 17:34:53 +0000Produced by Podcast For HireInvisible Fence Brand of the TriStates / E1 - What is Invisible Fence Invisible Fence Brand of the Tri-States 319 Northstar RoadWI 54636 (608) 399-1266 https://tri-states.invisiblefence.com...Invisible Fence Brand of the Tri-States
319 Northstar RoadWI 54636
(608) 399-1266
https://tri-states.invisiblefence.com
https://www.facebook.com/pages/category/Pet-Service/Invisible-Fence-209481692915/

Time for your invisible fence Brand Microcast at invisible fence. They offer peace of mind had safe friends for a long time. You should know this but you know how to tell you visible think spring is a great containment for dogs. Where can I have been around 45 years cell pumper where I mean it's a containment solution for bulk solutions to help people with insights kinds of things we've we've solved a lot of problems for folks solutions and containment solution with me about containment is basically meaning that were keeping dogs in an area so that they are running into the road or running away or by the neighbor or whatever it may be, or keeping them out of the horse pass terror those kind of things and then yell solutions – we have so many of them. Your dog is naughty and assert Rome. I can keep the monotherapy in the garbage or if they rush the front door when the pizza guy comes or a pee on your Christmas tree. I mean, I can solve all those problems know we have been friends for a long time. You told me about solutions with pigs and cats to make sense to me. Well, you know, just because were considered a dog company but we do things with you knowing to cars like that To go outside. I also have two things that we put on our newest GPS system sold to pay executive roam around in the pigs. We don't lay any wire down so were able to use the satellites in the sky just like your GPS when you're putting your car to go somewhere on the coordinates with the collar and it's able to talk to the pet to tell me you can't go calculation with no recalculating gives him a chance to turn around, though for the dogs. It is an anti-Wenger zone so they can have time to turn around in the same like the earth moves into the satellites move but it gets the dogs opportunity to learn or pigs to go and I really want to do about having done a goat yet, but I'd like to know I want to do about future lot of successes that you had with me over the years. Different animals have had great solutions because of invisible fence. What's a great solution you can share with someone when it comes to mind. It's the one I always think of when someone asked me this question by a gal that had MS and was in a wheelchair had two boxers and the one boxer was younger and was a puppy and this dog would literally excited loved his owner, but would jump on her and pushed her wheelchair and she almost ended up going down the steps because of it. So we were able to use one of our little indoor shields and we were able to put it in the backpack on her wheelchair so the dog couldn't jump on her but she was able to retell the dog so the dog was it for baking from her just jumped on her and it was probably one of the most great things that one of the great things that we've done on being able to see the scalp. Keep her dog meant a lot to her and being able to function with her disability and we were able to help. We done a few different ones like that were we've been able to do things on the ninth had folks that have had cancer that literally can't let their dogs outside in order put them on a chain or anything. Were talking about getting rid of their dogs and we been able to make it so that their dogs can have a great life insulting me which is awesome. So how does somebody get a hold of invisible funds Carla Coleman correctly located right.LLC which is actually six to learn more about an visible fence Brand visit invisible fence.com invisible fence friends are told containment and avoiding...]]>257brand,bswithbob,business,cat,containment,dog,doggie,fence,fences,if,invisible,invisiblefence,karla,microcast,pet,pig,toppenfalsefullhttps://www.spreaker.com/episode/e1-jason-boring-travel-hacking-ninja--16269371https://api.spreaker.com/episode/16269371Tue, 20 Nov 2018 17:54:13 +0000Produced by Podcast For HireJason Boring has been traveling around the world for over a decade. He has crossed the country via plane, car, bus, motorcycle, and hitchhiking. Jason has circumnavigated the globe and comes with a wealth of experience in the developing world,629adventure,bob,boring,bswithbob,college,hack,hacking,jason,microcast,ninja,not,plane,presentation,schmidt,speaker,train,travel,travelhackingninja,traveling,travelninjafalsefullhttps://www.spreaker.com/episode/e7-mchugh-excavating-free-estimates-hiring--15811528
expect to be paid something for the time. But just look at a project look at over pencil up some price and give you a proposal. There's no charge for that.

What's the benefit of hiring somebody local rather than getting you know somebody that maybe a few dollars cheaper from another community.

There's not a lot of that in the smaller residential work. Of course there isn't some larger stuff some of the public good kind of stuff. There will be folks from out of town building but you know if you ever have a question or a problem down the road I'm always shoes on the other foot I like to hire somebody local someone I know or somebody that I know knows them and I confident that they'll have a phone if I call them if I have a problem come back take a look at it whether it's going to take additional work or additional advice were raised here locally we're not going anywhere.

McHugh excavating hiring at the moment.

At the moment no color we have added some people this year. And I wouldn't be surprised if we add a few more here.

How does somebody go about applying for a job at McHugh excavating.

Well you can either stop in and ask for me or Steve will send our H.R. director or simpler yet I know a lot of people like to just look online at least for the initial step at our Web site. McHugh excavating that com there is a tab with a simplified version of our application. Click the link when you're done send it into us then we can always talk from there. We do have a more extended application we'd need before we hired someone but a lot of times that first more basic application can save a trip in or at least get you on our radar screen. If you've got a little bit of the type of experience we're looking for or at least start the conversation does McCue excavating work around to some degree. Yes we do have a number of our field employees that end up on winter lay off when work slows down and that varies year to year. The last few years we've had quite a bit of work. So there hasn't been a whole ton of layoff but it really it all depends on the winter. We do somewhat to work if it's available some of our stuff can be done in the winter. So for example a septic system can't be done in the winter. The street projects are tearing up the street you know wouldn't be able to get repaved so that can be done in the winter. But there are things that we do that can be done in the winter and when those opportunities hit at the right time of the year and maybe get started in the early fall and continue on into the winter those winters

a lot of the guys were quite a bit of the winter]]>https://api.spreaker.com/episode/15811528Tue, 13 Nov 2018 00:10:11 +0000Produced by Podcast For HireDean does it costs money to have McHugh excavating come out and give me a bid for a job that will typically come out and you know if it's an hour two of our time just to look over your project and put some numbers together or kind of walk through what...
expect to be paid something for the time. But just look at a project look at over pencil up some price and give you a proposal. There's no charge for that.

What's the benefit of hiring somebody local rather than getting you know somebody that maybe a few dollars cheaper from another community.

There's not a lot of that in the smaller residential work. Of course there isn't some larger stuff some of the public good kind of stuff. There will be folks from out of town building but you know if you ever have a question or a problem down the road I'm always shoes on the other foot I like to hire somebody local someone I know or somebody that I know knows them and I confident that they'll have a phone if I call them if I have a problem come back take a look at it whether it's going to take additional work or additional advice were raised here locally we're not going anywhere.

McHugh excavating hiring at the moment.

At the moment no color we have added some people this year. And I wouldn't be surprised if we add a few more here.

How does somebody go about applying for a job at McHugh excavating.

Well you can either stop in and ask for me or Steve will send our H.R. director or simpler yet I know a lot of people like to just look online at least for the initial step at our Web site. McHugh excavating that com there is a tab with a simplified version of our application. Click the link when you're done send it into us then we can always talk from there. We do have a more extended application we'd need before we hired someone but a lot of times that first more basic application can save a trip in or at least get you on our radar screen. If you've got a little bit of the type of experience we're looking for or at least start the conversation does McCue excavating work around to some degree. Yes we do have a number of our field employees that end up on winter lay off when work slows down and that varies year to year. The last few years we've had quite a bit of work. So there hasn't been a whole ton of layoff but it really it all depends on the winter. We do somewhat to work if it's available some of our stuff can be done in the winter. So for example a septic system can't be done in the winter. The street projects are tearing up the street you know wouldn't be able to get repaved so that can be done in the winter. But there are things that we do that can be done in the winter and when those opportunities hit at the right time of the year and maybe get started in the early fall and continue on into the winter those winters

a lot of the guys were quite a bit of the winter]]>246falsefullhttps://www.spreaker.com/episode/e5-bill-temte-making-forts-small-houses-northside-pride--15803016
WELL A friend of mine who lived over on the next street came to me for some reason we got the argument for something and I don't remember what it was.

He got so mad and he took a swing and he hit me in the head and it hurt his hand so bad that he had to go into the host haven't taken care of and he came out. I won't say crying but you know we whimpering because it still hurts so bad apologized for getting so bad and stuff.

Halloween trick or treating. We go on and never do dare. We knew there was nothing we'd be always be careful that we didn't do any damage to anything but we would make it known that we were there and. Maybe throw some toilet paper into the tree or something like that. I was amazed. I don't remember ever. Being with a bunch of guys were damaging something was one of us. The thing to do.

One time one of the streets was being repaired and there's all kinds of cement blocks and stuff. It was Halloween again and it was a side street. So we went out and made a barricade in the middle of it with the stick with the building materials you know if the car had to get around they could and we decorated it so the body would hit it.

So you kind of made you made a snow fort out of a building materials.

What are some other memories you have like that having a baseball and of course the baseball cards softball excuse me feel that the old Franklin but the diamond was here in right field was the principal's office on the second floor and the goal was who could get it far enough and high enough to put out one of the windows.

I was going to say Did anybody ever get anybody get a rack.

But it was one of those you know things that laughable don't get a kick about.

And we actually let her know that that was kind of a fun thing and she's oil is big enough and strong enough to have a ball she knew they would. And.

You know another memory I have is north of KMag. If you go a few miles north there's an old Norwegian church there that still does it really do to Fisks supper or dinner. I don't know if they still do. One time my two brothers guy and another couple people went up there sat at the table and looked around. And here is the elementary school teachers. I'll give one name that a concerned member my Zanders third grade wonderful and wonderful lady that loved every one of us and we all loved her. But she was also a wonderful teacher. But I don't remember the names of the other. But there was either four or five of them sitting there and we sat there and just had the most fun time talking about schooling at Franklin and eating Fisk Yeah you were one of them finally said My brother was sitting on the start on the sidewalk. And when he says to the waiter would you mind stirring the plate here. So it ends up there because no one ever gets by him.

That's the uniform in which appearance.

So we talked a little earlier about the the little houses and how the house you grew up in.

It's had a couple of different expansions if you will over the years. Could you imagine a family nowadays living into a house basically the size of the room that we're in right now.

No. It had a total of six hundred twenty square feet and one bathroom that also was the laundry room and other things. And they had one sink a shower and a stool. That was the toilet Lowe's kitchen which was half as big as this room. And that's where we eat also. And then two small bedrooms each one about two thirds the size of this room. And then the other was open area which was just a general living space. And then when I guess they got their first TV like it was out of the service and came back. I told the story about the fake TV stories that you know we just lived in and I don't mean the TMT family but we because I think I see I've shared this now with others that live didn't have a bead yet you know six square block area that I lived in. We lived a happy life.

Well first barbershop.

OK. That if you looked out my front window he was in the building right over there and we'd sit there and say Burr's barbershop membership because they have sat in the front of it. That would be nice. They would say that and it was a wonderful place a good place where people would hang the old waiting for their haircuts cause sunburn can garments were there and they were the barbers in almost every athletic team in the West know whatever would come in there for their haircuts. So they look great cool and then all all member the old folks and let him cut his hair. But there's another one down in the corner of the tavern is now where barbershops back in those days kind of territorial.

So you always went to bars and somebody always went to John sales and somebody I went to Smitty's and stuff like that.

You had your barber shop and frankly your barber and you know you mentioned before on George Street. That was the mind of the tavern's from Reon Sam's on the north down to Paris barbershop there's a tavern there now and he was there and then there's the whole building now.

And then the North Star the WW. And I can't think of the name of the other one but they weren't drunken places. There were places where people they had their their bar that they go and sit and talk and have a beer or two you know and that sort of thing. Do you remember your first beer. He was at the WWE tavern and just a very very small class and he was one I said when I'd go over there on a new year's eve and Christmas Eve also but New Year's Eve because Trinity Lutheran those days had a watch service at 11 to 12 Michael so I'd go pick up the in the tenor section at the w w we go down there and go on and one time they said here you deserve one. And you know just the littlest. Oh I know. All three owns classes like this and I don't know that he. Drank it all and they all got a kick out of it.

And a nice glass of Pepsi Pepsi would have them because I know we were on the Pepsi side of the Pepsi Coke for other than the north side of lacross called Just lacross or was it called Southside or was well what was the name of South of North lacross. Well we called it the south side on the north side but it was all the city of the cross and that.

We have heard crowd er side as they were this house I don't mean to put them down or anything but the south side was just spread so far. I can't remember the name of the man who developed what was the village shopping center before he developed that. If you drove up way back in the back corner about where the central football field is.

There was a small restaurant that was as far south as the Cross went.

Basically you know there were some housing and stuff but the that Evoque area ended there and then I can think of the man's name but he then the vote the village shopping centre which created a lot of other development and then the hoses that are south of there particularly on the east side were developed by a developer and he was basically copying the houses that were built up in Minneapolis. He may even come from there. I don't look at them when I used to do the history that I don't remember all that much but that's why so many of them look very much alike. Is that way the North Side is sometimes considered like Old Town and Old Town north because it was the where basically the Cross started and kind of spread out from here well there and the immediate downtown area you know Cass Street King Street Market Street and that sort of thing from there. Yeah there was there that was really the original lacross and the the rich. Don't tell anybody not to ask there was that the original among the patrons were there all of their homes the big ones and chaos and King those buying mansions.

That's where they lived were you ever friends with people from.

You mentioned Onalaska so like Onalaska or Kusum his cousin's mother and uncle he didn't work at the brewery and he'd ride in there and stuff and he died like my father at a very young age. He's my father's brother but the air telephone operation from Alaska was in their living room it was all very small it was just a very very small community all the way through the the fifties kind of a troublemaker.

It's a bit I'm a person who loves to put ideas out there and maybe even get people to think about things]]>https://api.spreaker.com/episode/15803016Sat, 10 Nov 2018 22:45:19 +0000Produced by Podcast For HireWere you guys are hooligans. WELL A friend of mine who lived over on the next street came to me for some reason we got the argument for something and I don't remember what it was. He got so mad and he took a swing and he hit me in the head and it...
WELL A friend of mine who lived over on the next street came to me for some reason we got the argument for something and I don't remember what it was.

He got so mad and he took a swing and he hit me in the head and it hurt his hand so bad that he had to go into the host haven't taken care of and he came out. I won't say crying but you know we whimpering because it still hurts so bad apologized for getting so bad and stuff.

Halloween trick or treating. We go on and never do dare. We knew there was nothing we'd be always be careful that we didn't do any damage to anything but we would make it known that we were there and. Maybe throw some toilet paper into the tree or something like that. I was amazed. I don't remember ever. Being with a bunch of guys were damaging something was one of us. The thing to do.

One time one of the streets was being repaired and there's all kinds of cement blocks and stuff. It was Halloween again and it was a side street. So we went out and made a barricade in the middle of it with the stick with the building materials you know if the car had to get around they could and we decorated it so the body would hit it.

So you kind of made you made a snow fort out of a building materials.

What are some other memories you have like that having a baseball and of course the baseball cards softball excuse me feel that the old Franklin but the diamond was here in right field was the principal's office on the second floor and the goal was who could get it far enough and high enough to put out one of the windows.

I was going to say Did anybody ever get anybody get a rack.

But it was one of those you know things that laughable don't get a kick about.

And we actually let her know that that was kind of a fun thing and she's oil is big enough and strong enough to have a ball she knew they would. And.

You know another memory I have is north of KMag. If you go a few miles north there's an old Norwegian church there that still does it really do to Fisks supper or dinner. I don't know if they still do. One time my two brothers guy and another couple people went up there sat at the table and looked around. And here is the elementary school teachers. I'll give one name that a concerned member my Zanders third grade wonderful and wonderful lady that loved every one of us and we all loved her. But she was also a wonderful teacher. But I don't remember the names of the other. But there was either four or five of them sitting there and we sat there and just had the most fun time talking about schooling at Franklin and eating Fisk Yeah you were one of them finally said My brother was sitting on the start on the sidewalk. And when he says to the waiter would you mind stirring the plate here. So it ends up there because no one ever gets by him.

That's the uniform in which appearance.

So we talked a little earlier about the the little houses and how the house you grew up in.

It's had a couple of different expansions if you will over the years. Could you imagine a family nowadays living into a house basically the size of the room that we're in right now.

No. It had a total of six hundred twenty square feet and one bathroom that also was the laundry room and other things. And they had one sink a shower and a stool. That was the toilet Lowe's kitchen which was half as big as this room. And that's where we eat also. And then two small bedrooms each one about two thirds the size of this room. And then the other was open area which was just a general living space. And then when I guess they got their first TV like it was out of the service and came back. I told the story about the fake TV stories that you know we just lived in and I don't mean the TMT family but we because I think I see I've shared this now with others that live didn't have a bead yet you...]]>720falsefullhttps://www.spreaker.com/episode/e5-masters-services-chimney-chad-what-can-we-burn--15793554
Everything's OK to burn in your fireplace except for wax candles as long as you get it inspected and if it necessarily clean every year.

Do people call you when they're buying a house or moving into a different house because they want to see if the chimney is is is workable and usable.

Absolutely. For many realtors or be referred by many home inspectors to have a fireplace properly inspected due to their moving in or moving out. We're doing we're doing the functionality of a fireplace chimney.

Chad why would somebody use an easy carry insta great rather than buying the big old you know old school grade that I remember my parents and my grandparents had in their fireplaces.

Well the easy carry integrate as it informs in its name was developed for the chimney sweep so they could offer a great to the people of the public so they don't have to go to a big box store to buy a great it's ready for them to burn as soon as we leave.

Nor are they something that needs to be replaced very often.

Definitely a question about how much you burn and what you burn on it. So the more you burn the more the. Well I mean it's a piece of metal. No matter if you buy a big a big one little one it's all going to depending on how thick it is and how much you burn.

I know that you talked in the past about being a certified chimney technician. What makes you different than you know Joe Schmo from down the street that goes ahead cleans chimneys.

I'm not just a certified Sumii technician I'm a certified master technician. I've been certified for 14 years. Got my master's. And you've gone through all the steps to prove that you actually are proficient in what you're what you're inspecting fixing and repairing and you've proven that you know what you're doing by taking a path that is not required by the states to take. But it is absolutely a valuable task to take to prove that you know what you're doing in a fireplace in the street. We are the most reviewed chimney company that I'm aware of in the country we're four point eight rated Google readings with the most reviews in Dallas Texas. And as for home adviser were the most reviewed company that they have in the chimney the fireplace industry in the country. It is.]]>https://api.spreaker.com/episode/15793554Mon, 05 Nov 2018 18:45:13 +0000Produced by Podcast For HireI know that a lot of big box stores. I mean heck you can buy them almost anywhere nowadays even the grocery store has those. You like Deira flame type logs and things like that are those good are safe to burn in your fireplace. Everything's OK to...
Everything's OK to burn in your fireplace except for wax candles as long as you get it inspected and if it necessarily clean every year.

Do people call you when they're buying a house or moving into a different house because they want to see if the chimney is is is workable and usable.

Absolutely. For many realtors or be referred by many home inspectors to have a fireplace properly inspected due to their moving in or moving out. We're doing we're doing the functionality of a fireplace chimney.

Chad why would somebody use an easy carry insta great rather than buying the big old you know old school grade that I remember my parents and my grandparents had in their fireplaces.

Well the easy carry integrate as it informs in its name was developed for the chimney sweep so they could offer a great to the people of the public so they don't have to go to a big box store to buy a great it's ready for them to burn as soon as we leave.

Nor are they something that needs to be replaced very often.

Definitely a question about how much you burn and what you burn on it. So the more you burn the more the. Well I mean it's a piece of metal. No matter if you buy a big a big one little one it's all going to depending on how thick it is and how much you burn.

I know that you talked in the past about being a certified chimney technician. What makes you different than you know Joe Schmo from down the street that goes ahead cleans chimneys.

I'm not just a certified Sumii technician I'm a certified master technician. I've been certified for 14 years. Got my master's. And you've gone through all the steps to prove that you actually are proficient in what you're what you're inspecting fixing and repairing and you've proven that you know what you're doing by taking a path that is not required by the states to take. But it is absolutely a valuable task to take to prove that you know what you're doing in a fireplace in the street. We are the most reviewed chimney company that I'm aware of in the country we're four point eight rated Google readings with the most reviews in Dallas Texas. And as for home adviser were the most reviewed company that they have in the chimney the fireplace industry in the country. It is.]]>191bswithbob,chad,chimney,chimneychad,chimneysweep,clean,dallad,fire,flu,fortworth,masters,mastersservices,microcast,podcast,services,sweepfalsefullhttps://www.spreaker.com/episode/e5-eco-gardens-by-washburn-llc-podcast--15940740
L'autre is a big issue. We're still going to be watering omelets every day even though we just got about how many inches of rain in our area. I know it sounds crazy to keep watering your plants but they need that healthy drink specially evergreen all your woody shrub that you've just planted. Although this is a really good time to plant pride it isn't ready for the changing season. Some people like to cut down their native grasses or they like to prune things to the ground right now which is OK but in my mind I like to leave them up until spring. Just because they're beneficial live in there and when I say beneficials I mean beneficial insects and it also gives our other beneficial like pollinators. Even a mouse can be a pollinator. Believe it or not. So you've given them habitat over the winter and you're in your ornamental grasses. If you have time in the spring to wait I say wait but otherwise even your plants a good mulching perhaps with some leaves that you collected or some straws or even some grass put in weed free of course and then you can remove that lots when spring time comes. So what you're doing is essentially your mulching your going to protect them.

So do we want to add the grass then to our garden. After we pull over. So in my example I've got my garden that I've got planted I've got tomatoes and peppers and squash. And I think that's all I have.

Oh and cucumbers this year. So do I want to hold those plants up and then kill off everything that's do I want to Roundup them. Everything that didn't get pulled up because there's a lot of weeds this year.

No definitely yes. Pull out your vegetable plants that are no longer producing fruit and you can eat them into the ground. If they don't have any disease issues. Otherwise you can put them in your yard. We've been an island to the site or put them wherever you put them. I would not roundup anything because basically you're kind of just wasting roundup simply because if you're going to plant in there and you're putting it to bed many of those are annual weeds and they won't come back next season until perhaps the weed seeds get stirred up again by Rodo chilling or just simply by blowing in your garden and growing in optimal temps. Definitely pulling out your plants and in fact if you wanted to introduce more nitrogen into your soil you could plant to cover crop. Some people plant a rye grass. Some people plants LCL from those types of things that you can just plant the winter cover crops.

So like I said if the nitrogen back into your soil which your plant or vegetable plants need so if you just if you end up just pulling them and now planting that can you put grass clippings over the top of that or like you mentioned leaves submental that'll also help with the nitrogen put it back into your for soil absolutely cover your whole garden with deadly away from disease.

Or quirk sample maple trees have a disease called Parisot and although that is cosmetic to the tree meaning that it doesn't hurt the tree it's just something that happens and the only way you can really get rid of it is by removing the leaves from the site that if you leave in your garden you are actually spreading the car but not you just want to sprinkle that on top or you want the upset him. I would just let it lay on top if you run a rototiller right now. You could otherwise I just wait till frame and let it naturally decompose on its own. But also when you are using the rototiller You are disturbing the soil underneath your feet and there's a lot of good microbes and microorganisms down there that are doing their job and when you disturb them. Some people call it organic farming or organic gardening. If you're using a rototiller instead of a broad fork you deserve the soil so much more. And basically you're working against yourself.]]>https://api.spreaker.com/episode/15940740Fri, 26 Oct 2018 21:20:02 +0000Produced by Podcast For HireAs we start changing seasons here in the upper Midwest sir Washburn of course from Eagle gardens by Washburn. My biggest question right now yes is what do we do in order to get our gardens ready for the last harvest or for you know putting it away for...
L'autre is a big issue. We're still going to be watering omelets every day even though we just got about how many inches of rain in our area. I know it sounds crazy to keep watering your plants but they need that healthy drink specially evergreen all your woody shrub that you've just planted. Although this is a really good time to plant pride it isn't ready for the changing season. Some people like to cut down their native grasses or they like to prune things to the ground right now which is OK but in my mind I like to leave them up until spring. Just because they're beneficial live in there and when I say beneficials I mean beneficial insects and it also gives our other beneficial like pollinators. Even a mouse can be a pollinator. Believe it or not. So you've given them habitat over the winter and you're in your ornamental grasses. If you have time in the spring to wait I say wait but otherwise even your plants a good mulching perhaps with some leaves that you collected or some straws or even some grass put in weed free of course and then you can remove that lots when spring time comes. So what you're doing is essentially your mulching your going to protect them.

So do we want to add the grass then to our garden. After we pull over. So in my example I've got my garden that I've got planted I've got tomatoes and peppers and squash. And I think that's all I have.

Oh and cucumbers this year. So do I want to hold those plants up and then kill off everything that's do I want to Roundup them. Everything that didn't get pulled up because there's a lot of weeds this year.

No definitely yes. Pull out your vegetable plants that are no longer producing fruit and you can eat them into the ground. If they don't have any disease issues. Otherwise you can put them in your yard. We've been an island to the site or put them wherever you put them. I would not roundup anything because basically you're kind of just wasting roundup simply because if you're going to plant in there and you're putting it to bed many of those are annual weeds and they won't come back next season until perhaps the weed seeds get stirred up again by Rodo chilling or just simply by blowing in your garden and growing in optimal temps. Definitely pulling out your plants and in fact if you wanted to introduce more nitrogen into your soil you could plant to cover crop. Some people plant a rye grass. Some people plants LCL from those types of things that you can just plant the winter cover crops.

So like I said if the nitrogen back into your soil which your plant or vegetable plants need so if you just if you end up just pulling them and now planting that can you put grass clippings over the top of that or like you mentioned leaves submental that'll also help with the nitrogen put it back into your for soil absolutely cover your whole garden with deadly away from disease.

Or quirk sample maple trees have a disease called Parisot and although that is cosmetic to the tree meaning that it doesn't hurt the tree it's just something that happens and the only way you can really get rid of it is by removing the leaves from the site that if you leave in your garden you are actually spreading the car but not you just want to sprinkle that on top or you want the upset him. I would just let it lay on top if you run a rototiller right now. You could otherwise I just wait till frame and let it naturally decompose on its own. But also when you are using the rototiller You are disturbing the soil underneath your feet and there's a lot of good microbes and microorganisms down there that are doing their job and when you disturb them. Some people call it organic...]]>293bob,bswithbob,crop,eco,ecogardens,ecogardensbywashburn,garden,lacrosse,microcast,mulch,planting,pulling,roundup,sara,schmidt,washburn,weeds,winterfalsefullhttps://www.spreaker.com/episode/e1-1-word-chris-jones-change--16002787https://api.spreaker.com/episode/16002787Tue, 23 Oct 2018 17:00:31 +0000Produced by Podcast For HireDream Big Dreams - In Episode 1 of the One Word Chris Jones Micro-cast Chris talks about meeting Senator Barack Obama, his appearance on America’s Got Talent when he made the impossible happen: Known germaphobe Howie Mandel shook hands, we talked...950barack,change,chicago,chris,double,doubletake,howiemandel,hypnotist,hypnotized,jones,marriage,obama,oneword,onewordchrisjones,social,take,teachingfalsefullhttps://www.spreaker.com/episode/e6-mchugh-excavating-why-hire-do-yourself--15811498
Well Tyler our goal to help our customers find a solution to their problem and to do the job right the first time.

Is it hard to come up with a solution.

Well it depends. You know sometimes what one thinks might be the solution there might be something else that works better. Some of our guys with variety and years of experience might have something to propose that might work a little bit better than what was being thought of or at least throw a couple options out there in front of the customer. This this probably will take care of your problem but maybe your problem could come up again in the future or this is kind of an overboard solution. But if you do it this way and have the extra money in your budget spend you probably can cover yourself to you know make Will. Heck look at what we've been experiencing here in the last few weeks here with the rain. You know you can't you can't predict some of these events and some of these events wipe out you know stuff lose engineered for 100 year flood. You know sometimes even a 2 or 3 inch rainfall can wreak havoc on something. Sometimes customer might say. Yes for peace of mind. You know I want to go with a little bit more expensive solution because I've got a lot more confidence that that isn't going to get knocked out in unexpected weather event.

Well I'm guessing too that sometimes those more expensive fixes may not even be that much more expensive because you know what you're supposed to do and how to do it and you can come up with a better solution based on your knowledge compared to what the customer knows that a lot of times it isn't that much more to go to a different solution.

Or sometimes we have a cheaper solution to what was being thought of to better customers love to see that.

So it's a benefit of hiring McHugh excavating over hiring do it myself.

Well a lot of times I've been there myself with home to take projects something looks like I can handle it on a weekend maybe go to the home improvement store and grab a couple of things when I get to do it through Project and wish I would have never opened it up. Sometimes you don't anticipate what we're going to run into hiring us and our expertise usually can save you a lot of headaches of maybe having to go ahead and call someone after you try it first.

I'm guessing everybody listening has probably had some of those projects themselves where they're like oh yeah I can replace that or yeah I can I can I can put that up on there.

Yeah.

It's probably better to call somebody that knows what they're doing you know and some people have access to smaller equipment like maybe a bobcat on the farm or a brother or an uncle or somebody and you know sometimes that stuff works out just fine too. And I've had situations where I'll tell some you know I had a situation actually in the spring where I knew back in high school. He called about his daughter's place called was washed out. I looked at a game of price and he says Well jeez you know I have access to a bobcat and I can put my own time and I can go buy the culvert locally here and I said Yeah you know this is a pretty simple job I don't think you're going to go wrong there. So we'll tell you you know we'll tell you whether we think you could get yourself in trouble or if you have the access to the equipment and either yourself or someone else says a little bit of expertise. We'll just tell you if we think you should go ahead. You know we think it's something that you can handle and be fine.]]>https://api.spreaker.com/episode/15811498Fri, 12 Oct 2018 23:10:49 +0000Produced by Podcast For HireWhy should somebody hire McHugh excavating. Well Tyler our goal to help our customers find a solution to their problem and to do the job right the first time. Is it hard to come up with a solution. Well it depends. You know sometimes what one...
Well Tyler our goal to help our customers find a solution to their problem and to do the job right the first time.

Is it hard to come up with a solution.

Well it depends. You know sometimes what one thinks might be the solution there might be something else that works better. Some of our guys with variety and years of experience might have something to propose that might work a little bit better than what was being thought of or at least throw a couple options out there in front of the customer. This this probably will take care of your problem but maybe your problem could come up again in the future or this is kind of an overboard solution. But if you do it this way and have the extra money in your budget spend you probably can cover yourself to you know make Will. Heck look at what we've been experiencing here in the last few weeks here with the rain. You know you can't you can't predict some of these events and some of these events wipe out you know stuff lose engineered for 100 year flood. You know sometimes even a 2 or 3 inch rainfall can wreak havoc on something. Sometimes customer might say. Yes for peace of mind. You know I want to go with a little bit more expensive solution because I've got a lot more confidence that that isn't going to get knocked out in unexpected weather event.

Well I'm guessing too that sometimes those more expensive fixes may not even be that much more expensive because you know what you're supposed to do and how to do it and you can come up with a better solution based on your knowledge compared to what the customer knows that a lot of times it isn't that much more to go to a different solution.

Or sometimes we have a cheaper solution to what was being thought of to better customers love to see that.

So it's a benefit of hiring McHugh excavating over hiring do it myself.

Well a lot of times I've been there myself with home to take projects something looks like I can handle it on a weekend maybe go to the home improvement store and grab a couple of things when I get to do it through Project and wish I would have never opened it up. Sometimes you don't anticipate what we're going to run into hiring us and our expertise usually can save you a lot of headaches of maybe having to go ahead and call someone after you try it first.

I'm guessing everybody listening has probably had some of those projects themselves where they're like oh yeah I can replace that or yeah I can I can I can put that up on there.

Yeah.

It's probably better to call somebody that knows what they're doing you know and some people have access to smaller equipment like maybe a bobcat on the farm or a brother or an uncle or somebody and you know sometimes that stuff works out just fine too. And I've had situations where I'll tell some you know I had a situation actually in the spring where I knew back in high school. He called about his daughter's place called was washed out. I looked at a game of price and he says Well jeez you know I have access to a bobcat and I can put my own time and I can go buy the culvert locally here and I said Yeah you know this is a pretty simple job I don't think you're going to go wrong there. So we'll tell you you know we'll tell you whether we think you could get yourself in trouble or if you have the access to the equipment and either yourself or someone else says a little bit of expertise. We'll just tell you if we think you should go ahead. You know we think it's something that you can handle and be fine.]]>268falsefullhttps://www.spreaker.com/episode/e4-bill-temte-kids-stuff-old-store-hockey-trolly--15798684
So cars were not the norm at all and rode the bus or the streetcar actually.

Let's talk about the streetcars because I moved across in 1992 and they were long gone for before I moved here.

When did they kind of fall out of favor.

Well they didn't fall out of favor so much as they simply replaced Barry their technology and a bus system and that sort of thing but they were the lifeblood kind of all of us landed on our side because I was the one who made a big circle and one side of that circle was right up George Street and George Street can be accessed from the east and west and the other one I think went up Lumas street to prospect one of those anyway and made a big loop there and came back to George Street.

There was a little hose on the corner with a flat roof.

That's thing I really can remember that house is still there but it's been updated with more space than a regular roof and everything but that's where it made the turn to go south again. Very little was north of that of that time because all letch Shopko Bay Area thing that's created much much much later. But people walk like I said earlier you know in the morning all of the workers at the electric light it looked like the lemmings heading to the sea. Let's talk about the downtown area the north side downtown because now it's kind of considered like Caledonia's street and stuff as it always has always been the case the downtown there is a men's store and a shoe store on the Riviera Theatre and of course the sweet shop and the St. James Catholic Church. And you know a lot of other things there. There's a women's store that was still there when we came back from a military which would have been in 1960 a number of stores are still there. The men's store and McCann's and a shoe store Klinkner and Jenssen. None of us sir anymore. So but you know didn't have to go downtown to shop. We had basically whatever you needed right there on the Caledonia's street. And then there were a few other shops like on George Street. There was a shoe stop in a hardware store that sold a variety of things right across the street kind of from my dad's grocery store and a few other small stores. The buildings are there but the stores aren't there anymore.

Right. What was there to do for teenagers.

The sweetshop turps restaurant where the old Logan was the tennis courts and athletic fields were just to the south of it. But then right on nextstep street Terpstra had the cafeteria and police were kids at the nurse doing well come in sit around have a soda have a dish of ice cream or whatever and hang out and talk. And then there was the sweet shop and walking down the sweetshop was a we didn't go to the main door because there was a restaurant and the sweet shop welcomed us to just go in there hang out get the booze talk and have a loose end.

And then of course being neighborhoods like in the summertime we had a continual bowl game softball game going.

Could you see kids nowadays. Bell actually living the simple life like you did when you were a kid.

No frankly on that simple life left the South Side much earlier simply because the more involved things to do because of the university being there and the the campus school and the terrible with the women's kinds of things and other institutions. Well you the vocational school had that big auditorium and stuff. So there's a lot of things going on there and being a vocational school was a welcoming place. As for. You know youth to go.

Now a lot of times when I watch some of the old school TV shows or you know even like a Lawrence Welk when I was a kid there was you know people that were out there dancing and things like that was there a place or a dance hall or you know a get together for teenagers or maybe between teenager years and being married years wrote.

Hey the schools have with the called the jive high school had a very very good swing band and Friday nights are Saturdays when they're here at Central and Logan.

There was a dance and you'd go and dance and walk around. They were always looking ahead at me because we had that big Jim and it was in the gym and in your room. So the swimming would be set up in the balcony and when.

And the dance floor. And if you were dancing you were with somebody or a guy or gal just walking the pruner this drink and maybe singing.

And there's just a whole different life so similar to like watching some of those Ginger Rogers movies and things like that when they're actually singing and dancing.

I mean the world really was that way back in the day the rose colored glasses were always on the up.

And it was it was wonderful and rehearsed is a word I've used several times. We used to ride our bikes by the way everywhere and we go climb the bluff third by Gillette's roots up. We just ride on a bunch of Gillette's street leaning over against the tree at the base of the bluff KwaNdebele of all day and snow come back down right back in the late 40s or 50s. I don't remember ever worrying about having their Breakstone was your crime back then that you remember the crime.

Yeah it did. It read it could be like a dead woman for instance. Stores weren't rude about shoplifting and stuff because there's immorality in the people also about right and wrong and to shoplift something wouldn't hinder some of that.

I wonder if there is a fear of that of the mom and dad. Because I remember one night when I was a kid I remember taking a candy bar. I got spanked. A stand in the corner. I had to bring the candy bar back and tell the guy that I took it and I think he made me work too. Nowadays I don't think kids have the fear of their parents.

No you are. Well because parents haven't said you don't intimidate your children you'll be nice to your children.

You never touch them emotionally or physically. And so there's no discipline that really works anymore. But if you're a good writer and family discipline and I can remember I'd walk by my grandma and grandpa house and go in there and there was share with them that I don't remember it bad but them cure I remembered as caring about me.

Right. So anyway but you get it right in the head of the way. Yes.

Let's talk about some of the other businesses what are some of the businesses that you remember that used to be there that are no longer around.

Well like I said there was Kyung on your street. I don't remember the name of the women's store but it was on the corner of Caledonia and I'm quite sure on the other end the department store. And then a shoe store coming to them and they were there when Quittner and Johnson and the McCann MEND's.

OK. What about your your your father's grocery store. I know that you said in one of the previous podcasts that he had passed on and your mom ranted after that. What happened to the story eventually.

Well he an electrician was a big electrical contracting business on the north side. He wanted to he moved his business and that sort of thing because there were story Jotan back and all that and he had my mom run the office. After that I went into nothing to remember. But no it's really that big.

They didn't. It's a haircutting Siliguri and it takes up what was a store and was the vacant lot.

So did the store shell get torn down to build that build what's there now. Because I know that the house you grew up in is still there. So there now is that the same look that that house had from the front.

But if you go down the alley it's been handed down and you know there's no yard anymore. In fact we used to have a swimming pool. My dad had when me not a concrete.

That was about three feet deep at its deepest to a Schallert two feet and you're still bleeding. And then in the wintertime we'd have a hockey rink skating rink out there. And that what we call the vacant lot. I mentioned there time about the little hole it was there. Well in that there was a whole city a lot from the street all the way to the alley and a good part of that was vacant. In front there wasn't a basement area in front of that was what would have been going on for that whole set burned down many many years ago. And behind it the backyard is where we have our hockey rink and on the very end of it our swimming pool not just all the friends in the neighborhood would come over and skate play hockey. And of course in those days the goods were brought in wire baskets of lettuce and. And what we do is we take two of those and make those goals for the hockey rink.]]>https://api.spreaker.com/episode/15798684Wed, 10 Oct 2018 21:45:05 +0000Produced by Podcast For HireYou know I said that we didn't have a car and many of the neighbors didn't and all the people that did they just sat in the garage 90 percent of the time and the number of people that I have oh we didn't have a car. No. People my age 75 to 80 in that...
So cars were not the norm at all and rode the bus or the streetcar actually.

Let's talk about the streetcars because I moved across in 1992 and they were long gone for before I moved here.

When did they kind of fall out of favor.

Well they didn't fall out of favor so much as they simply replaced Barry their technology and a bus system and that sort of thing but they were the lifeblood kind of all of us landed on our side because I was the one who made a big circle and one side of that circle was right up George Street and George Street can be accessed from the east and west and the other one I think went up Lumas street to prospect one of those anyway and made a big loop there and came back to George Street.

There was a little hose on the corner with a flat roof.

That's thing I really can remember that house is still there but it's been updated with more space than a regular roof and everything but that's where it made the turn to go south again. Very little was north of that of that time because all letch Shopko Bay Area thing that's created much much much later. But people walk like I said earlier you know in the morning all of the workers at the electric light it looked like the lemmings heading to the sea. Let's talk about the downtown area the north side downtown because now it's kind of considered like Caledonia's street and stuff as it always has always been the case the downtown there is a men's store and a shoe store on the Riviera Theatre and of course the sweet shop and the St. James Catholic Church. And you know a lot of other things there. There's a women's store that was still there when we came back from a military which would have been in 1960 a number of stores are still there. The men's store and McCann's and a shoe store Klinkner and Jenssen. None of us sir anymore. So but you know didn't have to go downtown to shop. We had basically whatever you needed right there on the Caledonia's street. And then there were a few other shops like on George Street. There was a shoe stop in a hardware store that sold a variety of things right across the street kind of from my dad's grocery store and a few other small stores. The buildings are there but the stores aren't there anymore.

Right. What was there to do for teenagers.

The sweetshop turps restaurant where the old Logan was the tennis courts and athletic fields were just to the south of it. But then right on nextstep street Terpstra had the cafeteria and police were kids at the nurse doing well come in sit around have a soda have a dish of ice cream or whatever and hang out and talk. And then there was the sweet shop and walking down the sweetshop was a we didn't go to the main door because there was a restaurant and the sweet shop welcomed us to just go in there hang out get the booze talk and have a loose end.

And then of course being neighborhoods like in the summertime we had a continual bowl game softball game going.

Could you see kids nowadays. Bell actually living the simple life like you did when you were a kid.

No frankly on that simple life left the South Side much earlier simply because the more involved things to do because of the university being there and the the campus school and the terrible with the women's kinds of things and other institutions. Well you the vocational school had that big auditorium and stuff. So there's a lot of things going on there and being a vocational school was a welcoming place. As for. You know youth to go.

Now a lot of times when I watch some of the old school TV shows or you know even like a Lawrence Welk when I was a kid there was you...]]>715falsefullhttps://www.spreaker.com/episode/e4-masters-services-chimney-chad-inserts--15793615
You know you just hit on something I didn't even know that you guys did. So you see you guys actually help install gas fire logs and gas fireplaces like inserts.

We were just getting into the interior part of it when it comes into the GasLog side of it you know just putting gas jugs in that would bring fireplace from one of the top sellers in taxes of GasLog.

Explain to me what a difference between an insert and a GasLog is.

Gas hogs are just like wood putting in your fireplace that function like that would that look like a real burning fire an insert is an actual fireplace that is placed into a hole in the wall that is your fireplace looking at it inside like a wood stove scenario but yeah that's the sense you can put a woodstoves freestanding where you can put a wood stove inside of a fireplace right. So then there are electric ones there's you know there's gas ones there's propane ones whatever. So but gas logs are well go on my Web site Masters services thats 2 s’s in the middle.]]>https://api.spreaker.com/episode/15793615Fri, 05 Oct 2018 17:45:03 +0000Produced by Podcast For HireI do love my business. I do love the business. I love the people. Some of the special things I love doing about our business. I love putting GasLog in and watching people's face light up when they see all realistic and how easy it is to burn a fire at...
You know you just hit on something I didn't even know that you guys did. So you see you guys actually help install gas fire logs and gas fireplaces like inserts.

We were just getting into the interior part of it when it comes into the GasLog side of it you know just putting gas jugs in that would bring fireplace from one of the top sellers in taxes of GasLog.

Explain to me what a difference between an insert and a GasLog is.

Gas hogs are just like wood putting in your fireplace that function like that would that look like a real burning fire an insert is an actual fireplace that is placed into a hole in the wall that is your fireplace looking at it inside like a wood stove scenario but yeah that's the sense you can put a woodstoves freestanding where you can put a wood stove inside of a fireplace right. So then there are electric ones there's you know there's gas ones there's propane ones whatever. So but gas logs are well go on my Web site Masters services thats 2 s’s in the middle.]]>125bswithbob,chad,chimney,chimneychad,chimneysweep,clean,dallas,fire,fireplace,fortworth,gas,log,microcast,place,podcast,sweep,texasfalsefullhttps://www.spreaker.com/episode/e4-eco-gardens-by-washburn-llc-podcast--15136277
I think so Bob especially with all the oxygen that the plant will give up for your pet rock I think it will be much more helpful.

Let's walk through what is your plosives of Gardens our butterfly garden. Are you planting plants to make butterflies come into my yard.

Yes we will be planting plump milkweed or Rose milkweed brings and attract butterflies into your yard into your landscape. And so you can be sitting on your patio or just looking out your kitchen windows. Oh my gosh look at that beautiful butterfly and be mesmerized. And that's also going to help enhance the pollinator action in your landscape too. What about a rain garden also known as bio retention. I think more in a residential landscape. We say rain Gardens and then commercial since there's larger properties we call those bio retention rain Gardens are going to help aid in the retention of the water that is going to leave your property if you don't have a rain garden and does that rain garden is going to act as a retention pond.

But a quickly dissipating retention on rain garden you can have trees and there you can have ornamental grasses you have native plantings you can have shrubs. Basically what we want that rain garden to do is collect that water and then quickly dissipated. Green Gardens are not your mosquito Haven.

That's a good thing you know. Pollinator Garden is something that brings in the bees so you can help with the bee population.

Yep exactly. Pollinator Gardens also bring in our hummingbirds and our butterflies and our moth and our other beneficial insect though not just bees and things but you're on the right track. I mean we all like to eat right. Need pollinators.

That's true. Well that kind of slides into the next one and the next have a garden instead of Gardens it says edible landscaping what do you mean by that edible landscaping.

If you're going to be outside in your yard and you're hungry something as simple as a raspberry hedgerows or something. We've got fruit trees we can plant we have shrubs we can plant we have like a service berry tree that gives a berries for wildlife but that gives the berries for jams and jellies.

We can make some wine out of a Ronia shrubs.

Oh goodness edible landscaping dual purpose you know producing fruit or vegetable type.

So just basically making stuff edible so that way we can enjoy our garden by not only visually but also tastefully as well. Finally rock Gardens as I mentioned at the beginning that I've got a pet rock and I really I really do have one that I bought was kind of funny but what what really is a rock garden rock garden that's more of a Zero Escape feature and when I say Zero Escape that's felt an act like the rocks there.

So very very very drought tolerant used in places where people don't necessarily want to or maybe they can't mould or maybe they just don't want that much maintenance. So think of something maybe on a hillside or maybe you know you can even have a rock garden is introduction to your rain garden something that provides quite a bit of colour but also is very easy to maintain.]]>https://api.spreaker.com/episode/15136277Wed, 26 Sep 2018 21:20:04 +0000Produced by Podcast For HireYou mentioned a couple of different types of Gardens and I was on your website earlier. The Eco Gardens by Washburn dot site and you had rain Gardens butterfly Gardens pollinator Gardens edible landscaping and rock Gardens. I've got a pet rock would...
I think so Bob especially with all the oxygen that the plant will give up for your pet rock I think it will be much more helpful.

Let's walk through what is your plosives of Gardens our butterfly garden. Are you planting plants to make butterflies come into my yard.

Yes we will be planting plump milkweed or Rose milkweed brings and attract butterflies into your yard into your landscape. And so you can be sitting on your patio or just looking out your kitchen windows. Oh my gosh look at that beautiful butterfly and be mesmerized. And that's also going to help enhance the pollinator action in your landscape too. What about a rain garden also known as bio retention. I think more in a residential landscape. We say rain Gardens and then commercial since there's larger properties we call those bio retention rain Gardens are going to help aid in the retention of the water that is going to leave your property if you don't have a rain garden and does that rain garden is going to act as a retention pond.

But a quickly dissipating retention on rain garden you can have trees and there you can have ornamental grasses you have native plantings you can have shrubs. Basically what we want that rain garden to do is collect that water and then quickly dissipated. Green Gardens are not your mosquito Haven.

That's a good thing you know. Pollinator Garden is something that brings in the bees so you can help with the bee population.

Yep exactly. Pollinator Gardens also bring in our hummingbirds and our butterflies and our moth and our other beneficial insect though not just bees and things but you're on the right track. I mean we all like to eat right. Need pollinators.

That's true. Well that kind of slides into the next one and the next have a garden instead of Gardens it says edible landscaping what do you mean by that edible landscaping.

If you're going to be outside in your yard and you're hungry something as simple as a raspberry hedgerows or something. We've got fruit trees we can plant we have shrubs we can plant we have like a service berry tree that gives a berries for wildlife but that gives the berries for jams and jellies.

We can make some wine out of a Ronia shrubs.

Oh goodness edible landscaping dual purpose you know producing fruit or vegetable type.

So just basically making stuff edible so that way we can enjoy our garden by not only visually but also tastefully as well. Finally rock Gardens as I mentioned at the beginning that I've got a pet rock and I really I really do have one that I bought was kind of funny but what what really is a rock garden rock garden that's more of a Zero Escape feature and when I say Zero Escape that's felt an act like the rocks there.

So very very very drought tolerant used in places where people don't necessarily want to or maybe they can't mould or maybe they just don't want that much maintenance. So think of something maybe on a hillside or maybe you know you can even have a rock garden is introduction to your rain garden something that provides quite a bit of colour but also is very easy to maintain.]]>261bee,bob,bswithbob,eco,edible,gardens,grasses,landscaping,ornamental,plants,podcast,pollinator,pond,rain,retention,rock,sara,schmidt,shrubs,washburnfalsefullhttps://www.spreaker.com/episode/mchugh-excavating-e5-are-you-licensed-and-what-about-insurance--15136238https://api.spreaker.com/episode/15136238Wed, 12 Sep 2018 23:10:06 +0000Produced by Podcast For Hire217falsefullhttps://www.spreaker.com/episode/e3-bill-temte-boat-music-and-getting-old--15280870
Absolutely. And the one that I'm talking to is talking about with just 16 before you go over the river and you go into Medary there. Some area right there you end. Grow with vegetables and stuff and then ride his bike into the north side in a big basket from Pebble the stuff two small grocery stores and some of the bars and the Vogue and Oni's restaurant that he's way back through they get their stuff. And I was just again part of that simple life of the north side.

So Oni's was actually attached to the word the vogue right. And that was the find out that was fine dining.

Back in the day as much as you can get from one to the other inside but you could get into Oni's or just into the vogue on the roadside so that the Bridgeview plaza area when that popped up what used to be there prior to that it used to be Wilkerson's sand pit a very large sand pit. And it was filmed by dredging out the Shaku Bay which is the river outside. See the river used to be you see all river came down each channel. But they had to have sand to fill and developing the Shopko center there with all the sand pits that were around.

We've talked about a couple of them that you brought up is that where the kids like you and your brothers and sister used to play baseball or was there other places to play baseball. Actually we played ours in the alley behind the bombers.

By her house here. There's a softball.

We play softball hard. All but. Two the street and I mention the what used to be a hotel there cross that street and off to home base was at my neighbor's garage and the telephone pole over there was first base and a second base was dug out there and third base hey it was another natural part of the parking area. And we believe there are that kind of of a perpetual game going near all summer long. Did you guys use baseball gloves and bats and real balls or did you end up using what was going in there in balls but mostly not the last. Few gloves that show up but you weren't really that needed.

And so you ever had a homerun.

I don't know. Probably did at one time or another.

Cause you could do it over one of the Alongi either one of the people who lived with St you could hit it over his shack on the back of it where he kept his and neck gets to be playable and that could be a homerun because first base was here and he said he was quite a character he would you work on the railroad and he had a boat on a pushcart and he would push it down to the river and fish all day and come back and pull it back at night.

Yeah.

Fish and you don't see that nowadays. I mean people people got there. Well I don't know if you watched any of the the bass masters when they were here with their you know hundred thousand dollar boats and their electronics and there that's going to find the fish for you. Not like casting all the time and real and in new ones.

You know yeah I know they're real good from my own history of living there please.

And you know there's somebody told me there is a pontoon boat and some dock around here with 2 400 horse on it. Wow. Yeah that's what they said. Well because I used to have a 21 foot pontoon boat with a 50 horse Mercury with it's called the Big Foot bottom. So I think it's more power to push the boat and I'd pull over water skiers and everything with it but I can't. Well we were only broke sons bought. On Father's Day and we saw a couple of these boats going 60 miles pontoons 60 miles an hour down the river.

You know they're not enjoying it. You got to enjoy that go slow it just take it all in.

When we still have that pontoon boat with my son's office was up there in the building on the river there and the L.H.I building up and wife and I we take we just like to go out for a little boat ride during the day and we get down here and park the boat. Just let it sit in the middle of the river. Comparators office. I'm on the phone. The. We're having a good time when you don't go with us.

Except that it is just fun job.

How many times did he take you up on it once. How many kids you have. I count three. Are they all musical candy. Oh. In fact.

One of the most fun things we did as a family is my wife is that crazy principal. My wife playing the organ and the four of us singing songs in four part harmony and they were older by this time of course but we used to do it. We've got a CD called The Temte singers or something I've kept with the title is that we did and right. So music was really a part of our life. I was with a guy with a little parlor organ pump organ and I said Yes I have a picture. Of growing up on George Street and we win those little ones. Or anything you know and a picture of my mother sitting playing and the four of us kids and my sister's youngest couldn't have been over eight or nine so me. My oldest brother. 13 or 14 and reaching Christmas music in four part harmony and my father of them went to out and let them come the people that lived in the neighborhood that they could come and he would set up a little manger scene and my brothers we all day and proper bathrobes with scrapes on them you know the Manjari. My sister always had to be Mary she hated that and we put on the little show singing some carols and my mother playing a little organ and the people come in and just love them. But that was part of that. There was nothing that unusual or dramatic. It was part of that simpler people still getting together and enjoying each other.

Do you miss the simple times.

Oh yes. Try to try to maintain it as much as I care.

But it's there's too much hectic going on around you to really say it's the simple times and I'm getting older so I'm going to be 40 years old this year. Celebrating the 40 anniversary of 40.]]>https://api.spreaker.com/episode/15280870Mon, 10 Sep 2018 21:30:06 +0000Produced by Podcast For Hirementioned that there were people that would pick vegetables and fruits and things and then they'd come to like your father's market and some to your dad and sell them to you know some to some of the other markets around there. And there was a lot of...
Absolutely. And the one that I'm talking to is talking about with just 16 before you go over the river and you go into Medary there. Some area right there you end. Grow with vegetables and stuff and then ride his bike into the north side in a big basket from Pebble the stuff two small grocery stores and some of the bars and the Vogue and Oni's restaurant that he's way back through they get their stuff. And I was just again part of that simple life of the north side.

So Oni's was actually attached to the word the vogue right. And that was the find out that was fine dining.

Back in the day as much as you can get from one to the other inside but you could get into Oni's or just into the vogue on the roadside so that the Bridgeview plaza area when that popped up what used to be there prior to that it used to be Wilkerson's sand pit a very large sand pit. And it was filmed by dredging out the Shaku Bay which is the river outside. See the river used to be you see all river came down each channel. But they had to have sand to fill and developing the Shopko center there with all the sand pits that were around.

We've talked about a couple of them that you brought up is that where the kids like you and your brothers and sister used to play baseball or was there other places to play baseball. Actually we played ours in the alley behind the bombers.

By her house here. There's a softball.

We play softball hard. All but. Two the street and I mention the what used to be a hotel there cross that street and off to home base was at my neighbor's garage and the telephone pole over there was first base and a second base was dug out there and third base hey it was another natural part of the parking area. And we believe there are that kind of of a perpetual game going near all summer long. Did you guys use baseball gloves and bats and real balls or did you end up using what was going in there in balls but mostly not the last. Few gloves that show up but you weren't really that needed.

And so you ever had a homerun.

I don't know. Probably did at one time or another.

Cause you could do it over one of the Alongi either one of the people who lived with St you could hit it over his shack on the back of it where he kept his and neck gets to be playable and that could be a homerun because first base was here and he said he was quite a character he would you work on the railroad and he had a boat on a pushcart and he would push it down to the river and fish all day and come back and pull it back at night.

Yeah.

Fish and you don't see that nowadays. I mean people people got there. Well I don't know if you watched any of the the bass masters when they were here with their you know hundred thousand dollar boats and their electronics and there that's going to find the fish for you. Not like casting all the time and real and in new ones.

You know yeah I know they're real good from my own history of living there please.

And you know there's somebody told me there is a pontoon boat and some dock around here with 2 400 horse on it. Wow. Yeah that's what they said. Well because I used to have a 21 foot pontoon boat with a 50 horse Mercury with it's called the Big Foot bottom. So I think it's more power to push the boat and I'd pull over water skiers and everything with it but I can't. Well we were only broke sons bought. On Father's Day and we saw a couple of these boats going 60 miles pontoons 60 miles an hour down the river.

You know they're not enjoying it. You...]]>556bill,boat,bob,bswithbob,getting,microcast,mississippi,music,northside,northsidelacrosse,northsidelax,old,podcast,river,schmidt,stories,temtefalsefullhttps://www.spreaker.com/episode/e3-masters-services-chimney-chad-getting-involved-in-other-than-just-chimney--15280684https://api.spreaker.com/episode/15280684Wed, 05 Sep 2018 17:45:05 +0000Produced by Podcast For Hire111falsefullhttps://www.spreaker.com/episode/e3-i-am-sleeping-better-i-am-feeling-better--15275599https://api.spreaker.com/episode/15275599Thu, 30 Aug 2018 23:10:05 +0000Produced by Podcast For Hire166better,bob,bswithbob,chad,energy,feel,look,microcast,micro-cast,murray,podcast,schmidt,thrivefalsefullhttps://www.spreaker.com/episode/e3-eco-gardens-by-washburn-llc-podcast--15136274
I don't call soil dirt because there is no life in it. There is life in the soil so there are microorganisms in soil. There are nutrients and soil which have those in there. OK but there again yes weeds grow in dirt. OK. So yes there is a little bit of life but that the Cheerio's the dog care the Krumm the who knows what else you have on your kitchen for that.

What can people put in their soil for their own garden.

What should they put into compost compost. Is a soil amendment compost can be mixture of nitrogen and carbon usually. We want a 30 to 1 ratio so carbon that would come from your brown Neeve like your dad leaves in the fall. Make sure that you're using leaves from a healthy tree. We don't want leaves that come from a tree that is carrying a disease and then you let your could clipping from hopefully an untreated Lawn because if you treat your life special you're putting chemicals on it organic or not grass clippings from an untreated lawn into your vegetable garden.

Now if you are looking for compost for your flower bed or you know putting around your shrubs spare mulching for protection for winter then you know yeah that's okay.

It's a vicious cycle where eventually those lawn treatment can get into our wildlife.

How do we test how do we test her soil.

Sarah by simply either taking a shovel or soil probe we gather a sample I take mine down to the extension a general one cost to around seventeen dollars and you get the result within two weeks. You get emailed to you or you can have a mailed to you and you can also have the option of paying a little bit extra to test for certain nutrients.]]>https://api.spreaker.com/episode/15136274Sun, 26 Aug 2018 21:20:05 +0000Produced by Podcast For HireYou've said the word soil a couple of times rather than dirt why soil over this dirt. I don't call soil dirt because there is no life in it. There is life in the soil so there are microorganisms in soil. There are nutrients and soil which have...
I don't call soil dirt because there is no life in it. There is life in the soil so there are microorganisms in soil. There are nutrients and soil which have those in there. OK but there again yes weeds grow in dirt. OK. So yes there is a little bit of life but that the Cheerio's the dog care the Krumm the who knows what else you have on your kitchen for that.

What can people put in their soil for their own garden.

What should they put into compost compost. Is a soil amendment compost can be mixture of nitrogen and carbon usually. We want a 30 to 1 ratio so carbon that would come from your brown Neeve like your dad leaves in the fall. Make sure that you're using leaves from a healthy tree. We don't want leaves that come from a tree that is carrying a disease and then you let your could clipping from hopefully an untreated Lawn because if you treat your life special you're putting chemicals on it organic or not grass clippings from an untreated lawn into your vegetable garden.

Now if you are looking for compost for your flower bed or you know putting around your shrubs spare mulching for protection for winter then you know yeah that's okay.

It's a vicious cycle where eventually those lawn treatment can get into our wildlife.

How do we test how do we test her soil.

Sarah by simply either taking a shovel or soil probe we gather a sample I take mine down to the extension a general one cost to around seventeen dollars and you get the result within two weeks. You get emailed to you or you can have a mailed to you and you can also have the option of paying a little bit extra to test for certain nutrients.]]>162bob,bswithbob,by,clippings,compost,dirt,eco,gardens,grass,lawn,nutrients,podcast,schmidt,soil,test,washburnfalsefullhttps://www.spreaker.com/episode/mchugh-excavating-e4-what-machines-will-we-see-how-about-bidding--15136232https://api.spreaker.com/episode/15136232Sun, 12 Aug 2018 23:10:05 +0000Produced by Podcast For Hire550falsefullhttps://www.spreaker.com/episode/e2-bill-temte-mom-tv-gandy-dancers-borders--15280809
So there's always Central and always Logan.

Well through the first period years only central when there is virtually nothing to do on a site that's very early then is interstate grew. Then Logan was built in the location of Logan middle school now.

So I'm a little kid when they moved from where the middle school currently is to the high school where the high school is now. You were part of that in the planning right.

I was the head of the planning and I I had two principal factors one of them we are going to build a school that wasn't fancy Schmalensee or anything but a place where young people would want to be during their day. So we made it a user friendly and sent the new central that was built a number of years before they had was frankly not built very user friendly.

Now when you say new central are you talking about we're Wygant Park is now our worst central is now central is now OK.

Now they have redone the new Central and made it a much more user friendly space but it used to be confusing to get around so. So we said okay we're going to build high school students want to be in and be a part of and that was part of it. And the other thing is this is a river city and we have no indoor swimming pools to speak of. Other than the one in the old YMCA which was just a small one and you had to go in bare naked to go in that really what was at all because you had to take a good shower and go in because they didn't have the cleaning mechanisms in the pool everything. And they didn't have dirty clothes going into the pool. I belong to my wife for a while and the other interesting thing when I was still I think a sophomore and I was hanging out with the wall and a director of the Y came up one day and he said Bill how would you like to be a counselor at Camp Renfield which toasties was the YMCA camp. Right. So I was accepted as a usable adult at a very young age right and enjoyed it. And I would give the guy his name but a person that still sees me and says or you did it. Well he has to do is take the campers on a hike in the woods. And they are always afraid of a bear or something says guys do it. We're going to have a little fun. So I had it when they got close.

I came out and scream yell and they almost fell into the woods.

Anyway you'd mentioned to that when once Logan was being built that you had to bring a bunch of earth into there. We are not a great deal because it was a.

Very thin muck layer which was easy to scrape off. And then it was virgin sand underneath that. So all we had to do is bring in enough to raise it about 20 feet. And we put it in and did what's called engineered compacted fill. So that because we are obviously working to build a basement it because he got down to the ground water pretty pretty soon there and then build it right on that. Same base and we got it by digging Kramersville. There is no longer a Kramersville you know the cemetery is still there and you know we don't know the street but they they're all behind it. No buildings Kwik trip and others have taken the land over there. What used to be where Logan is currently sitting foundry that's why all of the sand was taken up behind it because all of the same. It was a fairly good size and heavy use foundry and the sand is all just dumped on. And over the years it just compacted down. So we just had to tear the foundry out of there which of course had no basement either and prepare or seitan build as we would say the new low in the five we think they did do a few add ons to it since then. But it's still in good shape.

As a place where students want to be any any story you want to tell today.

Well what the story is that could tell you that infects the way that North Side in the 40s and 50s is across \concrete and they make the big pipes for sewers and stuff huge and that whole area now where Crole is. But it was much bigger and the real road workers were called Gandy dancers because all the track and rail stuff is all done by hand and they'd bring them in and he would go up and down the track and do reappear. Well those Gandy dancers would sleep in those big six foot concrete things. And at night they make their way into the neighborhoods and particularly mine because there was a liquor store or my dad's grocery store bought for Tavern's within two blocks. It was a small community there and numerous times when we'd be running around outside at night. We'd run out to the alley and shake out a Gandy dancers or 2 sleeping in our bushes. Nobody got excited about it.

We didn't know we called the cops or anything. You have any stories about them per se. Well you knowshaking them out of the bushes and.

Never because what they would do is work hard all day and sledgehammers and you name it you know fixing the ties quote. And namely to back him and all that. So they. Would come to the Near North Side which George Street. We're pretty close to the real truth there instead of read really into them very quickly.

What were the boundaries of the north side. Because you just mentioned near north side and we talked the other day when we were on the other day you mentioned northern Northside and Southern North. What were kind of the boundaries of everything.

The nor the north side kind of ended around the old Roosevelt school a little beyond it because everything else above there just wasn't the only thing there was was George Street that headed into Onalaska and he had to go over the railroad tracks again and all that sort of thing. But the lower north side there are more Caledonia's street. Like Clinton Street down to the the Milwaukee Road I have to call it evil and stuff and the tracks and a little bit beyond them because again there wasn't much monitor Street was in there. But you know that's all the buildings and you see that none of them are any more than 30 years old.]]>https://api.spreaker.com/episode/15280809Fri, 10 Aug 2018 21:45:05 +0000Produced by Podcast For HireYou've mentioned that that when you're on the board of education that you guys planned the the new Logan was Logan always the second high school in LaCrosse Cross was there. So there's always Central and always Logan. Well through the first period...
So there's always Central and always Logan.

Well through the first period years only central when there is virtually nothing to do on a site that's very early then is interstate grew. Then Logan was built in the location of Logan middle school now.

So I'm a little kid when they moved from where the middle school currently is to the high school where the high school is now. You were part of that in the planning right.

I was the head of the planning and I I had two principal factors one of them we are going to build a school that wasn't fancy Schmalensee or anything but a place where young people would want to be during their day. So we made it a user friendly and sent the new central that was built a number of years before they had was frankly not built very user friendly.

Now when you say new central are you talking about we're Wygant Park is now our worst central is now central is now OK.

Now they have redone the new Central and made it a much more user friendly space but it used to be confusing to get around so. So we said okay we're going to build high school students want to be in and be a part of and that was part of it. And the other thing is this is a river city and we have no indoor swimming pools to speak of. Other than the one in the old YMCA which was just a small one and you had to go in bare naked to go in that really what was at all because you had to take a good shower and go in because they didn't have the cleaning mechanisms in the pool everything. And they didn't have dirty clothes going into the pool. I belong to my wife for a while and the other interesting thing when I was still I think a sophomore and I was hanging out with the wall and a director of the Y came up one day and he said Bill how would you like to be a counselor at Camp Renfield which toasties was the YMCA camp. Right. So I was accepted as a usable adult at a very young age right and enjoyed it. And I would give the guy his name but a person that still sees me and says or you did it. Well he has to do is take the campers on a hike in the woods. And they are always afraid of a bear or something says guys do it. We're going to have a little fun. So I had it when they got close.

I came out and scream yell and they almost fell into the woods.

Anyway you'd mentioned to that when once Logan was being built that you had to bring a bunch of earth into there. We are not a great deal because it was a.

Very thin muck layer which was easy to scrape off. And then it was virgin sand underneath that. So all we had to do is bring in enough to raise it about 20 feet. And we put it in and did what's called engineered compacted fill. So that because we are obviously working to build a basement it because he got down to the ground water pretty pretty soon there and then build it right on that. Same base and we got it by digging Kramersville. There is no longer a Kramersville you know the cemetery is still there and you know we don't know the street but they they're all behind it. No buildings Kwik trip and others have taken the land over there. What used to be where Logan is currently sitting foundry that's why all of the sand was taken up behind it because all of the same. It was a fairly good size and heavy use foundry and the sand is all just dumped on. And over the years it just compacted down. So we just had to tear the foundry out of there which of course had no basement either and prepare or seitan build as we would say the new low in the five we think they did do a few add ons to it since then. But it's still in good shape.

As a place where students want to be any any story you want to tell today.

Well what the story is that could tell you that infects the way...]]>796bill,bob,borders,bswithbob,dancers,gandy,gandydancers,heights,lacrosse,laxwi,microcast,mom,northside,northsidelacrosse,podcast,schmidt,temte,willow,wisconsinfalsefullhttps://www.spreaker.com/episode/e2-masters-services-chimney-chad-other-services-education--15280675https://api.spreaker.com/episode/15280675Sun, 05 Aug 2018 17:45:04 +0000Produced by Podcast For Hire213bswithbob,chad,chimney,dallas,fire,fireplace,fortworth,masters,mastersservices,microcast,murray,podcast,servicesfalsefullhttps://www.spreaker.com/episode/e2-what-is-thrive--15275567https://api.spreaker.com/episode/15275567Mon, 30 Jul 2018 23:10:06 +0000Produced by Podcast For Hire213bob,bswithbob,chad,feelgood,murray,podcast,schmidt,thrivefalsefullhttps://www.spreaker.com/episode/e2-eco-gardens-by-washburn-llc-podcast--15136270
When it comes to planting trees you mentioned that you'd like to plant a lot of trees.

How would the typical person plants a tree what's the right way to do that the right way to plant a tree to make sure that your law is at least three times the width of the rope. The adage you want to remember is planted high or it will die. So what happens is that so many people don't know this. They dig a hole too deep they don't dig it wide enough but when you dig the hole too deep you're not letting the flair be somewhat exposed to the top of the hole. So when you bury the flare which is like to go down the trunk and then once the roots start going a word that's called the root layer. And we don't want to necessarily cover that up with a ton of soil a very light covering maybe even half an inch is okay. Remember that tree roots they grow out they don't grow down.

Do you think we water them too much or not enough.

we want to really make sure that first season that we plant that tree to try to get it established properly that we're watering probably depending on where you live your soil type. How much rain. Mother Nature has given us really an inch a week is what we are looking for.

You're going to have to bend down or kneel down and touch the soil. You want to see how that soil is if it's moist. Don't lie to your tree that day.]]>https://api.spreaker.com/episode/15136270Thu, 26 Jul 2018 19:20:06 +0000Produced by Podcast For HireWhat I really like to push with my Eco garden is that we're inviting wildlife in. Believe it or not and I'm not just talking about deer and rabbits I'm talking about birds and the beneficial insects the pollinators which you know the bees. The...
When it comes to planting trees you mentioned that you'd like to plant a lot of trees.

How would the typical person plants a tree what's the right way to do that the right way to plant a tree to make sure that your law is at least three times the width of the rope. The adage you want to remember is planted high or it will die. So what happens is that so many people don't know this. They dig a hole too deep they don't dig it wide enough but when you dig the hole too deep you're not letting the flair be somewhat exposed to the top of the hole. So when you bury the flare which is like to go down the trunk and then once the roots start going a word that's called the root layer. And we don't want to necessarily cover that up with a ton of soil a very light covering maybe even half an inch is okay. Remember that tree roots they grow out they don't grow down.

Do you think we water them too much or not enough.

we want to really make sure that first season that we plant that tree to try to get it established properly that we're watering probably depending on where you live your soil type. How much rain. Mother Nature has given us really an inch a week is what we are looking for.

You're going to have to bend down or kneel down and touch the soil. You want to see how that soil is if it's moist. Don't lie to your tree that day.]]>161bob,bswithbob,butterflies,by,eco,ecogardens,flowers,gardens,hummingbirds,planting,podcast,pollinators,sara,schmidt,trees,washburn,water,wildlifefalsefullhttps://www.spreaker.com/episode/mchugh-excavating-e3-why-the-name-what-do-you-do--15136229https://api.spreaker.com/episode/15136229Thu, 12 Jul 2018 23:10:04 +0000Produced by Podcast For Hire251falsefullhttps://www.spreaker.com/episode/e1-bill-temte-what-i-like-best-about-the-northside--15229458
And when we first came back from my military my wife and I looking for apartments decided we'd go in there and see what it like well that tobacco smell was still so bad in that particular the hallways and stairways. We climbed up two floors and climbed back down to the floors and went out. But that was another place that employed quite a few people. Most of those you know like I said as we were driving around people tended to live closer to where they worked. Then people do today of course.

So anyway the simplicity and the acceptance. For instance right across the street from my father's small meat market grocery store was a few canned goods was the extent and produce right was that but right across the street was a very nice very good liquor store.

And the fellow who and the liquor store had a sedan and he also had a pickup truck. Twice a week my brothers sister mom and dad would get in the back of a pickup truck. They didn't get in the seat in as kids for kids and we go as far go and see to the river Black River comes under the river road bridges then. And fish all day and have meals and stuff. And then at 5 o'clock or so we all piled back in the back of the pickup truck and and back to George Street.

Let me ask you this when you guys were in your car were you wearing seatbelts.

There were no seatbelts and we didn't have a car. That's the other thing about it. Many people like my next door neighbor he had a car but it was in the garage. 90 percent of the time he worked as a custodian at the post office and he would simply get on the bus and go to daughters work downtown. The only powerful post office in those days and that the car would come out of the garage once in a while.

When the family would maybe go for a Sunday drive that was a nice big deal and they didn't fight me because I was a good friend of one of the sons and they invite me to ride along with them. But to cars just were not used either no longer from the south side to the extent they are now. But the South Side was much more car oriented. First of all it was spread out over a lot more a lot more area. So using the car was more of a sense like the old Trane company was a way to south ditches of the La Crosse and in fact you know the Village Shopping Center what was called The Village Shopping Center. Yup. Before that was built.

There was one small restaurant which would be back about where the Central High School football field is. A little path road going back there. Nothing else was anywhere around there because there was a there was a teacher at the time of the 40s in the early 50s. And so I really enjoyed growing up in that environment.

Was it called the North Side back when you were younger.

Yeah yeah. In fact the idea of it being a separate community that died many years before that and and then they built. A Lang drive to connect could your eyes actually lit up when you said that. So you recall when they built lane drive this year before that and you know you meet you where you over the causeway which wasn't that big of a deal. That's where you got from one to the other for many years and then there is just a kind of road or a bench. And then they actually built a lane drive built it up so that it was the 12 season or 12 months all season road.

So before they had the bridge then did you have to wait for all the trains to get through. Absolutely.

Yeah. In fact those overpasses both the George Street narrow street ones were put in very late in the game in the 50s and the 60s you know you had to wait for trains and that kind of an interesting one that I've enjoyed here that I was president of the Board of Education when we built the new logo. Well. If you can remember that that street going out had to go over all of the railroad tracks you know eventually to get out to. I was 16 and I thought the city was great about it talked him into putting that overpass over the railroad tracks.

So your your as the Board of Education was able to talk the city into that. Yes. And they were very co-operative.

And they they knew me pretty well in fact. I mean I can tell you a story you can use if you want to and that is when we were building the new Logan the school where it just becoming a fiscally independent operation and the city no longer had to approve everything. But we took it to the city the building of it and present you what we're going to do and what we had done in research and all that to know what we are building in life and they really bought into it and so on. But when we're done with the first thing on the agenda when you are done walked onto that rotunda area the outside the city or outside the council chambers or right the wrong thing and I'm standing there for just a minute. One Two Three Four Five Six aldermen came up the hill to tell me what my father meant to them as they were growing up.

So your dad made a difference to these gentlemen. Absolutely. Wow that's awesome.

In fact one of the fellows names initials were shot in the ceiling of the back room with a 22. That was but but he was just that kind of a person who would see people who needed and help them with groceries with a lot of things.

What's the story behind the 22.

Well I don't know they were just fooling around back there and no no big deal just having fun and some laughter time I guess. But you know nothing this liquor store across the street was the only place with them. Oh there's that. St James and St John's directly St James they could come and get their communion wine. Well. Several times my father would meet them in the middle George Street. Bring him back to the back room and feed him some food and so on so that he could nicely get back to their rectory.

Back on Caledonia's street what was the name of your father's grocery store just Temtes market.

How was it was the grocery store back in those states similar to what a bar or a church is now where people get together and it with a little bit a little bit but most of it is just there.

My father was so welcoming and great. Another little story about this there was a family on the north side who lost their home that kicked out of renting or whatever. And they had a couple kids and there was an old.

We called it the little holes behind our house and our house had all of 620 square feet and this was the little house.

I must have been a tiny house because he showed me the house he grew up in.

Yeah. Well this house of course is no longer there. But what he did is he moved the family in there and got some business furniture and stuff for them that they needed above what they could bring from their apartment or whatever. And he lived in there for several years until he got them things together and could move into another real house.

I didn't know about this until one of the sons who was very much involved with refereeing in youth sports and stuff saw me and told me the story and like the Six aldermen outside in the vestibule area there there were seven crying men to hear their stories to tell of what my father meant when my father passed away when I was a young man. 13 I guess i was. So I never knew him as a full adult. But he did because he was 50 when he passed away and he had to tell me their story. And you were so moving the stories that every one of them said they're not weeping tears of joy telling their story in the same way that this other young man who was given peace with his father and other family to live for a couple of years by my father who was always giving that kind of a temporary legacy.

Yeah I learned a lot from him and I built my lifestyle around what I didn't know about him and that's the way it is right.

Were you close with your mother.

Well after my father passed. Yes in fact we saw my wife and I we saw my mother through the end. She was a worker all to keep the family together and stuff but then she moved into storyteller's we got her in there when she was in her 60s and she lived to 83 and I had the good fortune because I worked at Tech I was vice president of Tech at the time and I would if I was running around don't I would stop and check on my mother.

Well one day I did. And she'd gotten up got half or three fourths crest sat on the bed and just laid herself back down. And that was the end of it. And I walked in and saw so I called Nine one one. It wasn't that number of them. But anyway he said to Doc what time you left here. He was the coroner and I don't know if it was still his way but if somebody died outside of a hospital the coroner had to come to make sure that everything was fine.

And Doc would tell you I've always had a cigar never left hanging out of his mouth and I side of the bed and I'm on this side.

Right. And he looking at Earnhardt rolls the price of Mr. temte he said he died peacefully. He never suffered a movement that was good.

Oh yeah I bet. As a son that's probably great to hear.

Yeah yeah it was. So anyway and. The variety of people on the north side like I say this one family owned service transfer finally bought out by what was the big gave we transfer which was the other. The other big one and other people were very much. We had a doctor and Denis that sort of thing]]>https://api.spreaker.com/episode/15229458Tue, 10 Jul 2018 21:28:43 +0000Produced by Podcast For HireWhat I like best about the Northside is simply that it was exactly that simple. It wasn't any the classification of people and stuff. And we had some people that that lived there in the 40s and 50s that had some money. And one person the neighbor down...
And when we first came back from my military my wife and I looking for apartments decided we'd go in there and see what it like well that tobacco smell was still so bad in that particular the hallways and stairways. We climbed up two floors and climbed back down to the floors and went out. But that was another place that employed quite a few people. Most of those you know like I said as we were driving around people tended to live closer to where they worked. Then people do today of course.

So anyway the simplicity and the acceptance. For instance right across the street from my father's small meat market grocery store was a few canned goods was the extent and produce right was that but right across the street was a very nice very good liquor store.

And the fellow who and the liquor store had a sedan and he also had a pickup truck. Twice a week my brothers sister mom and dad would get in the back of a pickup truck. They didn't get in the seat in as kids for kids and we go as far go and see to the river Black River comes under the river road bridges then. And fish all day and have meals and stuff. And then at 5 o'clock or so we all piled back in the back of the pickup truck and and back to George Street.

Let me ask you this when you guys were in your car were you wearing seatbelts.

There were no seatbelts and we didn't have a car. That's the other thing about it. Many people like my next door neighbor he had a car but it was in the garage. 90 percent of the time he worked as a custodian at the post office and he would simply get on the bus and go to daughters work downtown. The only powerful post office in those days and that the car would come out of the garage once in a while.

When the family would maybe go for a Sunday drive that was a nice big deal and they didn't fight me because I was a good friend of one of the sons and they invite me to ride along with them. But to cars just were not used either no longer from the south side to the extent they are now. But the South Side was much more car oriented. First of all it was spread out over a lot more a lot more area. So using the car was more of a sense like the old Trane company was a way to south ditches of the La Crosse and in fact you know the Village Shopping Center what was called The Village Shopping Center. Yup. Before that was built.

There was one small restaurant which would be back about where the Central High School football field is. A little path road going back there. Nothing else was anywhere around there because there was a there was a teacher at the time of the 40s in the early 50s. And so I really enjoyed growing up in that environment.

Was it called the North Side back when you were younger.

Yeah yeah. In fact the idea of it being a separate community that died many years before that and and then they built. A Lang drive to connect could your eyes actually lit up when you said that. So you recall when they built lane drive this year before that and you know you meet you where you over the causeway which wasn't that big of a deal. That's where you got from one to the other for many...]]>1223bill,bob,bswithbob,crosse,georgestreet,heights,la,lacrosse,microcast,north,northside,schmidt,side,stories,temte,temtemarket,willow,willowheightswi,wisconsinfalsefullhttps://www.spreaker.com/episode/e1-masters-services-chimney-chad--15198755Chad Murray, the founding CEO, has earned his Certified Master Chimney Technician Certificate.
We're not just any chimney cap installer, we are also the chimney cap fabricator. Masters Services will not stop wildlife removal until there is absolutely no wildlife activity.]]>https://api.spreaker.com/episode/15198755Thu, 05 Jul 2018 17:42:57 +0000Produced by Podcast For HireCertified Master Chimney Techs Chad Murray, the founding CEO, has earned his Certified Master Chimney Technician Certificate. We're not just any chimney cap installer, we are also the chimney cap fabricator. Masters Services will not stop wildlife...Chad Murray, the founding CEO, has earned his Certified Master Chimney Technician Certificate.
We're not just any chimney cap installer, we are also the chimney cap fabricator. Masters Services will not stop wildlife removal until there is absolutely no wildlife activity.]]>181bob,bswithbob,certified,chad,chimney,chimneycap,master,masters,mastersservices,microcast,micro-cast,murray,podcast,removal,schmidt,services,technician,wildlifefalsefullhttps://www.spreaker.com/episode/e1-thrive-how-did-you-get-involved--15167145https://api.spreaker.com/episode/15167145Sat, 30 Jun 2018 23:06:34 +0000Produced by Podcast For HireChad Murray went from user of Thrive Products to Promoter. See how Thrive can help you.161better,bswithbob,chad,feel,microcast,murray,thrive,thriveweightlossfalsefullhttps://www.spreaker.com/episode/extra-eco-gardens-by-washburn-llc-podcast--15136263
So you were able to take your love for being outside your skills that you learned teaching and then wrap that up into your own your own business with Eco Gardens.

My Washburn Yeah actually right after I graduated I started Eco garden by Washburn and I thought oh boy what am I doing. Ok so I had a very good business background and a pretty good knowledge for horticulture. Every day I learn something different and I tell you bouncing ideas off people and trying to make sure that you stand by all the needs of everybody. I know you can't do it but trying it is challenging but it's fun when you actually have a lot of success at it.

What are some of the service organizations that you belong to the American Legion.

I'm involved with them. In fact we've been discussing some tree replacement options up at the Onalaska Legion post and though I belong to a referral group we are a group of small business owners and leaders and we get together about three times a month. We discuss what our business is doing kind of like the current trends in our business and what type of referrals that we're looking for is.]]>https://api.spreaker.com/episode/15136263Tue, 26 Jun 2018 21:14:22 +0000Produced by Podcast For HireSarah what's your background. So I've always enjoyed nature always enjoyed being outside. I decided that it was time for me to get out of the entire retail setting and so I went back to school for my sEcond associate degree and I got that Western...
So you were able to take your love for being outside your skills that you learned teaching and then wrap that up into your own your own business with Eco Gardens.

My Washburn Yeah actually right after I graduated I started Eco garden by Washburn and I thought oh boy what am I doing. Ok so I had a very good business background and a pretty good knowledge for horticulture. Every day I learn something different and I tell you bouncing ideas off people and trying to make sure that you stand by all the needs of everybody. I know you can't do it but trying it is challenging but it's fun when you actually have a lot of success at it.

What are some of the service organizations that you belong to the American Legion.

I'm involved with them. In fact we've been discussing some tree replacement options up at the Onalaska Legion post and though I belong to a referral group we are a group of small business owners and leaders and we get together about three times a month. We discuss what our business is doing kind of like the current trends in our business and what type of referrals that we're looking for is.]]>150american,bob,bswithbob,business,by,college,community,eco,ecogardens,gardens,lawn,legion,podcast,sara,schmidt,service,techical,trees,washburn,westernfalsefullhttps://www.spreaker.com/episode/e1-eco-gardens-by-washburn-llc-podcast--15136245I wanted to include my name because I feel that a lot of people knew me if I'd been in this area ever since I was 4 years old. So that's kind of why I wanted to include my last name. But the Eco Gardens carpet the Eco friendly like the native plants the edible landscaping the rain garden that we associate with sustainable landscaping sustainable being encountered nothing but you leave it better than you found it really sustainable to me meaning locally sourced that we're not putting a whole lot of wasted energy into creating something just to have it Eco involving wildlife and the Gardens parks Gardens is you know the sustainable landscape and garden design. So I want to be planting something more along the lines of where you're going to go outside and you're going to say oh look at that beautiful you know and it cuts around in your garden. Those are the parts of what I thought was important to me and important for me to give back to the community. And that's how I put my theme of my business together. So what do you what do you want people to know about you that I do what I say I'm going to do to help people get outside to actually enjoy where they exist.

I think that I can help you very creative in getting what you want within your budget to create outdoor landscape.

I think a lot of people when they think of landscaping they think of putting edging around the house throwing some rocks in there and calling it good maybe some bark in the back or on the tree. What does landscaping mean to you sir.

Landscaping can mean so many different things. And to me it means getting out into your yard or at your business area beautification. OK. We have trees which I'm a big proponent of planting trees but always you have to have the right plant in the right place. You don't want to planted sugar maple in a real pay corridor because you know that they're not going to fit the heightened with restrictions that you have in a tight corridor. What I like to make sure to do is to plant something native because then we have an easier time with the establishment and maintenance of the tree and then we go down to our next level perhaps shrub.

So hardy shrub woody shrub this area providing a lot of another habitat area for wildlife that we have are our perennials. We can certainly plant things in the landscape that give us a really nice show all year long to.]]>https://api.spreaker.com/episode/15136245Tue, 26 Jun 2018 21:13:16 +0000Produced by Podcast For HireSo why the name Eco Gardens by Washburn I wanted to include my name because I feel that a lot of people knew me if I'd been in this area ever since I was 4 years old. So that's kind of why I wanted to include my last name. But the Eco Gardens carpet...I wanted to include my name because I feel that a lot of people knew me if I'd been in this area ever since I was 4 years old. So that's kind of why I wanted to include my last name. But the Eco Gardens carpet the Eco friendly like the native plants the edible landscaping the rain garden that we associate with sustainable landscaping sustainable being encountered nothing but you leave it better than you found it really sustainable to me meaning locally sourced that we're not putting a whole lot of wasted energy into creating something just to have it Eco involving wildlife and the Gardens parks Gardens is you know the sustainable landscape and garden design. So I want to be planting something more along the lines of where you're going to go outside and you're going to say oh look at that beautiful you know and it cuts around in your garden. Those are the parts of what I thought was important to me and important for me to give back to the community. And that's how I put my theme of my business together. So what do you what do you want people to know about you that I do what I say I'm going to do to help people get outside to actually enjoy where they exist.

I think that I can help you very creative in getting what you want within your budget to create outdoor landscape.

I think a lot of people when they think of landscaping they think of putting edging around the house throwing some rocks in there and calling it good maybe some bark in the back or on the tree. What does landscaping mean to you sir.

Landscaping can mean so many different things. And to me it means getting out into your yard or at your business area beautification. OK. We have trees which I'm a big proponent of planting trees but always you have to have the right plant in the right place. You don't want to planted sugar maple in a real pay corridor because you know that they're not going to fit the heightened with restrictions that you have in a tight corridor. What I like to make sure to do is to plant something native because then we have an easier time with the establishment and maintenance of the tree and then we go down to our next level perhaps shrub.

So hardy shrub woody shrub this area providing a lot of another habitat area for wildlife that we have are our perennials. We can certainly plant things in the landscape that give us a really nice show all year long to.]]>201bob,bswithbob,business,by,eco,ecogardens,gardens,landscapes,podcast,schmidt,shrubs,trees,washburn,washburnecogardensfalsefullhttps://www.spreaker.com/episode/mchugh-excavating-is-involved-in-the-community-and-civic-organizations--15026925
We do. We belong to the Wisconsin Underground Contractors Association. It's a statewide organization of companies that do water and sewer and other underground type work. I'm not sure how many members are in it. I wouldn't be surprised if it's around 100 or so but we've won their safety award seven times in the last. So that's one of the organizations we belong to and we're active in our safety director has been on the safety insurance committee. There are a number of years. We also belong to the Wisconsin Transportation Builders Association. There are some people generically called the road builders. They're an organization of a lot of companies that are larger than asserting that. But a lot of contractors that work on department transportation projects and interstates and on some of the highways since we do some of that work. We also belong to that organization we belong to La Crosse Chamber Commerce cluster development corporation and a few other smaller civic organizations like we're right on the edge of home and here so we belong to the Holmen Business too.

I also know that water is a passion of yours and you help other countries with their water problems.

Yes I'm involved with Rotary International through the Holmen Rotary Club and because of my experience with McHugh excavating you know water treatment which is what septic systems are and you know larger wastewater treatment plants to cities municipalities use you know all involved involved cleaning the water before it goes either into the groundwater or goes out into the river. Unfortunately there's areas in our world where the only water available to drink is of the quality of what our sewers are. So I've been involved with a number of projects mainly around Lima but some other areas in Peru also where we hope loopers nonprofit organizations and come up with some solutions whether it be individual filtration at the home level or at the village level. We've done a few and some smaller two to 3000 person villages were put in a central treatment so that the water that is available to them can be made safe to drink.

How does somebody reach McHugh excavating Dean?

The office number is out the summer is 608-783-1404 and my cell number is 608-769-4803. And all of our e-mail addresses are on our website which is MchughExcavating.com.

You go to the About Us tab on our website. McHughExcavating.com and there's a link with right by each person's picture to email them.]]>https://api.spreaker.com/episode/15026925Tue, 12 Jun 2018 22:05:10 +0000Produced by Podcast For HireDean McHugh excavating joining us on the McHugh excavating podcast. Do you belong to any professional organizations? We do. We belong to the Wisconsin Underground Contractors Association. It's a statewide organization of companies that do water and...
We do. We belong to the Wisconsin Underground Contractors Association. It's a statewide organization of companies that do water and sewer and other underground type work. I'm not sure how many members are in it. I wouldn't be surprised if it's around 100 or so but we've won their safety award seven times in the last. So that's one of the organizations we belong to and we're active in our safety director has been on the safety insurance committee. There are a number of years. We also belong to the Wisconsin Transportation Builders Association. There are some people generically called the road builders. They're an organization of a lot of companies that are larger than asserting that. But a lot of contractors that work on department transportation projects and interstates and on some of the highways since we do some of that work. We also belong to that organization we belong to La Crosse Chamber Commerce cluster development corporation and a few other smaller civic organizations like we're right on the edge of home and here so we belong to the Holmen Business too.

I also know that water is a passion of yours and you help other countries with their water problems.

Yes I'm involved with Rotary International through the Holmen Rotary Club and because of my experience with McHugh excavating you know water treatment which is what septic systems are and you know larger wastewater treatment plants to cities municipalities use you know all involved involved cleaning the water before it goes either into the groundwater or goes out into the river. Unfortunately there's areas in our world where the only water available to drink is of the quality of what our sewers are. So I've been involved with a number of projects mainly around Lima but some other areas in Peru also where we hope loopers nonprofit organizations and come up with some solutions whether it be individual filtration at the home level or at the village level. We've done a few and some smaller two to 3000 person villages were put in a central treatment so that the water that is available to them can be made safe to drink.

How does somebody reach McHugh excavating Dean?

The office number is out the summer is 608-783-1404 and my cell number is 608-769-4803. And all of our e-mail addresses are on our website which is MchughExcavating.com.

You go to the About Us tab on our website. McHughExcavating.com and there's a link with right by each person's picture to email them.]]>187bigtruck,bob,bswithbob,dean,excavating,holmen,lacrosse,mchugh,mchughexcavating,onalaska,plumbing,podcast,public,rotary,schmidt,service,water,wisconsinfalsefullhttps://www.spreaker.com/episode/mchugh-excavating-was-founded-1976--15026926Good question. From our standpoint he's gotten a little bit bigger.
1976 it was my dad and one guy but like with most businesses that have been around for decades.

They're not the same size they were when we started our company currently has about 40 employees. We've been as high as 60, years ago that we were covering or covering a larger geographic area at that time. So we've pulled that back a little bit. Not that we don't go out of town. We still do. But that's probably the biggest change is the the change in the size of our business.

Really you know some of the technology changes in the equipment and the trucks and of course if you get into septic systems I hate to talk about septic systems too much because it's a relatively small part of our business but it's something an owner faces needing a new septic for 20 or 30 year old house. There are newer technologies available now that weren't 30 or 40 years ago. So there are ways to make septic systems or replacement systems fit on lots where maybe they want to put the patch. We're different and different ways of attacking the problem that didn't exist before.

You mentioned in 1976 as your dad and another guy with your business growing. Are you in need of people to work for you.

We're always in need of good skilled people. We run into the same problem a lot of folks do in the trades. Most of our positions are skilled. So we're looking for skilled people yet. How do you become skilled. If no one can give you a chance to start with. We do have an apprenticeship program through the Laborers Union and the African Union. So there are some opportunities just you know a couple every year where a person can get in all the way on the ground floor. But you know to have apprentices you need to have skill Jurney workers that can help guide them and teach them and mentor them. So there is only a certain amount of the spots we can fill each year. We're always looking for people that want to work outdoors on their hands who want to learn a skill. Folks that even grew up on a farm are good candidates for us because they want to fix things they want to run smaller pieces of equipment in their use. You know they're used to the work. It's not easy work to work construction. It's a very financially rewarding work and I always tell people your job is never going to get shipped to China if you are construction it's always going to be here. But yes we're we're always looking for people to come in and apply and see what we have. And we have dump truck drivers to a number of different positions that people can try to fill mechanics in the shop.
How does somebody reach McHugh excavating Dean?

The office number is out the summer is 608-783-1404 and my cell number is 608-769-4803. And all of our e-mail addresses are on our website which is MchughExcavating.com.

You go to the About Us tab on our website. McHughExcavating.com and there's a link with right by each person's picture to email them.]]>https://api.spreaker.com/episode/15026926Tue, 12 Jun 2018 12:34:34 +0000Produced by Podcast For HireMcHugh Excavating has been in business since 1976 how has business changed since then? Good question. From our standpoint he's gotten a little bit bigger. 1976 it was my dad and one guy but like with most businesses that have been around for...Good question. From our standpoint he's gotten a little bit bigger.
1976 it was my dad and one guy but like with most businesses that have been around for decades.

They're not the same size they were when we started our company currently has about 40 employees. We've been as high as 60, years ago that we were covering or covering a larger geographic area at that time. So we've pulled that back a little bit. Not that we don't go out of town. We still do. But that's probably the biggest change is the the change in the size of our business.

Really you know some of the technology changes in the equipment and the trucks and of course if you get into septic systems I hate to talk about septic systems too much because it's a relatively small part of our business but it's something an owner faces needing a new septic for 20 or 30 year old house. There are newer technologies available now that weren't 30 or 40 years ago. So there are ways to make septic systems or replacement systems fit on lots where maybe they want to put the patch. We're different and different ways of attacking the problem that didn't exist before.

You mentioned in 1976 as your dad and another guy with your business growing. Are you in need of people to work for you.

We're always in need of good skilled people. We run into the same problem a lot of folks do in the trades. Most of our positions are skilled. So we're looking for skilled people yet. How do you become skilled. If no one can give you a chance to start with. We do have an apprenticeship program through the Laborers Union and the African Union. So there are some opportunities just you know a couple every year where a person can get in all the way on the ground floor. But you know to have apprentices you need to have skill Jurney workers that can help guide them and teach them and mentor them. So there is only a certain amount of the spots we can fill each year. We're always looking for people that want to work outdoors on their hands who want to learn a skill. Folks that even grew up on a farm are good candidates for us because they want to fix things they want to run smaller pieces of equipment in their use. You know they're used to the work. It's not easy work to work construction. It's a very financially rewarding work and I always tell people your job is never going to get shipped to China if you are construction it's always going to be here. But yes we're we're always looking for people to come in and apply and see what we have. And we have dump truck drivers to a number of different positions that people can try to fill mechanics in the shop.
How does somebody reach McHugh excavating Dean?

The office number is out the summer is 608-783-1404 and my cell number is 608-769-4803. And all of our e-mail addresses are on our website which is MchughExcavating.com.

You go to the About Us tab on our website. McHughExcavating.com and there's a link with right by each person's picture to email them.]]>2271976,big,bswithbob,business,dean,deanmchugh,earth,excavating,hiring,holmen,lacrosse,mchugh,mchughexcavating,microcast,move,onalaska,plumbing,podcastforhire,trucks,yellowfalsefull