Pregnancy, Birth and Beyond

Pregnancy, Birth and Beyondhttp://www.pbbmedia.org
Visit us at www.pbbmedia.org]]>enHealth & FitnessCopyright PBB Media Incorporatedhttps://d3wo5wojvuv7l.cloudfront.net/t_rss_itunes_square_1400/images.spreaker.com/original/bd0a624f29fa6ddb9dec6f91e76c5166.jpgPregnancy, Birth and Beyondhttp://www.pbbmedia.orgThu, 02 Jul 2026 08:07:44 +0000PBB Media IncorporatedPBB Media Incorporatedhello@pbbmedia.orgPregnancy Birth & Beyond where stories, science, traditions and new ideas meet. We work and live on Bundjalung Country, Australia. Visit us at www.pbbmedia.org
Visit us at www.pbbmedia.org]]>falseepisodicStanding up for Home Birth - yet again with Katelyn Commerfordhttps://www.spreaker.com/episode/standing-up-for-home-birth-yet-again-with-katelyn-commerford--72289083
Homebirth with registered midwives has never been widely available to Australian mothers. The restrictions on their ability to practise (e.g. VBAC, twins and breech births), the need to have a second midwife at the birth, the decades of lack of intrapartum insurance, the need for homebirth midwives to also go through an additional qualification of becoming Endorsed midwives (which also includes a further 5000 hours of practice) means we have a small (and diminishing) number of homebirth midwives women can call on - especially in rural and regional areas.

And now, the Nurses and Midwives Board of Australia are proposing yet more regulations that will restrict women's access to midwives. The main issues are that the second midwife at a birth now also needs to have the same insurance as the primary midwife and for that, she needs to be an Endorsed midwife. And without a second midwife, the primary midwife can't attend the birth. This is particularly difficult for rural and regional midwives who often rely on hospital midwives as their second midwife and until now haven't needed these extra qualiification or insurances.

However! We can have our concerns made known and thankfully Katelyn and her team have made things a little easier for us. NOTE: we need to make our submissions by THIS FRIDAY 5 JUNE 2026.

The NMBA's process for receiving feedback is characteristically not straightforward, but in the last 20 mins or so after discussing the issues, we go into the detail of how to make your concerns known in the easiest way possible.

Get someone to hold the baby for 15 mins, open your laptop and open these documents. Follow the instructions from the top of page two of both documents. NOTE - there are two submissions to be made. Yes, it's a pain, but with Katelyn's help, it won't take long.

Go to: https://www.homebirthaustralia.org/nmba-public-consultation.html
Scroll down to the TWO SUBMISSION TEMPLATES:
https://www.homebirthaustralia.org/sqg.html
https://www.homebirthaustralia.org/endorsement.html

You can email your submissions or fill them in online at the NMBA website. Remember - get them in by 5 June 2026. And if you're a few days late, email them in anyway.

Thanks Katelyn and the HBA team for your wonderful work!

Katelyn can also be found at @katelyn.doulaandnbac on Instagram and https://www.katelynthedoula.com.au/

Copyright 2026 PBB Media and Sally Cusack
All rights reserved.]]>https://api.spreaker.com/episode/72289083Tue, 02 Jun 2026 04:43:29 +0000PBB Media IncorporatedKatelyn Commerford is a busy mum to three young children, a doula, a Next Birth After Caesarean (NBAC) guide, co-host of the Australian VBAC Stories podcast. And if that wasn't enough, she's also the President of Homebirth NSW and the Co-ordinator of...
Homebirth with registered midwives has never been widely available to Australian mothers. The restrictions on their ability to practise (e.g. VBAC, twins and breech births), the need to have a second midwife at the birth, the decades of lack of intrapartum insurance, the need for homebirth midwives to also go through an additional qualification of becoming Endorsed midwives (which also includes a further 5000 hours of practice) means we have a small (and diminishing) number of homebirth midwives women can call on - especially in rural and regional areas.

And now, the Nurses and Midwives Board of Australia are proposing yet more regulations that will restrict women's access to midwives. The main issues are that the second midwife at a birth now also needs to have the same insurance as the primary midwife and for that, she needs to be an Endorsed midwife. And without a second midwife, the primary midwife can't attend the birth. This is particularly difficult for rural and regional midwives who often rely on hospital midwives as their second midwife and until now haven't needed these extra qualiification or insurances.

However! We can have our concerns made known and thankfully Katelyn and her team have made things a little easier for us. NOTE: we need to make our submissions by THIS FRIDAY 5 JUNE 2026.

The NMBA's process for receiving feedback is characteristically not straightforward, but in the last 20 mins or so after discussing the issues, we go into the detail of how to make your concerns known in the easiest way possible.

Get someone to hold the baby for 15 mins, open your laptop and open these documents. Follow the instructions from the top of page two of both documents. NOTE - there are two submissions to be made. Yes, it's a pain, but with Katelyn's help, it won't take long.

Go to: https://www.homebirthaustralia.org/nmba-public-consultation.html
Scroll down to the TWO SUBMISSION TEMPLATES:
https://www.homebirthaustralia.org/sqg.html
https://www.homebirthaustralia.org/endorsement.html

You can email your submissions or fill them in online at the NMBA website. Remember - get them in by 5 June 2026. And if you're a few days late, email them in anyway.

Thanks Katelyn and the HBA team for your wonderful work!

Katelyn can also be found at @katelyn.doulaandnbac on Instagram and https://www.katelynthedoula.com.au/

Copyright 2026 PBB Media and Sally Cusack
All rights reserved.]]>3550endorsedmidwives,homebirth,midwives,nmbafalsefullReaping the rewards of deep preparation with Oni Blecherhttps://www.spreaker.com/episode/reaping-the-rewards-of-deep-preparation-with-oni-blecher--69318123
This deep preparation is rare in these times where many women begin their preparation when they fall pregnant.

This is a follow up interview with Oni after an initial interview when she was 35 weeks pregnant with her first child. The first interview with Oni prior to her birth can be found here: https://www.spreaker.com/episode/a-most-intentional-pregnancy-with-oni-blecher--68549829

Now 18 weeks postpartum, Sally follows up with Oni who takes us through the last weeks of her pregnancy, her labour, birth and post partum period. In particular we hear about:

the impacts of having a big belly and contending with people's comments about it
how that shook her confidence in the last weeks
how she regained her confidence prior to going into labour
letting go of wanting the baby the come and just letting him choose the right time
thanking her baby in early labour for the life changing experience of growing him and acknowledging their next journey together through the rite of passage of birth
how in spite of being at 41 weeks' gestation, she couldn't quite believe that she was really in labour
labour coping strategies (e.g., not saying 'No', insteading saying 'Yes' to contractions)
birthing the baby in the water
birthing the placenta
her newborn's breast crawl
post partum support
claiming the success of her birth as being in large part due to all her preparation, leaving no stone unturned
what she would do differently next time
tips for expectant mums

the impacts of having a big belly and contending with people's comments about it
how that shook her confidence in the last weeks
how she regained her confidence prior to going into labour
letting go of wanting the baby the come and just letting him choose the right time
thanking her baby in early labour for the life changing experience of growing him and acknowledging their next journey together through the rite of passage of birth
how in spite of being at 41 weeks' gestation, she couldn't quite believe that she was really in labour
labour coping strategies (e.g., not saying 'No', insteading saying 'Yes' to contractions)
birthing the baby in the water
birthing the placenta
her newborn's breast crawl
post partum support
claiming the success of her birth as being in large part due to all her preparation, leaving no stone unturned
what she would do differently next time
tips for expectant mums

Enjoy the many nuggets of golden wisdom Oni has to share for other mothers embarking on their journey.

Also mentioned: Best Birth Finder for reviews of birth services www.bestbirthfinder.org.au

Links:
www.oniblecher.com
Instagram @earthedtobirth

Produced and presented by Sally Cusack
Guest: Oni Blecher

Copyright 2026 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>5335birthchoices,earthedtobirth,homebirth,pbbmedia,waterbirthfalsefullAt the threshold of birthing twins - again - with Leila Armourhttps://www.spreaker.com/episode/at-the-threshold-of-birthing-twins-again-with-leila-armour--69164864
In this episode Leila, so very generously shares her experiences of not one, but two twin pregnancies in the 40th week of her second twin pregnancy. We hear how she navigated the complexities of navigating the maternity care system to get the level of care she wanted when birthing her first twins, while also managing to avoid the interventions she didn't want. We explore the narratives surrounding twin pregnancies and how they're "usually" shorter and what Leila has found to be closer to the truth in her experience. We also hear of her recommendations for postpartum with twins, importantly ensuring there's plenty of support for older children so a deep, deep dive into learning about the unique needs of two different newborns, who will want and need very different things.

Leila also has a twin pregnancy and birth guide that she's very happy to share if you message her from her Instagram account. The other resources she mentions that come with her twin pregnancy guide are a reference to the book the Holistic Guide to Twin Pregnancy, which helped inform her about the various types of twin pregnancy, as well as this episode of the Great Rebellion Podcast with Dr Stuart Fischbein: https://www.melaniethemidwife.com/podcasts/the-great-birth-rebellion/episodes/2148000895.

Leila can be found at @villageformama on Instagram and www.villageformama.com.
Image credit: @bennicreative

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.]]>https://api.spreaker.com/episode/69164864Mon, 22 Dec 2025 23:00:08 +0000PBB Media IncorporatedLeila Armour is the Founder of Village for Mama, a project for bridging the gap in postpartum care by fostering a supportive and nourishing community for new mothers. In this episode Leila, so very generously shares her experiences of not one, but...
In this episode Leila, so very generously shares her experiences of not one, but two twin pregnancies in the 40th week of her second twin pregnancy. We hear how she navigated the complexities of navigating the maternity care system to get the level of care she wanted when birthing her first twins, while also managing to avoid the interventions she didn't want. We explore the narratives surrounding twin pregnancies and how they're "usually" shorter and what Leila has found to be closer to the truth in her experience. We also hear of her recommendations for postpartum with twins, importantly ensuring there's plenty of support for older children so a deep, deep dive into learning about the unique needs of two different newborns, who will want and need very different things.

Leila also has a twin pregnancy and birth guide that she's very happy to share if you message her from her Instagram account. The other resources she mentions that come with her twin pregnancy guide are a reference to the book the Holistic Guide to Twin Pregnancy, which helped inform her about the various types of twin pregnancy, as well as this episode of the Great Rebellion Podcast with Dr Stuart Fischbein: https://www.melaniethemidwife.com/podcasts/the-great-birth-rebellion/episodes/2148000895.

Leila can be found at @villageformama on Instagram and www.villageformama.com.
Image credit: @bennicreative

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.]]>4412falsefullThe Herstory of Birth with Wendy Jacksonhttps://www.spreaker.com/episode/the-herstory-of-birth-with-wendy-jackson--68795372Wendy Jackson, mother and retired midwife with 30 years' experience in the UK and Australian maternity care systems, has a lot to say about the massive cultural, social and political issues that surround the world of birth.

Main topics covered:

the importance of honouring and protecting the postnatal period/4th trimester, also known as matrescence,
women need to know the realities of the maternity system, as well as their incredible biology and how to protect its optimal functioining in the system,
defensive, interventionist (and often unquestioned) practices that have evolved over the millenia, especially over the last 100 years.
a resource she has developed for women navigating the perinatal period - her book "Mother Becoming".

Other references mentioned:

Prof. Archie Cochrane "the father of evidence based medicine" who jokingly awarded obstetrics with the "wooden spoon".
Jenny Allenson "The Golden Month"
Transforming Maternity Care Initiative
Dr Andrew Bissets, featured in "Birth Time"
Human Rights in Childbirth
Dr Carol de Costa "The Women's Doc" first professor of obs/gyn in Australia
Robbie Davis Floyd

NOTE: At 15 mins 51 secs, when referring to Dr Liz Fowler "trying to get vaginal birth in", she neglected to include the word "breech", so "trying to get vaginal BREECH birth in".

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.]]>https://api.spreaker.com/episode/68795372Mon, 08 Dec 2025 02:09:41 +0000PBB Media Incorporatedhttps://www.motherbecoming.com.au/, mother and retired midwife with 30 years' experience in the UK and Australian maternity care systems, has a lot to say about the massive cultural, social and political issues that surround the world of birth. Main...Wendy Jackson, mother and retired midwife with 30 years' experience in the UK and Australian maternity care systems, has a lot to say about the massive cultural, social and political issues that surround the world of birth.

Main topics covered:

the importance of honouring and protecting the postnatal period/4th trimester, also known as matrescence,
women need to know the realities of the maternity system, as well as their incredible biology and how to protect its optimal functioining in the system,
defensive, interventionist (and often unquestioned) practices that have evolved over the millenia, especially over the last 100 years.
a resource she has developed for women navigating the perinatal period - her book "Mother Becoming".

Other references mentioned:

Prof. Archie Cochrane "the father of evidence based medicine" who jokingly awarded obstetrics with the "wooden spoon".
Jenny Allenson "The Golden Month"
Transforming Maternity Care Initiative
Dr Andrew Bissets, featured in "Birth Time"
Human Rights in Childbirth
Dr Carol de Costa "The Women's Doc" first professor of obs/gyn in Australia
Robbie Davis Floyd

NOTE: At 15 mins 51 secs, when referring to Dr Liz Fowler "trying to get vaginal birth in", she neglected to include the word "breech", so "trying to get vaginal BREECH birth in".

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.]]>5065falsefullTogether we can Make a Difference with Katherine Edenhttps://www.spreaker.com/episode/together-we-can-make-a-difference-with-katherine-eden--68811543
This time Sally speaks with Katherine Eden, doula, birth advocate and mother of two boys based in South Australia. Eight years ago when birthing her second son, Katherine found herself freebirthing even though she wanted midwifery care, due to the climate of fear and retribution in Adelaide at the time, in large part due to this legislation and the attitudes surrounding it. She also asks whether women's choices would be better enabled through properly supporting private midwifery over the more restrictive, but Medicare funded homebirth services that run from public hospitals.

After trying to sound the alarm years ago to the rest of the country with this blog article, we are now finally all ears. Katherine's key message: when we work together we can achieve real improvements in maternity care. (Birth intervention rates dropped during 2009-2010, a time of mass organisation across the country for improvements in birth, culminating in the Mother of All Rallies in Canberra.)

Other podcasts referred to in this interview:
Tessa Kowliw
https://www.spreaker.com/episode/from-south-australia-with-love-with-tessa-kowaliw--68691041
Bashi Kumar-Hazard
https://www.spreaker.com/episode/how-to-criminalise-birth-with-bashi-kumar-hazard--68410484

Katherine Eden is an integrative therapist, therapeutic social worker, doula, kinesiologist, ceremonialist, rites of passage guide, professional supervisor/mentor and trauma-informed spaceholder with a background in psychology, midwifery, and event facilitation. For nearly 20 years, she has been deeply involved in the Adelaide birth community, co-founding the Adelaide Birth Network and the Doula Network of SA, both of which have grown into thriving hubs of connection.

Katherine's passion lies in trauma-informed, neuroaffirming, and embodied spaceholding, with a strong emphasis on integrity, ethical practice, and the significance of rites of passage. As birth trauma statistics continue to rise, she believes in the power of intentional and conscious spaceholding as well as trauma-informed eduation and supervision to shift these patterns. Her work supports spaceholders in cultivating ethical, heart-led, and attuned practices that foster inner safety and transformation.

Website: www.katherineeden.com
Instagram: www.instagram.com/katherineeden_rewilding
Facebook: www.facebook.com/katherineedenrewilding

Blog about the SA's Restrictive Birthing Practices legislation and Katherine's personal experience with it: https://katherineeden.com/speaking-the-unspeakable-not-celebrating-homebirth/

Other people/references mentioned:

Rachel Reed's article on the Future of Midwifery and Homebirth in Australia
Kelli Zakharoff, Midwife Crisis
Adelaide Birth Network, private Facebook group for Adelaide based women and birth workers
Catherine Bell, Founder of The Birth Map and Managing Director of Maternity Choices Australia

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/68811543Sun, 30 Nov 2025 23:43:14 +0000PBB Media IncorporatedA continuation of our series on the proposed ACM/RANZCOG legislation that will require that only trained registered professionals can "manage" the process of birth....
This time Sally speaks with Katherine Eden, doula, birth advocate and mother of two boys based in South Australia. Eight years ago when birthing her second son, Katherine found herself freebirthing even though she wanted midwifery care, due to the climate of fear and retribution in Adelaide at the time, in large part due to this legislation and the attitudes surrounding it. She also asks whether women's choices would be better enabled through properly supporting private midwifery over the more restrictive, but Medicare funded homebirth services that run from public hospitals.

After trying to sound the alarm years ago to the rest of the country with this blog article, we are now finally all ears. Katherine's key message: when we work together we can achieve real improvements in maternity care. (Birth intervention rates dropped during 2009-2010, a time of mass organisation across the country for improvements in birth, culminating in the Mother of All Rallies in Canberra.)

Other podcasts referred to in this interview:
Tessa Kowliw
https://www.spreaker.com/episode/from-south-australia-with-love-with-tessa-kowaliw--68691041
Bashi Kumar-Hazard
https://www.spreaker.com/episode/how-to-criminalise-birth-with-bashi-kumar-hazard--68410484

Katherine Eden is an integrative therapist, therapeutic social worker, doula, kinesiologist, ceremonialist, rites of passage guide, professional supervisor/mentor and trauma-informed spaceholder with a background in psychology, midwifery, and event facilitation. For nearly 20 years, she has been deeply involved in the Adelaide birth community, co-founding the Adelaide Birth Network and the Doula Network of SA, both of which have grown into thriving hubs of connection.

Katherine's passion lies in trauma-informed, neuroaffirming, and embodied spaceholding, with a strong emphasis on integrity, ethical practice, and the significance of rites of passage. As birth trauma statistics continue to rise, she believes in the power of intentional and conscious spaceholding as well as trauma-informed eduation and supervision to shift these patterns. Her work supports spaceholders in cultivating ethical, heart-led, and attuned practices that foster inner safety and transformation.

Website: www.katherineeden.com
Instagram: www.instagram.com/katherineeden_rewilding
Facebook: www.facebook.com/katherineedenrewilding

Blog about the SA's Restrictive Birthing Practices legislation and Katherine's personal experience with it: https://katherineeden.com/speaking-the-unspeakable-not-celebrating-homebirth/

Other people/references mentioned:

Rachel Reed's article on the Future of Midwifery and Homebirth in Australia
Kelli Zakharoff, Midwife Crisis
Adelaide Birth Network, private...]]>4682birthrights,freebirth,homebirth,midwifery,ranzcogfalse
fullFrom South Australia with Love with Tessa Kowaliwhttps://www.spreaker.com/episode/from-south-australia-with-love-with-tessa-kowaliw--68691041
The Australian College of Midwives (ACM) and the Royal Australian and New Zealand College of Obstetricians and Gynaecologists (RANZCOG) recently published a joint position statement calling for the rollout of this legislation across Australia. https://ranzcog.edu.au/news/ranzcog-acm-call-on-health-ministers-to-end-freebirth-deaths.

We discuss: - The important role SA can play for advising legislators and policy makers with 12 years' experience with this legislation
- The lead up to this law and the birthing landscape in SA since 2013
- Where we are now, 12 years on
- The risk of legislating and asking a broken system to apply this 'reasonably', unintended consequences
- A more appropriate roadmap for offering support for women outside the maternity system with the right level of urgency, in particular rebuilding trust and strengthening consumer partnerships
- Tessa and her colleagues' current efforts to compile a 'From SA With Love' info pack of their lived experiences under the restricted birthing practices law with a view to sharing this with interested consumer community leaders, advocates and decision makers interstate (due to be completed by early December)

Contact can be made with Tessa either through this podcast or at tessakowaliw@gmail.com.

(Article mentioned by Tessa: https://www.rachelreed.website/blog/homebirthaustralia
Book mentioned near end of the interview: Tew, Marjorie, Safer Childbirth? A Critical History of Maternity Care, Chapman and Hall, 1993.)

Tessa Kowaliw is a South Australian consumer advisor who has been working with birthing women, and the people and organisations which serve them, since 2009. In the 2010s, she was Coordinator for CARES (a former South Australian not-for-profit consumer group which supported women to make birth after Caesarean choices), she assisted national efforts to activate increased access to continuity of midwifery care under the National Maternity Services Plan (2010-2015), she has lobbied Health Ministers and local services to better address women's needs, and she founded (and still runs) 'VBAC Chat South Australia' - an active Facebook group of over 1.1K members designed to educate and support women and care providers.

Tessa has been a Special Purpose Director with Women's Healthcare Australasia, was a Councillor for RANZCOG for seven years, is co-author on the standard set of outcome measures for Pregnancy and Birth developed by the International Consortium for Health Outcome Measurement (ICHOM), and has presented internationally (incl. Washington, London, Utrecht) on value-based healthcare and 'what matters most' to healthcare consumers. By day, Tessa is a Business Architect and consultant, juggling corporate work around mothering duties, and her enduring passion for improving women's health.

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/68691041Sun, 23 Nov 2025 23:00:07 +0000PBB Media IncorporatedWe hear from Tessa Kowaliw (pron. ko-VAH-liyev) about birthing in South Australia since the enactment of the Health Practitioner Regulation National Law (South Australia) (Restricted Birthing Practices) Amendment Act 2013, which regulates who can...
The Australian College of Midwives (ACM) and the Royal Australian and New Zealand College of Obstetricians and Gynaecologists (RANZCOG) recently published a joint position statement calling for the rollout of this legislation across Australia. https://ranzcog.edu.au/news/ranzcog-acm-call-on-health-ministers-to-end-freebirth-deaths.

We discuss: - The important role SA can play for advising legislators and policy makers with 12 years' experience with this legislation
- The lead up to this law and the birthing landscape in SA since 2013
- Where we are now, 12 years on
- The risk of legislating and asking a broken system to apply this 'reasonably', unintended consequences
- A more appropriate roadmap for offering support for women outside the maternity system with the right level of urgency, in particular rebuilding trust and strengthening consumer partnerships
- Tessa and her colleagues' current efforts to compile a 'From SA With Love' info pack of their lived experiences under the restricted birthing practices law with a view to sharing this with interested consumer community leaders, advocates and decision makers interstate (due to be completed by early December)

Contact can be made with Tessa either through this podcast or at tessakowaliw@gmail.com.

(Article mentioned by Tessa: https://www.rachelreed.website/blog/homebirthaustralia
Book mentioned near end of the interview: Tew, Marjorie, Safer Childbirth? A Critical History of Maternity Care, Chapman and Hall, 1993.)

Tessa Kowaliw is a South Australian consumer advisor who has been working with birthing women, and the people and organisations which serve them, since 2009. In the 2010s, she was Coordinator for CARES (a former South Australian not-for-profit consumer group which supported women to make birth after Caesarean choices), she assisted national efforts to activate increased access to continuity of midwifery care under the National Maternity Services Plan (2010-2015), she has lobbied Health Ministers and local services to better address women's needs, and she founded (and still runs) 'VBAC Chat South Australia' - an active Facebook group of over 1.1K members designed to educate and support women and care providers.

Tessa has been a Special Purpose Director with Women's Healthcare Australasia, was a Councillor for RANZCOG for seven years, is co-author on the standard set of outcome measures for Pregnancy and Birth developed by the International Consortium for Health Outcome Measurement (ICHOM), and has presented internationally (incl. Washington, London, Utrecht) on value-based healthcare and 'what matters most' to healthcare consumers. By day, Tessa is a Business Architect and consultant, juggling corporate work around mothering duties, and her enduring passion for improving women's health.

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>3142acm,doulas,freebirth,maternityconsumeradvocacy,ranzcogfalsefullA most intentional pregnancy with Oni Blecherhttps://www.spreaker.com/episode/a-most-intentional-pregnancy-with-oni-blecher--68549829
Oni has been a student of birth since she witnessed the birth of her niece 12 years ago, taking her to study midwifery, birth doula care and craniosacral therapy that she provides for mothers and their babies, and facilitating pregnancy and post partum circles. Now, she stands at the threshold of birth as she waits for the arrival of her first baby.

This interview was recorded in the last weeks of Oni's pregnancy with the proviso that we wait until after her baby is born before we publish it. Two months ago, her little one arrived, and Oni has given her permission to share this interview now. We will catch up with her at some point in the future to hear what she'd like to share about the birth and the early months of motherhood.

Sally interviewed another expectant parent in 2015 and again after the birth, but that time with a father, Paul Crebar. You can hear that interview here: https://www.spreaker.com/episode/paul-crebar-on-expectant-fatherhood--7260253

Links:
www.oniblecher.com
Instagram @earthedtobirth

Produced and presented by Sally Cusack
Guest: Oni Blecher

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/68549829Thu, 13 Nov 2025 07:27:04 +0000PBB Media IncorporatedSally speaks with Oni Blecher, former host on the Pregnancy, Birth and Beyond radio show and podcast, and committee member of our organisation, PBB Media since 2018. Oni has been a student of birth since she witnessed the birth of her niece 12 years...
Oni has been a student of birth since she witnessed the birth of her niece 12 years ago, taking her to study midwifery, birth doula care and craniosacral therapy that she provides for mothers and their babies, and facilitating pregnancy and post partum circles. Now, she stands at the threshold of birth as she waits for the arrival of her first baby.

This interview was recorded in the last weeks of Oni's pregnancy with the proviso that we wait until after her baby is born before we publish it. Two months ago, her little one arrived, and Oni has given her permission to share this interview now. We will catch up with her at some point in the future to hear what she'd like to share about the birth and the early months of motherhood.

Sally interviewed another expectant parent in 2015 and again after the birth, but that time with a father, Paul Crebar. You can hear that interview here: https://www.spreaker.com/episode/paul-crebar-on-expectant-fatherhood--7260253

Links:
www.oniblecher.com
Instagram @earthedtobirth

Produced and presented by Sally Cusack
Guest: Oni Blecher

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>3703falsefullImpacts for Rural Birthing: The Perfect Sh*tstorm with Alecia Staineshttps://www.spreaker.com/episode/impacts-for-rural-birthing-the-perfect-sh-tstorm-with-alecia-staines--68457853https://www.facebook.com/share/p/1G2brGjDA9/

Alecia discusses the issues women face in accessing maternity care in rural and regional areas. Since the 1990's we've seen a steady closure of maternity services across the country, forcing women to drive hours from their homes to central services. Naturally this leads to women choosing to birth outside the system. Some of these women would like to engage a private midwife, but they are so hard to find, especially now with the requirement to have not one but two endorsed midwives at home births. And is it possible this legislation could be used against the good Samaritan who stops to help a woman birthing before arrival on her way to a centralised service, or a grandmother or aunty helping a woman who has a precipitous labour and decides to stay at home to give birth. Many questions remain, all due to proposals to further restrict women's access to choice and rights to informed decision making.

Maternity Choices Australia has collaborated with Human Rights in Childbirth International and maternity advocacy groups from around the country to publish the following media release:
https://www.maternitychoices.org.au/post/maternity-advocacy-groups-around-the-country-rally-together-to-protect-women-s-rights-in-birth

Links:
www.maternityconsumernetwork.org.au

Produced and presented by Sally Cusack
Guest: Alecia Staines, Maternity Consumer Network

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/68457853Sun, 09 Nov 2025 22:31:14 +0000PBB Media IncorporatedSally speaks with Alecia Staines, Founder and Director at Maternity Consumer Network about the South Australian legislation that the Australian College of Midwives and the Royal Australian and New Zealand College of Obstetricians and Gynaecologists...https://www.facebook.com/share/p/1G2brGjDA9/

Alecia discusses the issues women face in accessing maternity care in rural and regional areas. Since the 1990's we've seen a steady closure of maternity services across the country, forcing women to drive hours from their homes to central services. Naturally this leads to women choosing to birth outside the system. Some of these women would like to engage a private midwife, but they are so hard to find, especially now with the requirement to have not one but two endorsed midwives at home births. And is it possible this legislation could be used against the good Samaritan who stops to help a woman birthing before arrival on her way to a centralised service, or a grandmother or aunty helping a woman who has a precipitous labour and decides to stay at home to give birth. Many questions remain, all due to proposals to further restrict women's access to choice and rights to informed decision making.

Maternity Choices Australia has collaborated with Human Rights in Childbirth International and maternity advocacy groups from around the country to publish the following media release:
https://www.maternitychoices.org.au/post/maternity-advocacy-groups-around-the-country-rally-together-to-protect-women-s-rights-in-birth

Links:
www.maternityconsumernetwork.org.au

Produced and presented by Sally Cusack
Guest: Alecia Staines, Maternity Consumer Network

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>821falsefullFreebirth is just birth with Catherine Bellhttps://www.spreaker.com/episode/freebirth-is-just-birth-with-catherine-bell--68425819https://www.facebook.com/share/p/1G2brGjDA9/

Catherine discusses the dangers to women's rights this legislation poses (and is already happening in South Australia), especially for women who feel they have no other choice than to birth outside the system, how communication between women and their carers can be improved and the pressures the system places on women to fit within the services it wants to provide.

Maternity Choices Australia has collaborated with Human Rights in Childbirth International and maternity advocacy groups from around the country to publish the following media release:
https://www.maternitychoices.org.au/post/maternity-advocacy-groups-around-the-country-rally-together-to-protect-women-s-rights-in-birth

Links:
www.maternitychoices.org.au
www.thebirthmap.life

Produced and presented by Sally Cusack
Guest: Dr Catherine Bell, Maternity Choices Australia, The Birth Map

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/68425819Wed, 05 Nov 2025 05:09:09 +0000PBB Media IncorporatedSally speaks with Dr Catherine Bell, Maternity Choices Australia and Founder of The Birth Map about the South Australian legislation that the Australian College of Midwives and the Royal Australian and New Zealand College of Obstetricians and...https://www.facebook.com/share/p/1G2brGjDA9/

Catherine discusses the dangers to women's rights this legislation poses (and is already happening in South Australia), especially for women who feel they have no other choice than to birth outside the system, how communication between women and their carers can be improved and the pressures the system places on women to fit within the services it wants to provide.

Maternity Choices Australia has collaborated with Human Rights in Childbirth International and maternity advocacy groups from around the country to publish the following media release:
https://www.maternitychoices.org.au/post/maternity-advocacy-groups-around-the-country-rally-together-to-protect-women-s-rights-in-birth

Links:
www.maternitychoices.org.au
www.thebirthmap.life

Produced and presented by Sally Cusack
Guest: Dr Catherine Bell, Maternity Choices Australia, The Birth Map

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>1215advocacy,birth,birthchoices,doulas,freebirth,humanrightsinchildbirth,maternity,pregnancyfalsefullHow to criminalise birth with Bashi Kumar-Hazardhttps://www.spreaker.com/episode/how-to-criminalise-birth-with-bashi-kumar-hazard--68410484https://www.facebook.com/share/p/1G2brGjDA9/

Bashi argues that this will have the effect of impacting women's human rights to birth wherever and with whomever they choose, as it already is in South Australia. Instead, Bashi asks why governments and lobby groups aren't exploring what it is about their practice that has women choosing to avoid going to hospital.

Human Rights in Childbirth and Maternity Choices Australia have collaborated, along with maternity advocacy groups from around the country, to publish the following media release:
https://www.maternitychoices.org.au/post/maternity-advocacy-groups-around-the-country-rally-together-to-protect-women-s-rights-in-birth

Links:
https://www.humanrightsinchildbirth.org/
www.maternitychoices.org.au

Produced and presented by Sally Cusack
Guest: Dr Bashi Kumar-Hazard, Human Rights in Childbirth

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/68410484Tue, 04 Nov 2025 09:28:48 +0000PBB Media IncorporatedSally speaks with Dr Bashi Kumar-Hazard, lawyer and Board Chair of Human Rights in Childbirth International about the South Australian legislation that the Australian College of Midwives and the Royal Australian and New Zealand College of...https://www.facebook.com/share/p/1G2brGjDA9/

Bashi argues that this will have the effect of impacting women's human rights to birth wherever and with whomever they choose, as it already is in South Australia. Instead, Bashi asks why governments and lobby groups aren't exploring what it is about their practice that has women choosing to avoid going to hospital.

Human Rights in Childbirth and Maternity Choices Australia have collaborated, along with maternity advocacy groups from around the country, to publish the following media release:
https://www.maternitychoices.org.au/post/maternity-advocacy-groups-around-the-country-rally-together-to-protect-women-s-rights-in-birth

Links:
https://www.humanrightsinchildbirth.org/
www.maternitychoices.org.au

Produced and presented by Sally Cusack
Guest: Dr Bashi Kumar-Hazard, Human Rights in Childbirth

Copyright 2025 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>2424birthchoices,birthkeeper,birthrights,doula,freebirth,homebirthfalsefullBest Birth Finder with Sally Cusackhttps://www.spreaker.com/episode/best-birth-finder-with-sally-cusack--63387869
This is a special interview for Oni as this will be her last podcast interview under Pregnancy, Birth, and Beyond. She pays her respect to her time at Pregnancy, Birth, and Beyond and PBB Media and expresses gratitide to all guests, listeners, and experiences.

You can find Sally and Best Birth Finder below:

hello@pbbmedia.org

https://www.bestbirthfinder.org.au

And if you have any feedback, questions, or curiosities for Oni, you're welcome to contact her via

@oni_keeperofthehearth

oni.blecher@gmail.com]]>https://api.spreaker.com/episode/63387869Sat, 21 Dec 2024 03:35:56 +0000PBB Media IncorporatedToday, Oni Blecher interviews Sally Cusack. Sally Cusack is a mother of two teenagers based in Northern NSW. She is the co-founder of PBB Media and now runs PBB Media’s weekly free baby and toddler clothes swap and drop in centre, best known as the...
This is a special interview for Oni as this will be her last podcast interview under Pregnancy, Birth, and Beyond. She pays her respect to her time at Pregnancy, Birth, and Beyond and PBB Media and expresses gratitide to all guests, listeners, and experiences.

You can find Sally and Best Birth Finder below:

hello@pbbmedia.org

https://www.bestbirthfinder.org.au

And if you have any feedback, questions, or curiosities for Oni, you're welcome to contact her via

@oni_keeperofthehearth

oni.blecher@gmail.com]]>4103birth,health,love,motherhood,parenthood,postpartum,pregnancyfalsefullMy Breech Birth With Zoë Rose Gameauhttps://www.spreaker.com/episode/my-breech-birth-with-zoe-rose-gameau--62254509
Her current work is in creative development as Executive Producer at a sustainable film production company, Green Thumb Media. In the past, whilst being primary carer mothering two young children, she worked closer to home, founding How We Gather, a profit for purpose company facilitating health coaching for individuals and groups with creative methods and circle gatherings. She also worked part time for the not-for-profit group Environmental Leadership Australia which further deepened her engagement with the reality of the challenge we face environmentally and some of the solutions available. Previously an actress, Zoë worked with almost every major TV network in Australia, also contributing behind the scenes and featured in the documentaries That Sugar Film and 2040. As a published author she contributed to books 1 & 2 of That Sugar Guide - A Pan Mac Millan publication.

The weaving of these worlds leads Zoë to where she is today; combining all her efforts to bring about the sharing of meaningful stories to help shape a healthy society and environment in a responsible, wise and artistic way, whilst taking time to enjoy the simplicity of her surroundings and raising her children lovingly.

Find Zoë at her film production company here:

https://www.greenthumbmedia.com.au

]]>https://api.spreaker.com/episode/62254509Sun, 06 Oct 2024 18:00:02 +0000PBB Media IncorporatedToday, Oni Blecher speaks with Zoë Rose Gameau to hear Zoë's breech birth story. Zoë is a mother of two girls and lover of nature. She lives with her daughters in a tiny studio home nestled amongst the trees and streams of the Northern Rivers of New...
Her current work is in creative development as Executive Producer at a sustainable film production company, Green Thumb Media. In the past, whilst being primary carer mothering two young children, she worked closer to home, founding How We Gather, a profit for purpose company facilitating health coaching for individuals and groups with creative methods and circle gatherings. She also worked part time for the not-for-profit group Environmental Leadership Australia which further deepened her engagement with the reality of the challenge we face environmentally and some of the solutions available. Previously an actress, Zoë worked with almost every major TV network in Australia, also contributing behind the scenes and featured in the documentaries That Sugar Film and 2040. As a published author she contributed to books 1 & 2 of That Sugar Guide - A Pan Mac Millan publication.

The weaving of these worlds leads Zoë to where she is today; combining all her efforts to bring about the sharing of meaningful stories to help shape a healthy society and environment in a responsible, wise and artistic way, whilst taking time to enjoy the simplicity of her surroundings and raising her children lovingly.

Find Zoë at her film production company here:

https://www.greenthumbmedia.com.au

]]>3911birth,breech,childcare,children,fatherhood,love,midwife,motherhood,parenting,postpartum,pregnancyfalsefullUPDATES For Proposed Changes To Homebirth And The Birth Trauma Inquiry Report with Fiona O'Shaughnessyhttps://www.spreaker.com/episode/updates-for-proposed-changes-to-homebirth-and-the-birth-trauma-inquiry-report-with-fiona-o-shaughnessy--62052707
In this episode, Fiona also updates us on the birth trauma inquiry report and its successes, follow ups, and ways to assist the changes that have been suggested.

Fiona is a mum of 3, doula, childbirth educator, independent consumer representative for the Northern NSW LHD and a consumer advocate, representing the charity Hygieia Health. She's speaking to us today in her capacity working with Hygieia.

Hygieia Health is dedicated to the sacred work of birth and the impact it has on the physical, emotional, and psychological well-being of women, their families, and birth workers. We believe that “Peace on Earth begins at Birth,” as Jeanine Parvarti Baker so poignantly stated. As a non-profit organization with a charitable purpose of promoting the prevention and treatment of birth trauma, we strive to provide birth workers, obstetricians, midwives, and doulas with the knowledge and skills necessary to care for themselves and others, and to return birth to its rightful place as a profound rite of passage.

Letter Template & Call to Action: (Scroll down):

https://www.homebirthaustralia.org/call-to-action.html

Hygieia Heath:

https://hygieiahealth.org

@hygieiahealthltd

Homebirth Australia:

https://www.homebirthaustralia.org

History of PII (Professional Indemnity Insurance) for privately practicing midwives:

https://www.homebirthaustralia.org/professional-indemnity-insurance.html

Born at Home Film:

https://bornathomefilm.com

]]>https://api.spreaker.com/episode/62052707Sun, 22 Sep 2024 19:00:02 +0000PBB Media IncorporatedToday, Oni Blecher speaks with Fiona O'Shaughnessy. This is the third part in a series discussing the issue of the proposed changes to privately praciting midwives insurance in homebirth. For more info and a background to this issue, please listen to...
In this episode, Fiona also updates us on the birth trauma inquiry report and its successes, follow ups, and ways to assist the changes that have been suggested.

Fiona is a mum of 3, doula, childbirth educator, independent consumer representative for the Northern NSW LHD and a consumer advocate, representing the charity Hygieia Health. She's speaking to us today in her capacity working with Hygieia.

Hygieia Health is dedicated to the sacred work of birth and the impact it has on the physical, emotional, and psychological well-being of women, their families, and birth workers. We believe that “Peace on Earth begins at Birth,” as Jeanine Parvarti Baker so poignantly stated. As a non-profit organization with a charitable purpose of promoting the prevention and treatment of birth trauma, we strive to provide birth workers, obstetricians, midwives, and doulas with the knowledge and skills necessary to care for themselves and others, and to return birth to its rightful place as a profound rite of passage.

Letter Template & Call to Action: (Scroll down):

https://www.homebirthaustralia.org/call-to-action.html

Hygieia Heath:

https://hygieiahealth.org

@hygieiahealthltd

Homebirth Australia:

https://www.homebirthaustralia.org

History of PII (Professional Indemnity Insurance) for privately practicing midwives:

https://www.homebirthaustralia.org/professional-indemnity-insurance.html

Born at Home Film:

https://bornathomefilm.com

]]>2611falsefullFirst Nations Postpartum Care With Kirilly Dawnhttps://www.spreaker.com/episode/first-nations-postpartum-care-with-kirilly-dawn--61764877
We acknowledge the Traditional Owners of this land, the Arakwal people, the Minjungbal people and the Widjabul people of the Bundjalung Nation and the many other tribes that frequented this land. I pay my respects to elders past and present and emerging. As a team and organisation, we acknowledge the traditional owners of this land and waters whose cultures and customs have nurtured and continue to nurture this land. We acknowledge that sovereignty was never ceded and recognition of culture, connection to land and waters and sovereignty of all aboriginal/indigenous peoples across Australia is a matter of current and vital importance.

Today, Oni Blecher speaks with Kirilly Dawn. Kirilly is a Barkanji woman, a doula, and she runs the postpartum postpartum care program for The Returning Indigenous Corporation. Kirilly has also been on the development team with us here at PBB Media for the past 5 years. The work of the returning relies on the generous support of donations from the community and if you support their work and what they’re doing, you can go to their website, www.thereturning.com.au and find many different ways to support this amazing NFP.

Find The Returning here:

www.thereturning.com.au

@the_returning_

Thanks for tuning in ! Feel free to be in touch with us at

@pbb_media

hello@pbbmedia.org]]>https://api.spreaker.com/episode/61764877Sun, 15 Sep 2024 23:09:49 +0000PBB Media IncorporatedWelcome to Pregnancy, Birth and Beyond: Contemporary Conversations where stories, science, traditions and new ideas meet. I’m Oni Blecher and your host today. Pregnancy, Birth and Beyond Media, our development team and contributors pay our respects to...
We acknowledge the Traditional Owners of this land, the Arakwal people, the Minjungbal people and the Widjabul people of the Bundjalung Nation and the many other tribes that frequented this land. I pay my respects to elders past and present and emerging. As a team and organisation, we acknowledge the traditional owners of this land and waters whose cultures and customs have nurtured and continue to nurture this land. We acknowledge that sovereignty was never ceded and recognition of culture, connection to land and waters and sovereignty of all aboriginal/indigenous peoples across Australia is a matter of current and vital importance.

Today, Oni Blecher speaks with Kirilly Dawn. Kirilly is a Barkanji woman, a doula, and she runs the postpartum postpartum care program for The Returning Indigenous Corporation. Kirilly has also been on the development team with us here at PBB Media for the past 5 years. The work of the returning relies on the generous support of donations from the community and if you support their work and what they’re doing, you can go to their website, www.thereturning.com.au and find many different ways to support this amazing NFP.

Find The Returning here:

www.thereturning.com.au

@the_returning_

Thanks for tuning in ! Feel free to be in touch with us at

@pbb_media

hello@pbbmedia.org]]>3863aboriginal,birth,children,family,fatherhood,indigenous,motherhood,parenthood,postpartum,pregnancyfalsefullA Well of Wisdom: Birth Work and Pelvic Health with Jenny Blythhttps://www.spreaker.com/episode/a-well-of-wisdom-birth-work-and-pelvic-health-with-jenny-blyth--61165074Today Oni Blecher interviews Jenny Blyth.

Jenny has supported parents in natural birth for over 40 years. She is an independent birth educator, bodyworker, Associate Practitioner of Ortho-Bionomy, Spinning Babies® Approved Trainer, Spinning Babies® Aware Practitioner & Trainer, & Internal Pelvic Release Work Practitioner & Trainer. Her particular focus is on body preparation for birth & recovery, & encouraging greater self-responsibility in parents - to realise potential in birth & reduce birth trauma. She specialises in pelvic bodywork for wellbeing, balance, comfort & healing. Jenny regularly facilitates workshops in Australia & overseas. She is project co-ordinator for Lao Birthwork, teaching hands-on & emergency skills to health staff in remote areas of Northern Laos. She is also an author – The Down to Earth Birth Book, Birthwork, The little book of Pelvic Jiggling - & filmmaker -The Big Stretch films & A World of Birthworkers.

We are so happy to have Jenny on the show today. She is such a deep well of wisdom in the pregnancy, birth, postpartum and female health continuum. Jenny will be speaking at the upcoming Postpartum Conference which will be a great way to hear more of her lessons and wisdoms. Us from PBB will also be there and will be be doing interviews and taking comments from the participants. So if you’re there and want to meet us, come and say hello !

Jenny Blyth

www.birthwork.com

Postpartum conference:

https://www.gentletraditions.xyz/professional-conferences-well-supported-mothers-collective

]]>https://api.spreaker.com/episode/61165074Tue, 27 Aug 2024 00:51:25 +0000PBB Media IncorporatedToday Oni Blecher interviews Jenny Blyth. Jenny has supported parents in natural birth for over 40 years. She is an independent birth educator, bodyworker, Associate Practitioner of Ortho-Bionomy, Spinning Babies® Approved Trainer, Spinning Babies®...Today Oni Blecher interviews Jenny Blyth.

Jenny has supported parents in natural birth for over 40 years. She is an independent birth educator, bodyworker, Associate Practitioner of Ortho-Bionomy, Spinning Babies® Approved Trainer, Spinning Babies® Aware Practitioner & Trainer, & Internal Pelvic Release Work Practitioner & Trainer. Her particular focus is on body preparation for birth & recovery, & encouraging greater self-responsibility in parents - to realise potential in birth & reduce birth trauma. She specialises in pelvic bodywork for wellbeing, balance, comfort & healing. Jenny regularly facilitates workshops in Australia & overseas. She is project co-ordinator for Lao Birthwork, teaching hands-on & emergency skills to health staff in remote areas of Northern Laos. She is also an author – The Down to Earth Birth Book, Birthwork, The little book of Pelvic Jiggling - & filmmaker -The Big Stretch films & A World of Birthworkers.

We are so happy to have Jenny on the show today. She is such a deep well of wisdom in the pregnancy, birth, postpartum and female health continuum. Jenny will be speaking at the upcoming Postpartum Conference which will be a great way to hear more of her lessons and wisdoms. Us from PBB will also be there and will be be doing interviews and taking comments from the participants. So if you’re there and want to meet us, come and say hello !

Jenny Blyth

www.birthwork.com

Postpartum conference:

https://www.gentletraditions.xyz/professional-conferences-well-supported-mothers-collective

]]>4521falsefullGrandmother Doula with Anna Wattshttps://www.spreaker.com/episode/grandmother-doula-with-anna-watts--61074983Celebration of Birth, and has been guiding women and their partners through the journey of pregnancy and birth for over 30 years. Anna believes in honouring and celebrating birth as a ‘rite of passage’ for mother, father and baby, supporting empowered birthing choices and strengthening the spiritual connection in pregnancy and birth.

Anna’s experience as a Childbirth Educator, Doula Trainer, Prenatal Yoga Teacher, Spiritual Healer, Counsellor and mother of two beautiful daughters both born at home – one a water birth – brings a depth and grounded warmth to her teaching.

Anna also Co-Authored ‘Birthing the Spirit’ – Guide to Conscious Conception, Pregnancy and Birth – a beautiful set of cards with guidebook offering inspiration and guidance to support the spiritual connection at this transformative time.

Anna is a passionate traveller and has spent time teaching, learning and assisting in birth communities around the world, including the FreMo Birth Centre, Nairobi, Kenya; Da-a-Luz Midwifery School, Andalucia, Spain; Midwife & Doula Community, Queretaro, Mexico. Sharing women’s wisdom with a diverse range of birth professionals has greatly enhanced Anna’s birthing knowledge and the way she passes on holistic skills to both pregnant women and doulas alike.

Anna recently became a Grandmother; which was an inspiration for this episode. We have had Anna on the show before and we were keen to hear about her transition into grandmotherhood. In the Maga season of her life, Anna is delighting in supporting her family to blossom and flourish by holding true holistic care at the centre of wellbeing for future generations. The red thread lineage continues to be grounded in deep trust for birthing wisdom.

To get in touch with Anna's offerings, see below

https://www.celebrationofbirth.com

@sacredbirthsacredearth ]]>https://api.spreaker.com/episode/61074983Mon, 19 Aug 2024 00:05:38 +0000PBB Media IncorporatedToday Oni Blecher speaks with Anna Watts. Anna is the Founder of Celebration of Birth, and has been guiding women and their partners through the journey of pregnancy and birth for over 30 years. Anna believes in honouring and celebrating birth as a...Celebration of Birth, and has been guiding women and their partners through the journey of pregnancy and birth for over 30 years. Anna believes in honouring and celebrating birth as a ‘rite of passage’ for mother, father and baby, supporting empowered birthing choices and strengthening the spiritual connection in pregnancy and birth.

Anna’s experience as a Childbirth Educator, Doula Trainer, Prenatal Yoga Teacher, Spiritual Healer, Counsellor and mother of two beautiful daughters both born at home – one a water birth – brings a depth and grounded warmth to her teaching.

Anna also Co-Authored ‘Birthing the Spirit’ – Guide to Conscious Conception, Pregnancy and Birth – a beautiful set of cards with guidebook offering inspiration and guidance to support the spiritual connection at this transformative time.

Anna is a passionate traveller and has spent time teaching, learning and assisting in birth communities around the world, including the FreMo Birth Centre, Nairobi, Kenya; Da-a-Luz Midwifery School, Andalucia, Spain; Midwife & Doula Community, Queretaro, Mexico. Sharing women’s wisdom with a diverse range of birth professionals has greatly enhanced Anna’s birthing knowledge and the way she passes on holistic skills to both pregnant women and doulas alike.

Anna recently became a Grandmother; which was an inspiration for this episode. We have had Anna on the show before and we were keen to hear about her transition into grandmotherhood. In the Maga season of her life, Anna is delighting in supporting her family to blossom and flourish by holding true holistic care at the centre of wellbeing for future generations. The red thread lineage continues to be grounded in deep trust for birthing wisdom.

To get in touch with Anna's offerings, see below

https://www.celebrationofbirth.com

@sacredbirthsacredearth ]]>3145baby,birth,doula,healthcare,love,maternityhealth,mother,parenting,postpartum,pregnancy,spiritualfalsefullUPDATE and Next Steps for Proposed Changes to Homebirth in Australia With Fiona O'Shaughnessyhttps://www.spreaker.com/episode/update-and-next-steps-for-proposed-changes-to-homebirth-in-australia-with-fiona-o-shaughnessy--60941299
This is an update episode from our last episode with Fiona titled 'Proposed Changes to Homebirth in Australia' around one month ago. If you haven't listened to this episode, we recommend that you do. This episode is an update on the survey that Homebirth Australia, and Hygeia Health circulated to advocate for optimal consumer access to privately practicing midwives and hombeirth. Today, Fiona shares the results of this sruvey as a part of the consultation process that is happening on a federal level. Have a listen and hear how you can best support the next steps.

Below are some useful links to be updated on this issue.

Survey results: https://actionnetwork.org/user_files/user_files/000/110/933/original/Homebirth_Australia_survey_report.pdf_2024-07-29_11_11_56.pdf

History of issue: https://www.homebirthaustralia.org/professional-indemnity-insurance.html

Donate to support our travel: https://www.homebirthaustralia.org/donate.html

Petition for birth trauma reqs: https://www.betterbirthsillawarra.org.au/birthtraumapetition

Hygieia Health is dedicated to the sacred work of birth and the impact it has on the physical, emotional, and psychological well-being of women, their families, and birth workers. We believe that “Peace on Earth begins at Birth,” as Jeanine Parvarti Baker so poignantly stated. As a non-profit organization with a charitable purpose of promoting the prevention and treatment of birth trauma, we strive to provide birth workers, obstetricians, midwives, and doulas with the knowledge and skills necessary to care for themselves and others, and to return birth to its rightful place as a profound rite of passage.

Their mission is to support women on their journey to childbirth, ensuring that they receive safe and trauma-free birth services and support. We aim to raise awareness of the occurrence and consequences of birth trauma and provide women and birth workers with the tools and support they need to prepare for and experience a safe, positive birth.

Advocacy groups such as HH, Homebirth Australia, Maternity choices Australia, and us here at PBB Media spend a considerable amount of time translating some of these deeply rooted political stirrings or changes in to smaller bite sized information segments so that we can all come together in our united aim to ensure optimal freedom of choice in childbirth, however that may look for you.

We always welcome your feedback and thoughts. Leave us a review, rating, instagram comment or DM, or simply be in touch via email through hello@pbbmedia.org

Thanks for tuning in !

]]>https://api.spreaker.com/episode/60941299Wed, 07 Aug 2024 00:10:34 +0000PBB Media IncorporatedToday, Oni Blecher speaks with Fiona O'Shaughnessy. Fiona is a mum of 3, doula, childbirth educator, independent consumer representative for the Northern NSW LHD and a consumer advocate, representing the charity Hygieia Health. She's speaking to us...
This is an update episode from our last episode with Fiona titled 'Proposed Changes to Homebirth in Australia' around one month ago. If you haven't listened to this episode, we recommend that you do. This episode is an update on the survey that Homebirth Australia, and Hygeia Health circulated to advocate for optimal consumer access to privately practicing midwives and hombeirth. Today, Fiona shares the results of this sruvey as a part of the consultation process that is happening on a federal level. Have a listen and hear how you can best support the next steps.

Below are some useful links to be updated on this issue.

Survey results: https://actionnetwork.org/user_files/user_files/000/110/933/original/Homebirth_Australia_survey_report.pdf_2024-07-29_11_11_56.pdf

History of issue: https://www.homebirthaustralia.org/professional-indemnity-insurance.html

Donate to support our travel: https://www.homebirthaustralia.org/donate.html

Petition for birth trauma reqs: https://www.betterbirthsillawarra.org.au/birthtraumapetition

Hygieia Health is dedicated to the sacred work of birth and the impact it has on the physical, emotional, and psychological well-being of women, their families, and birth workers. We believe that “Peace on Earth begins at Birth,” as Jeanine Parvarti Baker so poignantly stated. As a non-profit organization with a charitable purpose of promoting the prevention and treatment of birth trauma, we strive to provide birth workers, obstetricians, midwives, and doulas with the knowledge and skills necessary to care for themselves and others, and to return birth to its rightful place as a profound rite of passage.

Their mission is to support women on their journey to childbirth, ensuring that they receive safe and trauma-free birth services and support. We aim to raise awareness of the occurrence and consequences of birth trauma and provide women and birth workers with the tools and support they need to prepare for and experience a safe, positive birth.

Advocacy groups such as HH, Homebirth Australia, Maternity choices Australia, and us here at PBB Media spend a considerable amount of time translating some of these deeply rooted political stirrings or changes in to smaller bite sized information segments so that we can all come together in our united aim to ensure optimal freedom of choice in childbirth, however that may look for you.

We always welcome your feedback and thoughts. Leave us a review, rating, instagram comment or DM, or simply be in touch via email through hello@pbbmedia.org

Thanks for tuning in !

]]>2229advocacy,australia,birth,homebirth,love,maternity,parenting,postpartum,pregnancyfalsefullProgressive Postpartum Approaches with Oscar Serrelach and Naomi Janssonhttps://www.spreaker.com/episode/progressive-postpartum-approaches-with-oscar-serrelach-and-naomi-jansson--60796950
Dr Oscar specialises in postnatal depletion and his medical expertise centres around optimising Mothers health and wellness. “He deeply believe that if Mothers are well, families can be well. And if families are well, then society has a much better chance of being well." Researching Postnatal Recovery for almost 10 years, Dr. Oscar Serrallach has shared his knowledge on Postnatal Depletion and fourth trimester healing with his revolutionary book, “The Postnatal Depletion Cure.” Today, Dr. Oscar Serrallach continues to offer medical consultations and retreats around Byron Bay New South Wales in Australia, whilst building the resources and community for the MotherCare Project alongside his partner Caroline.

For those of you who don’t know or are new to Pregnancy, Birth, and Beyond; Dr Serrelach, his wife Caroline, and The Health Lodge have also been long time supporters of us here at PBB Media and have also contributed greatly to Pregnancy, Birth, and Beyond podcast since its inception. Big thanks to you two for being such active, supportive, and generous members of our community.

Naomi is a traditional medicine practitioner, with over 20 years of experience. She weaves a wealth of expertise from diverse healthcare settings to provide clinical care and education. She is dedicated Advocate for Traditional Medicine especially in Women's Health and Birth/Reproductive Health services. She holds the vision of Culturally oriented and Mother centred experiences for Women during childbearing and rites of passage. Naomi often speaks at conferences and for podcasts to inform on the importance of Cultural Practices and Medicines in Women's Health. Pertinent to this interview, Naomi is hosting a postpartum conference in Coolangatta, Tweed in December.
Today, Naomi and I speak to Oscar, and each other about some of the sciences and themes that will be highlighted in Naomi’s upcoming conference where Oscar will be a key note speaker. This was a really enjoyable conversation that reiterated my own sense of purpose or re stoked the fire of advocating for mothers and families with young children.

Please see their website details below !

POSTPARTUM CONFERENCE DETAILS:

https://www.gentletraditions.xyz/professional-conferences-well-supported-mothers-collective

https://www.droscarserrallach.com

https://www.gentletraditions.xyz

]]>https://api.spreaker.com/episode/60796950Thu, 25 Jul 2024 19:00:04 +0000PBB Media IncorporatedToday, Oni Blecher and Naomi Jannsen both speak with Dr. Oscar Serrelach. Naomi joins us as a guest interviewer for this conversation with Oscar Serrelach for the upcoming Postpartum Conference hosted by Well Supported Mother. Dr Oscar specialises...
Dr Oscar specialises in postnatal depletion and his medical expertise centres around optimising Mothers health and wellness. “He deeply believe that if Mothers are well, families can be well. And if families are well, then society has a much better chance of being well." Researching Postnatal Recovery for almost 10 years, Dr. Oscar Serrallach has shared his knowledge on Postnatal Depletion and fourth trimester healing with his revolutionary book, “The Postnatal Depletion Cure.” Today, Dr. Oscar Serrallach continues to offer medical consultations and retreats around Byron Bay New South Wales in Australia, whilst building the resources and community for the MotherCare Project alongside his partner Caroline.

For those of you who don’t know or are new to Pregnancy, Birth, and Beyond; Dr Serrelach, his wife Caroline, and The Health Lodge have also been long time supporters of us here at PBB Media and have also contributed greatly to Pregnancy, Birth, and Beyond podcast since its inception. Big thanks to you two for being such active, supportive, and generous members of our community.

Naomi is a traditional medicine practitioner, with over 20 years of experience. She weaves a wealth of expertise from diverse healthcare settings to provide clinical care and education. She is dedicated Advocate for Traditional Medicine especially in Women's Health and Birth/Reproductive Health services. She holds the vision of Culturally oriented and Mother centred experiences for Women during childbearing and rites of passage. Naomi often speaks at conferences and for podcasts to inform on the importance of Cultural Practices and Medicines in Women's Health. Pertinent to this interview, Naomi is hosting a postpartum conference in Coolangatta, Tweed in December.
Today, Naomi and I speak to Oscar, and each other about some of the sciences and themes that will be highlighted in Naomi’s upcoming conference where Oscar will be a key note speaker. This was a really enjoyable conversation that reiterated my own sense of purpose or re stoked the fire of advocating for mothers and families with young children.

Please see their website details below !

POSTPARTUM CONFERENCE DETAILS:

https://www.gentletraditions.xyz/professional-conferences-well-supported-mothers-collective

https://www.droscarserrallach.com

https://www.gentletraditions.xyz

]]>3065birth,children,love,motherhood,parenting,postnatal,postpartum,pregnancy,pregnancybirthandbeyond,progressivefalsefullEmbracing The Body With Edie Bartleyhttps://www.spreaker.com/episode/embracing-the-body-with-edie-bartley--60627730
Edie’s work aims to normalise conversations around sex and pleasure and the social and cultural discourse around both. She sheds light on topics relating to nervous system health, navigating stress and overwhelm, self worth, self compassion and acceptance, dealing with chronic pain or illness, menstrual cycle health, consent, boundaries and relationships. In this interview we also cover menstrual shame; the topic of Edie's thesis. Edie’s work expands into realms of the grater human experience, with healing and wellbeing. She offers a safe space, where anything and everything can be spoken, acknowledged, seen and accepted

In this conversation, we span many topics and curiosities; all aligning to embracing the body at many different life stages.

Enjoy this conversation and check out Edie's work here:

https://www.ediebartley.com

@with.edie]]>https://api.spreaker.com/episode/60627730Mon, 08 Jul 2024 00:20:32 +0000PBB Media IncorporatedIn this epsiode, Oni Blecher speaks with Edie Barltey. Edie is a Sexologist and Art therapist with a background in psychotherapy. Edie has also complted her doula training and has assisted birth. Her approach as both a therapist and a human being is...
Edie’s work aims to normalise conversations around sex and pleasure and the social and cultural discourse around both. She sheds light on topics relating to nervous system health, navigating stress and overwhelm, self worth, self compassion and acceptance, dealing with chronic pain or illness, menstrual cycle health, consent, boundaries and relationships. In this interview we also cover menstrual shame; the topic of Edie's thesis. Edie’s work expands into realms of the grater human experience, with healing and wellbeing. She offers a safe space, where anything and everything can be spoken, acknowledged, seen and accepted

In this conversation, we span many topics and curiosities; all aligning to embracing the body at many different life stages.

Enjoy this conversation and check out Edie's work here:

https://www.ediebartley.com

@with.edie]]>4540birth,childbearing,embodiment,love,maternityhealth,parenting,postpartum,pregnancy,psychotherapy,sex,sexpositivefalsefullThe Importance of Gathering for Pregnancy, Birth, and Postpartum with Sali and Naomihttps://www.spreaker.com/episode/the-importance-of-gathering-for-pregnancy-birth-and-postpartum-with-sali-and-naomi--60380227
Sali is an antenatal educator, author midwife, Arvigo practitioner and teacher, and mother of four adult children, all born at home. She also runs Heart and Soul of Wellness which is a wellness centre in Murwillumbah where she runs pregnancy and postpartum groups, amongst many more offerings.

Naomi is a traditional medicine practitioner, with over 20 years of experience. She weaves a wealth of expertise from diverse healthcare settings to provide clinical care and education. She is dedicated Advocate for Traditional Medicine especially in Women's Health and Birth/Reproductive Health services. She holds the vision of Culturally oriented and Mother centred experiences for Women during childbearing and rites of passage. Naomi often speaks at conferences and for podcasts to inform on the importance of Cultural Practices and Medicines in Women's Health.

Together, these two run a festival called Birth Wellness festival, which is a coming together of parents, families, and practitioners and clinicians in the area for greater connection of community and services relevant to the pregnancy, birth, and postpartum period. In this interview we speak a lot about the importance of gathering in real life embodied spaces to create greater sense of care and togetherness in community.

Birth Wellness Festival:

https://events.humanitix.com/birth-wellness-festival-2024

Sali:

https://heartandsoulofwellness.com.au

Naomi:

https://www.gentletraditions.xyz/

]]>https://api.spreaker.com/episode/60380227Sun, 16 Jun 2024 19:00:03 +0000PBB Media IncorporatedToday I speak with Sali McIntyre and Naomi Jannsson. Sali is an antenatal educator, author midwife, Arvigo practitioner and teacher, and mother of four adult children, all born at home. She also runs Heart and Soul of Wellness which is a wellness...
Sali is an antenatal educator, author midwife, Arvigo practitioner and teacher, and mother of four adult children, all born at home. She also runs Heart and Soul of Wellness which is a wellness centre in Murwillumbah where she runs pregnancy and postpartum groups, amongst many more offerings.

Naomi is a traditional medicine practitioner, with over 20 years of experience. She weaves a wealth of expertise from diverse healthcare settings to provide clinical care and education. She is dedicated Advocate for Traditional Medicine especially in Women's Health and Birth/Reproductive Health services. She holds the vision of Culturally oriented and Mother centred experiences for Women during childbearing and rites of passage. Naomi often speaks at conferences and for podcasts to inform on the importance of Cultural Practices and Medicines in Women's Health.

Together, these two run a festival called Birth Wellness festival, which is a coming together of parents, families, and practitioners and clinicians in the area for greater connection of community and services relevant to the pregnancy, birth, and postpartum period. In this interview we speak a lot about the importance of gathering in real life embodied spaces to create greater sense of care and togetherness in community.

Birth Wellness Festival:

https://events.humanitix.com/birth-wellness-festival-2024

Sali:

https://heartandsoulofwellness.com.au

Naomi:

https://www.gentletraditions.xyz/

]]>2400falsefullProposed Changes to Homebirth in Australia with Fiona O'Shaughnessyhttps://www.spreaker.com/episode/proposed-changes-to-homebirth-in-australia-with-fiona-o-shaughnessy--60344580
Hygieia Health is dedicated to the sacred work of birth and the impact it has on the physical, emotional, and psychological well-being of women, their families, and birth workers. They believe that “Peace on Earth begins at Birth,” as Jeanine Parvarti Baker so poignantly stated. As a non-profit organization with a charitable purpose of promoting the prevention and treatment of birth trauma, they strive to provide birth workers, obstetricians, midwives, and doulas with the knowledge and skills necessary to care for themselves and others, and to return birth to its rightful place as a profound rite of passage. Their mission is to support women on their journey to childbirth, ensuring that they receive safe and trauma-free birth services and support. They aim to raise awareness of the occurrence and consequences of birth trauma and provide women and birth workers with the tools and support they need to prepare for and experience a safe, positive birth.

Advocacy groups such as Hygieia Health, Homebirth Australia, Maternity choices Australia, and us here at PBB Media to name a few, spend a considerable amount of time translating some of these deeply rooted political stirrings or changes in to smaller bite sized information segments so that we can all come together in our united aim to ensure optimal freedom of choice in childbirth, however that may look for you.

You may have a relative, a friend, a neighbour who is interested to birth at home. You may know a midwifery student who has the aim to become a privately practicing midwife. Even if home birth is not on your radar, you may even just empathise with the right to choose a birth environment that feels safe and right. Advocacy groups do so much work, but lets not forget our own capacity to advocate for our fellow human beings, even if their choices look different to ours. The meaning of advocacy is ‘public support for or recommendation of a particular cause or policy’.

We always welcome your feedback and thoughts. Leave us a review, rating, instagram comment or DM, or simply be in touch via email through hello@pbbmedia.org We have left some great links below in relation to information sources that Fi mentions throughout the interview.

Thanks for tuning in !

@hygieiahealthltd

@bumps_birth_and_beyond

@homebirth_australia

@bornathomefilm

Survey link:

https://tr.ee/pENQCpTihh

Excerpt from Hygieia Health Instagram regarding proposed changes:

“You may have seen a video circulating yesterday where Senator @larissawaters asked the Chief Nursing and Midwifery Officer (CNMO) about proposed changes to insurance for homebirth during Senate Estimates - we’d like to thank Senator Waters for her questions.
If you're wondering what this all means, please keep reading.

We feel the collective anger, fear and in some cases hopelessness about this issue, understanding it's deeply rooted in the lived experiences of women and midwives who have had to fight for women’s rights in childbirth for decades.

What We Do Know: The Government will conduct a consultation process in the coming months, aiming to have details finalised by the end of the year. The proposed insurance would only be available for midwives providing homebirth care to women with 'low risk' pregnancies. This could mean that midwives might not be legally able to provide homebirth services to women outside this definition.

Currently, the definition of ‘low risk’ and who defines it is yet to be determined. However, comments made by the CNMO suggest it could exclude women with common risk factors such as previous c-section, high BMI, gestational diabetes, lack of social support and more. The CNMO also stated that if women deemed ‘high risk’ still want a homebirth, they will need a consultation with an obstetrician to be told to give birth in a hospital.

Our Goal: It’s not too late to influence this process and protect the choice to homebirth as a right for all women. HBA has been promised a seat at the table and we are pushing for this to be a public consultation.

Urgency: Women who will become pregnant from September onwards will be directly impacted, so we will reiterate the urgency of this throughout the consultation process.

Your Feedback Matters: We’ve put together a survey as a first step to gather your feedback so we can head into the consultation process and represent the needs of our community.

Who Should fill out the Survey: • Have you had a homebirth previously? • Are you planning a homebirth? • Are you a homebirth midwife?

Take Action: Complete our survey (link above)]]>https://api.spreaker.com/episode/60344580Mon, 10 Jun 2024 23:58:02 +0000PBB Media IncorporatedIn this episode, Oni Blecher speaks with Fiona O'Shaughnessy. Fiona is a mum of 3, doula, childbirth educator, independent consumer representative for the Northern NSW LHD and a consumer advocate, representing the charity Hygieia Health. She's...
Hygieia Health is dedicated to the sacred work of birth and the impact it has on the physical, emotional, and psychological well-being of women, their families, and birth workers. They believe that “Peace on Earth begins at Birth,” as Jeanine Parvarti Baker so poignantly stated. As a non-profit organization with a charitable purpose of promoting the prevention and treatment of birth trauma, they strive to provide birth workers, obstetricians, midwives, and doulas with the knowledge and skills necessary to care for themselves and others, and to return birth to its rightful place as a profound rite of passage. Their mission is to support women on their journey to childbirth, ensuring that they receive safe and trauma-free birth services and support. They aim to raise awareness of the occurrence and consequences of birth trauma and provide women and birth workers with the tools and support they need to prepare for and experience a safe, positive birth.

Advocacy groups such as Hygieia Health, Homebirth Australia, Maternity choices Australia, and us here at PBB Media to name a few, spend a considerable amount of time translating some of these deeply rooted political stirrings or changes in to smaller bite sized information segments so that we can all come together in our united aim to ensure optimal freedom of choice in childbirth, however that may look for you.

You may have a relative, a friend, a neighbour who is interested to birth at home. You may know a midwifery student who has the aim to become a privately practicing midwife. Even if home birth is not on your radar, you may even just empathise with the right to choose a birth environment that feels safe and right. Advocacy groups do so much work, but lets not forget our own capacity to advocate for our fellow human beings, even if their choices look different to ours. The meaning of advocacy is ‘public support for or recommendation of a particular cause or policy’.

We always welcome your feedback and thoughts. Leave us a review, rating, instagram comment or DM, or simply be in touch via email through hello@pbbmedia.org We have left some great links below in relation to information sources that Fi mentions throughout the interview.

Thanks for tuning in !

@hygieiahealthltd

@bumps_birth_and_beyond

@homebirth_australia

@bornathomefilm

Survey link:

https://tr.ee/pENQCpTihh

Excerpt from Hygieia Health Instagram regarding proposed changes:

“You may have seen a video circulating yesterday where Senator @larissawaters asked the Chief Nursing and Midwifery Officer (CNMO) about proposed changes to insurance for homebirth during Senate Estimates - we’d like to thank Senator Waters for her questions.
If you're wondering what this all means, please keep reading.

We feel the collective anger, fear and in some cases hopelessness about this issue, understanding it's deeply rooted in the lived experiences of women and midwives who have had to fight for women’s rights in childbirth for decades.

What We Do Know: The Government will conduct a consultation process in the coming months, aiming to have details finalised by the end of the year. The proposed insurance would only be available for midwives providing homebirth care to women with 'low risk' pregnancies. This could mean that midwives might not...]]>2070falsefullPBB Outreach Hub: Origins and Evolution, with Sally and Annaleehttps://www.spreaker.com/episode/pbb-outreach-hub-origins-and-evolution-with-sally-and-annalee--60258067
"This is so needed!" PBB weaving love into our community

In this episode, Annalee and Sally, two of the founders of PBB Media and former presenters of our show, get together to discuss the history of our Outreach Hub, how it started and how it has evolved over time and all that it has to offer our community.
The PBB Outreach Hub offers free baby and toddler clothes every Friday from 10am at the CWA Hall in Mullumbimby (corner of Tincogan and Gordon Sts). We welcome any good quality donations of clothes to keep them circulating.

We also hear from two mums, Calindy and Hope, who have found some clothing treasures for their little ones. Alice also shares her story of being supported by the hub in the early days after the 2022 floods when her first child was only 6 months old. Alice still loves to come and visit, catch up with friends and swap some kids' clothing, now with her second child in tow.

And finally we hear from one of our volunteers, Jess, a mum of 3 who gives her time to help run the hub and play with the little ones while mums look through the clothes and shoes.

We thank everyone who contributed to this podcast and look forward to seeing you at the Hub!

If you are interested in volunteering at the hub, we just ask for 4 hours of your time per month and in return you have a lovely social time, making cups of tea and sorting the donated clothes into the boxes. Enquiries: sally@pbbmedia.org

]]>https://api.spreaker.com/episode/60258067Thu, 06 Jun 2024 19:00:03 +0000PBB Media Incorporated"This is so needed!" PBB weaving love into our community In this episode, Annalee and Sally, two of the founders of PBB Media and former presenters of our show, get together to discuss the history of our Outreach Hub, how it started and how it has...
"This is so needed!" PBB weaving love into our community

In this episode, Annalee and Sally, two of the founders of PBB Media and former presenters of our show, get together to discuss the history of our Outreach Hub, how it started and how it has evolved over time and all that it has to offer our community.
The PBB Outreach Hub offers free baby and toddler clothes every Friday from 10am at the CWA Hall in Mullumbimby (corner of Tincogan and Gordon Sts). We welcome any good quality donations of clothes to keep them circulating.

We also hear from two mums, Calindy and Hope, who have found some clothing treasures for their little ones. Alice also shares her story of being supported by the hub in the early days after the 2022 floods when her first child was only 6 months old. Alice still loves to come and visit, catch up with friends and swap some kids' clothing, now with her second child in tow.

And finally we hear from one of our volunteers, Jess, a mum of 3 who gives her time to help run the hub and play with the little ones while mums look through the clothes and shoes.

We thank everyone who contributed to this podcast and look forward to seeing you at the Hub!

If you are interested in volunteering at the hub, we just ask for 4 hours of your time per month and in return you have a lovely social time, making cups of tea and sorting the donated clothes into the boxes. Enquiries: sally@pbbmedia.org

]]>3799falsefullIn The Life of Two Midwifery Students, Xanthe and Tallulahhttps://www.spreaker.com/episode/in-the-life-of-two-midwifery-students-xanthe-and-tallulah--59122858
In this episode, Oni Blecher interviews Tallulah and Xanthe. Both are Bachelor of Midwifery students in the final year of their studies.

Tallulah grew up on Bundjalung Country and was immersed in a community that favoured an integrative approach to healthcare and wellness, Tallulah felt an innate pull to participate. Along her journey, she felt a deep calling to support women and families, naturally falling into midwifery.

Xanthe first felt the calling of midwifery at 14 years old. She spent the next decade thinking about the seed that was planted from such a young age, eventually realising that this calling could no longer be ignored. She truly loves midwifery with her whole heart, and feels incredibly privileged to be walking into a profession that is so rich in culture and practice since the beginning of humanity.

Tallulah’s philosophy is to be led by women and families. As Culturally Safe care is inherently defined by the perspectives of those receiving care, Tallulah aspires for the women she serves to feel the power handed back to them as the primary decision makers. Tallulah hopes to fulfil a graduate position in Midwifery Group Practice (MGP) and go on to facilitate home births as a private practice midwife, whilst offering a sliding scale of cost to make safe birth more accessible.

Xanthe hopes to work alongside some of our most vulnerable people groups in the community as a midwife, also within a continuity of care model. She is driven by the desire to provide holistic care, where women, birthing people, and families feel deeply respected and heard. She strongly believes in the potential of the childbirth continuum being a time that can have deep and lasting positive change for families and communities when care is provided well.

Both Tallulah and Xanthe had the privilege of undertaking an overseas placement in remote Papua New Guinea in November 2023 of which they talk about during this interview. It was here that their love for midwifery was solidified. They were reminded of the role of midwifery as primary healthcare, servicing families and communities. Being remote and without basic resources or staffing, the two learnt the value of teamwork, being resourceful and acting on instinct.

Tallulah and Xanthe cherish the relationships they build with women and their families and see the art and profession of midwifery as an immense privilege, they can’t imagine doing anything else!

If you have any questions for these two, feel free to send us an email at hello@pbbmedia.org
]]>https://api.spreaker.com/episode/59122858Mon, 25 Mar 2024 18:30:01 +0000PBB Media IncorporatedIn this episode, Oni Blecher interviews Tallulah and Xanthe. Both are Bachelor of Midwifery students in the final year of their studies. Tallulah grew up on Bundjalung Country and was immersed in a community that favoured an integrative approach to...
In this episode, Oni Blecher interviews Tallulah and Xanthe. Both are Bachelor of Midwifery students in the final year of their studies.

Tallulah grew up on Bundjalung Country and was immersed in a community that favoured an integrative approach to healthcare and wellness, Tallulah felt an innate pull to participate. Along her journey, she felt a deep calling to support women and families, naturally falling into midwifery.

Xanthe first felt the calling of midwifery at 14 years old. She spent the next decade thinking about the seed that was planted from such a young age, eventually realising that this calling could no longer be ignored. She truly loves midwifery with her whole heart, and feels incredibly privileged to be walking into a profession that is so rich in culture and practice since the beginning of humanity.

Tallulah’s philosophy is to be led by women and families. As Culturally Safe care is inherently defined by the perspectives of those receiving care, Tallulah aspires for the women she serves to feel the power handed back to them as the primary decision makers. Tallulah hopes to fulfil a graduate position in Midwifery Group Practice (MGP) and go on to facilitate home births as a private practice midwife, whilst offering a sliding scale of cost to make safe birth more accessible.

Xanthe hopes to work alongside some of our most vulnerable people groups in the community as a midwife, also within a continuity of care model. She is driven by the desire to provide holistic care, where women, birthing people, and families feel deeply respected and heard. She strongly believes in the potential of the childbirth continuum being a time that can have deep and lasting positive change for families and communities when care is provided well.

Both Tallulah and Xanthe had the privilege of undertaking an overseas placement in remote Papua New Guinea in November 2023 of which they talk about during this interview. It was here that their love for midwifery was solidified. They were reminded of the role of midwifery as primary healthcare, servicing families and communities. Being remote and without basic resources or staffing, the two learnt the value of teamwork, being resourceful and acting on instinct.

Tallulah and Xanthe cherish the relationships they build with women and their families and see the art and profession of midwifery as an immense privilege, they can’t imagine doing anything else!

If you have any questions for these two, feel free to send us an email at hello@pbbmedia.org
]]>4949birth,fatherhood,healthcare,love,midwifery,motherhood,parenthood,postnatal,postpartum,pregnancyfalsefullGentle Traditional Medicine with Naomi Janssonhttps://www.spreaker.com/episode/gentle-traditional-medicine-with-naomi-jansson--59039173
With a deep respect for the Ancestors, History and Cultures of Traditional Medicines she practises her craft and maintains long term apprenticeship with Master practitioners in Australia, Japan and USA whilst studying the traditional manuscripts and learning opportunities with lineage teachers. Traditional Medicine is Naomi’s life calling and she has truly dedicated herself to the Medicine and those who seek to receive or learn from her.

A dedicated Advocate for Traditional Medicine especially in Women's Health and Birth/Reproductive Health services. She holds the vision of Culturally oriented and Mother centred experiences for Women during childbearing and rites of passage. Naomi often speaks at conferences and for podcasts to inform on the importance of Cultural Practices and Medicines in Women's Health.
Naomi has also planned an upcoming postpartum conference on the 20 and 21st of April. ‘The Whole Picture’ postpartum conference is a dynamic 2 day event with inspiring speakers, offering CPD points and showcasing interdisciplinary innovations for optimal outcomes.

Find Naomi and her offerings here:

https://www.gentletraditions.xyz

@gentle_traditions]]>https://api.spreaker.com/episode/59039173Thu, 14 Mar 2024 03:48:58 +0000PBB Media IncorporatedIn this episode, Oni Blecher interviews Naomi Jannson. With over 20 years of experience as a health professional, Naomi weaves a wealth of expertise from diverse healthcare settings to provide clinical care and education. Naomi inherited a strong...
With a deep respect for the Ancestors, History and Cultures of Traditional Medicines she practises her craft and maintains long term apprenticeship with Master practitioners in Australia, Japan and USA whilst studying the traditional manuscripts and learning opportunities with lineage teachers. Traditional Medicine is Naomi’s life calling and she has truly dedicated herself to the Medicine and those who seek to receive or learn from her.

A dedicated Advocate for Traditional Medicine especially in Women's Health and Birth/Reproductive Health services. She holds the vision of Culturally oriented and Mother centred experiences for Women during childbearing and rites of passage. Naomi often speaks at conferences and for podcasts to inform on the importance of Cultural Practices and Medicines in Women's Health.
Naomi has also planned an upcoming postpartum conference on the 20 and 21st of April. ‘The Whole Picture’ postpartum conference is a dynamic 2 day event with inspiring speakers, offering CPD points and showcasing interdisciplinary innovations for optimal outcomes.

Find Naomi and her offerings here:

https://www.gentletraditions.xyz

@gentle_traditions]]>4318falsefullBorn at Home Film with Amanda Bankshttps://www.spreaker.com/episode/born-at-home-film-with-amanda-banks--58772784In this epsiode, Oni Blecher speaks with Amanda Banks, co creator and producer of the new film Born at Home. Empowered by the homebirth of her second child in 2020, Amanda, together with long term dear friend Eleanor, set out to create a film exploring Homebirth in QLD.

Amanda is mother of two children, both born at home. She has always had a passion for health which led her to works as an Acupuncturist in Brisbane, supporting families through fertility, pregnancy and beyond for over 8 years. Amanda was the former Convenor for Homebirth QLD for 2.5 years until mid 2023 and worked as a maternity consumer representative on the QLD Normal Birth Strategy.

Supporting women has always been a passion of hers and after absorbing current research on the mainstream maternity system working with Homebirth QLD, she was driven to advocate for evidence based maternity care, women’s rights and access to safe birthing options and education. Amanda believes in the physiological process of birth, that birth is a rite of passage and a positive, supported birth experience can create a mother who feels confident in herself and in her parenting journey, amongst many other beneficial maternal and infant outcomes.

We hope you enjoy this conversation and learning more about the film ! To check out more details and the upcoming film screenings, look at the links below !

https://www.bornathomefilm.com.au

https://au.demand.film/born-at-home/

]]>https://api.spreaker.com/episode/58772784Thu, 22 Feb 2024 04:18:32 +0000PBB Media IncorporatedIn this epsiode, Oni Blecher speaks with Amanda Banks, co creator and producer of the new film Born at Home. Empowered by the homebirth of her second child in 2020, Amanda, together with long term dear friend Eleanor, set out to create a film...In this epsiode, Oni Blecher speaks with Amanda Banks, co creator and producer of the new film Born at Home. Empowered by the homebirth of her second child in 2020, Amanda, together with long term dear friend Eleanor, set out to create a film exploring Homebirth in QLD.

Amanda is mother of two children, both born at home. She has always had a passion for health which led her to works as an Acupuncturist in Brisbane, supporting families through fertility, pregnancy and beyond for over 8 years. Amanda was the former Convenor for Homebirth QLD for 2.5 years until mid 2023 and worked as a maternity consumer representative on the QLD Normal Birth Strategy.

Supporting women has always been a passion of hers and after absorbing current research on the mainstream maternity system working with Homebirth QLD, she was driven to advocate for evidence based maternity care, women’s rights and access to safe birthing options and education. Amanda believes in the physiological process of birth, that birth is a rite of passage and a positive, supported birth experience can create a mother who feels confident in herself and in her parenting journey, amongst many other beneficial maternal and infant outcomes.

We hope you enjoy this conversation and learning more about the film ! To check out more details and the upcoming film screenings, look at the links below !

https://www.bornathomefilm.com.au

https://au.demand.film/born-at-home/

]]>2840falsefull
Breastfeeding and Postpartum: Navigating Transition with Dr. Michelle Gerbihttps://www.spreaker.com/episode/breastfeeding-and-postpartum-navigating-transition-with-dr-michelle-gerbi--58262178
In this episode, they discuss many topics but provide a special focus on breastfeeding, tongue tie, and the culture of under prepared postpartum. Michelle shares her extensive professional experince as well as her own personal birthing and breastfeeding journey.

Enjoy this conversation and find Michelle through the links below.
- Instagram: @postpartummotheringmentor
- Website: www.drgerbi.com
]]>
https://api.spreaker.com/episode/58262178Thu, 11 Jan 2024 18:50:02 +0000
PBB Media IncorporatedIn this interview, Oni Blecher interviews Dr Michelle Gerbi. With a background as a chiropractor, perinatal health coach, functional medicine provider, certified perinatal health coach, postpartum corrective exercise specialist, and international...
In this episode, they discuss many topics but provide a special focus on breastfeeding, tongue tie, and the culture of under prepared postpartum. Michelle shares her extensive professional experince as well as her own personal birthing and breastfeeding journey.

Enjoy this conversation and find Michelle through the links below.
Instagram: @postpartummotheringmentor
Website: www.drgerbi.com
]]>
4275baby,birth,chiropractor,fatherhood,health,love,maternalhealth,motherhood,parenting,pbbmedia,postpartum,pregnancyfalsefull
Dr. Howard Chilton: Baby's Brains and Responsive Parentinghttps://www.spreaker.com/episode/dr-howard-chilton-baby-s-brains-and-responsive-parenting--57956345Public Service Announcement: Would you like to support us ? We are raising money for our NFP and podcast to obtain an office space and podcast recording studio for 2024. Our goal is $10, 000 AUD and any donation big or small is helpful ! If you're interested in supporting us, please email us at hello@pbbmedia.org for more information. If you're not familiar, Check out our work at pbbmedia.org

In this interview, Oni Blecher interviews Dr. Howard Chilton has been a neonatologist (a baby’s physician) for over 45 years. He was born in York, England and studied at St Mary’s Hospital Medical School in London. After wonderful years in London in the swinging sixties he graduated then interned at Addington Hospital on the beach in Durban, South Africa. Following this, he was accepted for a Senior House Physician appointment in Neonatal Medicine at Harari Hospital in then, Salisbury Rhodesia, now, Harare, Zimbabwe).
After more training, Howard eventually obtained paediatric appointments at the Hammersmith Hospital and the Westminster Children’s Hospital, then, after obtaining his MRCP (UK) degree, the John Radcliffe Hospital, Oxford where he also did a short fellowship. He then became a SHO at the Hospital for Sick Children, Great Ormond Street, London in the Department of Respiratory Medicine. He did a mandatory Neonatal Fellowship in the US at Denver Children’s Hospital which included two years in a centre of excellence in high tech neonatology including doing neonatal ground and air retrievals, really taught him how to look after the sickest, smallest babies.

Before starting this fellowship though, he had a long stopover in Sydney doing locum Respiratory and Paediatric jobs, to check out job prospects. During one job at Prince Henry Hospital he met a beautiful nursing sister called Tamara.

At the end of the fellowship, Howard was appointed as the Director of Newborn Services at the Royal Hospital for Women in Sydney, where he held this position for over twenty years, resigning in 1999 to concentrate on clinical work and parent education.

Apart from looking after babies and their parents, Howard now spends a lot of his time talking: to parent groups, or to conferences in Australia and overseas, and to media outlets about ‘responsive parenting’ and the myriad issues which arise for parents when they take their new baby home. He believes knowledge of the biology of the baby can help parents understand and meet their baby’s needs and enables them to relax and enjoy the wonderful experience of parenting.

He married Tamara soon after arriving back in Sydney from the USA and she remains the light of his life. They have two daughters, Georgina and Isabella and five grandchildren ! all under 5 years of age.

Find out more about Dr. Chilton, including his well renowned books at

babydoc.com.au

]]>https://api.spreaker.com/episode/57956345Sun, 10 Dec 2023 18:00:02 +0000PBB Media IncorporatedPublic Service Announcement: Would you like to support us ? We are raising money for our NFP and podcast to obtain an office space and podcast recording studio for 2024. Our goal is $10, 000 AUD and any donation big or small is helpful ! If you're...Public Service Announcement: Would you like to support us ? We are raising money for our NFP and podcast to obtain an office space and podcast recording studio for 2024. Our goal is $10, 000 AUD and any donation big or small is helpful ! If you're interested in supporting us, please email us at hello@pbbmedia.org for more information. If you're not familiar, Check out our work at pbbmedia.org

In this interview, Oni Blecher interviews Dr. Howard Chilton has been a neonatologist (a baby’s physician) for over 45 years. He was born in York, England and studied at St Mary’s Hospital Medical School in London. After wonderful years in London in the swinging sixties he graduated then interned at Addington Hospital on the beach in Durban, South Africa. Following this, he was accepted for a Senior House Physician appointment in Neonatal Medicine at Harari Hospital in then, Salisbury Rhodesia, now, Harare, Zimbabwe).
After more training, Howard eventually obtained paediatric appointments at the Hammersmith Hospital and the Westminster Children’s Hospital, then, after obtaining his MRCP (UK) degree, the John Radcliffe Hospital, Oxford where he also did a short fellowship. He then became a SHO at the Hospital for Sick Children, Great Ormond Street, London in the Department of Respiratory Medicine. He did a mandatory Neonatal Fellowship in the US at Denver Children’s Hospital which included two years in a centre of excellence in high tech neonatology including doing neonatal ground and air retrievals, really taught him how to look after the sickest, smallest babies.

Before starting this fellowship though, he had a long stopover in Sydney doing locum Respiratory and Paediatric jobs, to check out job prospects. During one job at Prince Henry Hospital he met a beautiful nursing sister called Tamara.

At the end of the fellowship, Howard was appointed as the Director of Newborn Services at the Royal Hospital for Women in Sydney, where he held this position for over twenty years, resigning in 1999 to concentrate on clinical work and parent education.

Apart from looking after babies and their parents, Howard now spends a lot of his time talking: to parent groups, or to conferences in Australia and overseas, and to media outlets about ‘responsive parenting’ and the myriad issues which arise for parents when they take their new baby home. He believes knowledge of the biology of the baby can help parents understand and meet their baby’s needs and enables them to relax and enjoy the wonderful experience of parenting.

He married Tamara soon after arriving back in Sydney from the USA and she remains the light of his life. They have two daughters, Georgina and Isabella and five grandchildren ! all under 5 years of age.

Find out more about Dr. Chilton, including his well renowned books at

babydoc.com.au

]]>3893attachmentparenting,babies,birth,love,maternityhealth,mothers,neonatal,neonatologist,paedeatrician,parenting,postnatal,postpartum,pregnancy,responsiveparentingfalsefullYin and Taoist approaches to parenthood with Tahnee Taylorhttps://www.spreaker.com/episode/yin-and-taoist-approaches-to-parenthood-with-tahnee-taylor--57836201
In this interview, Tahnee shares how her deep experience and resonance with yin and Taoist principles and the intersection between them has influenced her motherhing and her interaction with her many roles as a woman and human. Enjoy this interview.

Find Tahnee here:

@tahneeyoga

tahneetaylor.com]]>https://api.spreaker.com/episode/57836201Wed, 29 Nov 2023 18:30:02 +0000PBB Media IncorporatedIn this episode, Oni Blecher speaks with Tahnee Taylor. Tahnee is a yoga teacher with a deep and resonant love of Yin Yoga and how it meets the alchemical magic of Taoism. She is also a practitioner of Chi Nei Tsang, which is a Taoist abdominal...
In this interview, Tahnee shares how her deep experience and resonance with yin and Taoist principles and the intersection between them has influenced her motherhing and her interaction with her many roles as a woman and human. Enjoy this interview.

Find Tahnee here:

@tahneeyoga

tahneetaylor.com]]>5675babies,birth,children,fatherhood,love,maternityhealth,motherhood,postnatal,postpartum,pregnancy,toaism,womanhood,yin,yogafalsefullPelvic Physio: Optimising Pregnancy, Birth, and Postpartum with Ruth Schuberthttps://www.spreaker.com/episode/pelvic-physio-optimising-pregnancy-birth-and-postpartum-with-ruth-schubert--57654187
Find Ruth here:

@exhale_physiotherapy

www.exhalephysio.com.au

Find PBB Media here

@pbb_media

www.pbbmedia.org]]>https://api.spreaker.com/episode/57654187Thu, 16 Nov 2023 18:15:02 +0000PBB Media IncorporatedIn this episode, Oni Blecher speaks with Ruth Schubert. Ruth is a physiotherapist for 20 years. She Schubert is inspired to help her clients lead a beautiful life. She believes in building resilience through developing a strong body and calm mind....
Find Ruth here:

@exhale_physiotherapy

www.exhalephysio.com.au

Find PBB Media here

@pbb_media

www.pbbmedia.org]]>4200birth,byronbay,love,maternityhealth,painmanagement,parenting,pelvicfloor,pelvicphysiotherapy,physiotherapy,postnatal,postpartum,pregnancyfalsefullTwin Life with Natalie Woodshttps://www.spreaker.com/episode/twin-life-with-natalie-woods--57585475
Enjoy this conversation

Find Nat here:

@nat.woods_

Sign petition here:

https://equalityformultiples.good.do/HELPNOW/MULTIPLES-NEED-SUPPORT/]]>https://api.spreaker.com/episode/57585475Fri, 10 Nov 2023 04:27:01 +0000PBB Media IncorporatedIn today's episode, Oni Blecher speaks with Natalie Woods. Natalie Woods is a twin mother to two boys, River and Jarrah. She lives in the Northern Rivers with her partner Dan. She’s also a writer and community builder, which has led her to think...
Enjoy this conversation

Find Nat here:

@nat.woods_

Sign petition here:

https://equalityformultiples.good.do/HELPNOW/MULTIPLES-NEED-SUPPORT/]]>4388birth,fatherhood,love,motherhood,multiplebirths,multiples,parenthood,postnatal,postpartum,pregnancy,twinsfalsefullStillbirth: A Father's Story, with Nyck Jeaneshttps://www.spreaker.com/episode/stillbirth-a-father-s-story-with-nyck-jeanes--57438339
This interview was recorded nearly two years ago and with floods, and other events, it is only now we are airing it.

PBB met Nyck in his former role as the president of BayFM, our local community radio station; the very place that Pregnancy, Birth, and Beyond started so many years ago.

Nyck has always been a truth seeker who comes from a place of an eternal wonder like an inquisitive child but with wise and sharp intellect to investigate and articulate the wonder. He is a friend of many and has been a backbone for so many in the community.

Nyck has a big heart, and enthusiasm to tell the story. In this interview, his story is a rich and deep story that includes a pivotal moment in his life; the birth and death of his first child. Nyck generously and wisely shares this story with us decades later. It includes the story of an inquest and the braveness of acting in a painful and challenging time.

Oni was honoured to sit and witness Nyck talk as a father, after us sitting next to him at the radio station for many years as our show used to air just after his finished. It was only years later, after a spontaneous conversation at a cafe did Oni realise what Nyck had gone through as a father.

Thank you Nyck and we hope you appreciate this conversation.

Please see below for details of helplines if you or your loved ones need help

Organisations for support: (via www.iamstillborn.com)

Sands – Sands provides support, information and education to anyone affected by the death of a baby before, during or shortly after birth. They have helplines you can call up and they also have face to face events. There is lots of info on their website. http://www.sands.org.au/

Bears of Hope – Bears Of Hope Pregnancy & Infant Loss Support provides leading support and exceptional care for families who experience the loss of their baby. Bears of Hope has a great Facebook group for grieving parents. There is also one group set up just for Dads. http://www.bearsofhope.org.au/

The Stillbirth Foundation Australia is the only Australian charity dedicated to stillbirth research. We are 100 percent community funded. It was launched by Emma McLeod in October 2005 after Olivia, Emma’s second child and first daughter, died unexpectedly in utero and was born still on 31 July 2002. They have a birth remembrance on their website for all the babies gone too soon. They also have information for parents who are dealing with their grief. http://stillbirthfoundation.org.au/]]>https://api.spreaker.com/episode/57438339Mon, 30 Oct 2023 22:36:22 +0000PBB Media IncorporatedIn this interview, Oni speaks with local father Nyck Jeanes. Nyck is also a musician, producer, independent journalist, and as one close friend describes him; a social engineer; he’s out to help change the way we relate to one another, understand the...
This interview was recorded nearly two years ago and with floods, and other events, it is only now we are airing it.

PBB met Nyck in his former role as the president of BayFM, our local community radio station; the very place that Pregnancy, Birth, and Beyond started so many years ago.

Nyck has always been a truth seeker who comes from a place of an eternal wonder like an inquisitive child but with wise and sharp intellect to investigate and articulate the wonder. He is a friend of many and has been a backbone for so many in the community.

Nyck has a big heart, and enthusiasm to tell the story. In this interview, his story is a rich and deep story that includes a pivotal moment in his life; the birth and death of his first child. Nyck generously and wisely shares this story with us decades later. It includes the story of an inquest and the braveness of acting in a painful and challenging time.

Oni was honoured to sit and witness Nyck talk as a father, after us sitting next to him at the radio station for many years as our show used to air just after his finished. It was only years later, after a spontaneous conversation at a cafe did Oni realise what Nyck had gone through as a father.

Thank you Nyck and we hope you appreciate this conversation.

Please see below for details of helplines if you or your loved ones need help

Organisations for support: (via www.iamstillborn.com)

Sands – Sands provides support, information and education to anyone affected by the death of a baby before, during or shortly after birth. They have helplines you can call up and they also have face to face events. There is lots of info on their website. http://www.sands.org.au/

Bears of Hope – Bears Of Hope Pregnancy & Infant Loss Support provides leading support and exceptional care for families who experience the loss of their baby. Bears of Hope has a great Facebook group for grieving parents. There is also one group set up just for Dads. http://www.bearsofhope.org.au/

The Stillbirth Foundation Australia is the only Australian charity dedicated to stillbirth research. We are 100 percent community funded. It was launched by Emma McLeod in October 2005 after Olivia, Emma’s second child and first daughter, died unexpectedly in utero and was born still on 31 July 2002. They have a birth remembrance on their website for all the babies gone too soon. They also have information for parents who are dealing with their grief. http://stillbirthfoundation.org.au/]]>4944birth,fatherhood,grief,infantloss,loss,love,maternityhealth,motherhood,parenting,postnatal,postpartum,pregnancy,stillbirthfalsefullParenting As Social Activism with Robin Grillehttps://www.spreaker.com/episode/parenting-as-social-activism-with-robin-grille--57376701
Robin speaks at international conferences, on a range of themes presented in his books. He conducts international trainings for psychotherapists, and for parents and offers private psychotherapy/counselling/coaching sessions.

Robin was born in Uruguay to migrant parents. Spanish was his first language, French his second and Romanian his third language before coming to Australia when he was 10 years old.

So far he has written and published; 'Heart to Heart Parenting', 'Parenting for a Peaceful World', and a chapter in a book called 'Social Ecology, Applying Ecological Understanding to our Lives and our Planet'.

We hope you enjoy this conversation.

Find Robin at

https://www.robingrille.com

or

@robingrille

]]>https://api.spreaker.com/episode/57376701Wed, 25 Oct 2023 19:00:02 +0000PBB Media IncorporatedRobin Grille Is a psychotherapist, psychologist, author, mentor, speaker, and educator. His work seeks to restore relationships to their natural flow and balance: include family relationships, partnerships, workplace relationships, and relationship to...
Robin speaks at international conferences, on a range of themes presented in his books. He conducts international trainings for psychotherapists, and for parents and offers private psychotherapy/counselling/coaching sessions.

Robin was born in Uruguay to migrant parents. Spanish was his first language, French his second and Romanian his third language before coming to Australia when he was 10 years old.

So far he has written and published; 'Heart to Heart Parenting', 'Parenting for a Peaceful World', and a chapter in a book called 'Social Ecology, Applying Ecological Understanding to our Lives and our Planet'.

We hope you enjoy this conversation.

Find Robin at

https://www.robingrille.com

or

@robingrille

]]>5290awareparenting,birth,children,fatherhood,love,motherhood,parenting,postnatal,postpartum,pregnancyfalsefullMotherhood: Holding it Tenderly with Jacqui Lewishttps://www.spreaker.com/episode/motherhood-holding-it-tenderly-with-jacqui-lewis--56902004
Jacqui Lewis is a meditation teacher, mentor, an author of four books, a Tedx Speaker, and hosts leadership programs globally. She co-founded The Broad Place, a global school sharing ancient knowledge and modern neuroscience, tools and experiences for higher grade living with Arran Russell. She focuses on philosophy and tools for greater clarity, creativity and consciousness and bringing a grounded, innovative and resilient approach into the lives of her students and clients. A student of Eastern wisdom, neuroscience and psychology, she continues to study and integrate these teachings into her work.

In this interview, Jacqui shares her diverse and personal experience as a mother, including motherhood and work, creativity, and tuning in to your own wisdom in a world saturated with information. We also discuss Jacqui’s book ‘Mothers Mind Cleanse’ and hear about her own impetus and writing process. Enjoy this conversation

To tune into Jacqui's work, head to:

https://thebroadplace.com.au

Instagram:

@thebroadplace]]>https://api.spreaker.com/episode/56902004Sat, 23 Sep 2023 19:00:01 +0000PBB Media IncorporatedThis episode is a conversation between Oni Blecher and Jacqui Lewis. Jacqui Lewis is a meditation teacher, mentor, an author of four books, a Tedx Speaker, and hosts leadership programs globally. She co-founded The Broad Place, a global school...
Jacqui Lewis is a meditation teacher, mentor, an author of four books, a Tedx Speaker, and hosts leadership programs globally. She co-founded The Broad Place, a global school sharing ancient knowledge and modern neuroscience, tools and experiences for higher grade living with Arran Russell. She focuses on philosophy and tools for greater clarity, creativity and consciousness and bringing a grounded, innovative and resilient approach into the lives of her students and clients. A student of Eastern wisdom, neuroscience and psychology, she continues to study and integrate these teachings into her work.

In this interview, Jacqui shares her diverse and personal experience as a mother, including motherhood and work, creativity, and tuning in to your own wisdom in a world saturated with information. We also discuss Jacqui’s book ‘Mothers Mind Cleanse’ and hear about her own impetus and writing process. Enjoy this conversation

To tune into Jacqui's work, head to:

https://thebroadplace.com.au

Instagram:

@thebroadplace]]>5074birth,childbirth,coparenting,fatherhood,love,meditation,motherhood,parenting,postnatal,postpartum,pregnancyfalsefullSamantha Neal: In Deep Relationship with The Menstrual Cyclehttps://www.spreaker.com/episode/samantha-neal-in-deep-relationship-with-the-menstrual-cycle--56350254
Samantha has been working for over six years, contributing to the field of menstruation by way of workshops, comprehensive online education programs, private mentorship and circle facilitation. Samantha is within a new wave of menstrual educators, approaching the field slowly and carefully with the utmost sanctity and respect; researching and writing while based in the Northern Rivers of New South Wales, Australia.
She has worked with all ages, supported thousands of women and girls in their understanding and integration of menstrual awareness. Her widely loved online course, the Cyclical Living Immersion, has been received and celebrated by participants from around the world. Most recently, she has started an online container called ‘Altered’, a 4 week course exploring the liminal dimensions of menstruation. She is always tending budding projects as well as serving weekly tea ceremonies, continuing her deep studies and exploring under the guidance of her mentors Dr. Lara Owen and Moana Pearl.

This interview is full of deep explorations around relationship; with self, with cycles, and with those who teach us. Enjoy !

To connect or work with Sam, have a look at her website:

https://samantha-neal.com

Or her Instagram:

@samanthaneal_]]>https://api.spreaker.com/episode/56350254Thu, 03 Aug 2023 20:00:02 +0000PBB Media IncorporatedIn this episode, Oni Blecher brings you an interview with menstrual educator Samantha Neal. Samantha has been working for over six years, contributing to the field of menstruation by way of workshops, comprehensive online education programs, private...
Samantha has been working for over six years, contributing to the field of menstruation by way of workshops, comprehensive online education programs, private mentorship and circle facilitation. Samantha is within a new wave of menstrual educators, approaching the field slowly and carefully with the utmost sanctity and respect; researching and writing while based in the Northern Rivers of New South Wales, Australia.
She has worked with all ages, supported thousands of women and girls in their understanding and integration of menstrual awareness. Her widely loved online course, the Cyclical Living Immersion, has been received and celebrated by participants from around the world. Most recently, she has started an online container called ‘Altered’, a 4 week course exploring the liminal dimensions of menstruation. She is always tending budding projects as well as serving weekly tea ceremonies, continuing her deep studies and exploring under the guidance of her mentors Dr. Lara Owen and Moana Pearl.

This interview is full of deep explorations around relationship; with self, with cycles, and with those who teach us. Enjoy !

To connect or work with Sam, have a look at her website:

https://samantha-neal.com

Or her Instagram:

@samanthaneal_]]>4035birth,childbirth,children,cycleawareness,death,femalehealth,healing,menstrualeducation,menstruation,parenting,postnatal,postpartum,pregnancy,rebirth,selfhelpfalsefullJane Hardwicke Collings: Bringing Birth Trauma Out of the Dungeonshttps://www.spreaker.com/episode/jane-hardwicke-collings-bringing-birth-trauma-out-of-the-dungeons--56039464
Jane has many gifts of wisdom from her decades of experience in regards to birthing well. Not only is Jane and her school a wellspring of knowledge but she is a keen collaborator and her generosity to other groups and organisatins including ours is a testament to her ability to evolve our field and work together for a better future.

Below are links to the Northern Rivers based events mentioned in Jane's interview.

FREE birth trauma event:

https://janehardwickecollings.com/events/red-thread-birth-trauma-a-conversation-with-jane-hardwicke-collings-rhea-dempsey/
https://www.eventbrite.com.au/e/birth-trauma-awareness-event-tickets-623425651907

Red Thread Birth Trauma - A Conversation with Jane Hardwicke Collings and Rhea Dempsey

]]>https://api.spreaker.com/episode/56039464Sun, 09 Jul 2023 20:00:02 +0000PBB Media IncorporatedIn this Episode, Oni Blecher interviews Jane Hardwicke Collings. Jane has spent decades in the realms of birth education and ther wider work of reconnecting women with their sacred rites of passage. Jane started and runs the School of Shamanic Woman...
Jane has many gifts of wisdom from her decades of experience in regards to birthing well. Not only is Jane and her school a wellspring of knowledge but she is a keen collaborator and her generosity to other groups and organisatins including ours is a testament to her ability to evolve our field and work together for a better future.

Below are links to the Northern Rivers based events mentioned in Jane's interview.

FREE birth trauma event:

https://janehardwickecollings.com/events/red-thread-birth-trauma-a-conversation-with-jane-hardwicke-collings-rhea-dempsey/
https://www.eventbrite.com.au/e/birth-trauma-awareness-event-tickets-623425651907

Red Thread Birth Trauma - A Conversation with Jane Hardwicke Collings and Rhea Dempsey

]]>2050birth,birthtrauma,childcare,fatherhood,love,maternitycare,maternityhealth,motherhood,parenting,postnatal,postpartum,traumafalsefullRhea Dempsey on BayFM's Make a Change showhttps://www.spreaker.com/episode/rhea-dempsey-on-bayfm-s-make-a-change-show--55999292Make a Change on BayFM interviews Rhea Dempsey and Sally Cusack on birth trauma and related events coming up in the region for #birthtraumaawarenessweek 16 - 22 July 2023.

Rhea Dempsey, childbirth educator, counsellor and author, will be in conversation with Jerusha Sutton from the Birth Time documentary team on Thursday 13 July 2023 at 6:30 - 8:30pm at Vali Byron.

Bookings can be made through PBB Media here or here.

Rhea will be visiting this region from Melbourne to also present at this Birth Trauma Awareness Event at Lennox Head on 18 July 2023.
https://www.eventbrite.com.au/e/birth-trauma-awareness-event-tickets-623425651907

Aired on bayfm.org on 5 July 2023.
Copyright Dione Green, Make a Change 2023]]>https://api.spreaker.com/episode/55999292Wed, 05 Jul 2023 05:21:41 +0000PBB Media IncorporatedDione from https://www.facebook.com/makeachangebayfm/ interviews Rhea Dempsey and Sally Cusack on birth trauma and related events coming up in the region for #birthtraumaawarenessweek 16 - 22 July 2023. https://www.rheadempsey.com.au, childbirth...Make a Change on BayFM interviews Rhea Dempsey and Sally Cusack on birth trauma and related events coming up in the region for #birthtraumaawarenessweek 16 - 22 July 2023.

Rhea Dempsey, childbirth educator, counsellor and author, will be in conversation with Jerusha Sutton from the Birth Time documentary team on Thursday 13 July 2023 at 6:30 - 8:30pm at Vali Byron.

Bookings can be made through PBB Media here or here.

Rhea will be visiting this region from Melbourne to also present at this Birth Trauma Awareness Event at Lennox Head on 18 July 2023.
https://www.eventbrite.com.au/e/birth-trauma-awareness-event-tickets-623425651907

Aired on bayfm.org on 5 July 2023.
Copyright Dione Green, Make a Change 2023]]>1165beyondthebirthplan,birthtraumaawarenessweek,painandpowerinthebirthroom,rheadempseyfalsefullTane Luna: Evolving Obstetricshttps://www.spreaker.com/episode/tane-luna-evolving-obstetrics--54319250
Pregnancy, Birth and Beyond Media, our development team and contributors pay our respects to indigenous elders past, present and emerging. This interview was recorded and edited on Bundjalung land. We acknowledge that we live, work, and benefit from these unceded lands. PBB Media as a NFP organisation is fully volunteer run. We are grateful for our loyal and long-lasting listener ship and believe the content we share around Pregnancy, Birth, Postpartum, and parenting is vital for healthier communities. Leave us a comment or a review, or send on our episodes to anyone you think would benefit. We also have a backlog of 100s of rich and varied episodes. Have a look!

On July 18th, Tane and a group of other practitioners and clinicians specialising in birth and postpartum will be running a free event to raise awareness around birth trauma. I will pop the details about this below in our show notes. Enjoy this interview !

https://www.eventbrite.com.au/e/birth-trauma-awareness-event-tickets-623425651907]]>https://api.spreaker.com/episode/54319250Tue, 13 Jun 2023 04:58:23 +0000PBB Media IncorporatedIn Today's episode, Oni Blecher will be interviewing Tane Luna, A Spanish obstetrician that is working as the head os Obstetrics at Lismore Base Hospital. Tane has had vast experience working in many models of care, including a period of time with...
Pregnancy, Birth and Beyond Media, our development team and contributors pay our respects to indigenous elders past, present and emerging. This interview was recorded and edited on Bundjalung land. We acknowledge that we live, work, and benefit from these unceded lands. PBB Media as a NFP organisation is fully volunteer run. We are grateful for our loyal and long-lasting listener ship and believe the content we share around Pregnancy, Birth, Postpartum, and parenting is vital for healthier communities. Leave us a comment or a review, or send on our episodes to anyone you think would benefit. We also have a backlog of 100s of rich and varied episodes. Have a look!

On July 18th, Tane and a group of other practitioners and clinicians specialising in birth and postpartum will be running a free event to raise awareness around birth trauma. I will pop the details about this below in our show notes. Enjoy this interview !

https://www.eventbrite.com.au/e/birth-trauma-awareness-event-tickets-623425651907]]>2435birth,children,fatherhood,health,love,maternity,motherhood,obstetrics,parenting,postpartum,pregnancyfalsefullResearcher Alysha-leigh Fameli: PTSD in Birthhttps://www.spreaker.com/episode/researcher-alysha-leigh-fameli-ptsd-in-birth--54005311
As part of her new and current research, she is seeking the participation of mothers with infants aged 0-6 months for participation in a clinical interview, observation and online survey. If this is you, check out our links below to see how you can be involved. Your experiences matter and recording them safely and officially helps to prevent future harm and creates the space for others to have their experiences validated.

As you may know, the rates of PTSD in childbirth are growing. These statistics are ones that us here at PBB Media are not okay with. We will also leave some mental health resources below. If you are feeling like you need mental health support in relation to your birth or postpartum, know that you are not alone.

Mental health support for expecting and new parents:

https://forwhenhelpline.org.au / Call 1300 24 23 22 National Helpline on 1300 24 23 22 is now live between 9.00am-4.30pm – Monday to Friday.

Call ForWhen helpline, which is a national service and you can look up your area and link you in to support close to you 1300 24 23 22, forwhenhelpline.org.au

To be involved in Alysha-leigh's study:

To support and participate in this vital research (for this project, anyone with babies 6 months and younger), you can reach her here:

afam4556@uni.sydney.edu.au and www.australianbirthstudy.com

Upcoming free Birth Trauma event in Lismore:

https://www.instagram.com/p/CsDxQZTru4I/?igshid=NTc4MTIwNjQ2YQ==

]]>https://api.spreaker.com/episode/54005311Fri, 26 May 2023 20:00:02 +0000PBB Media IncorporatedThis epsiode is a conversation between Annalee Atia and Alysha-leigh Fameli. Alysha-leigh is PhD student/Registered Psychologist University of Sydney. Alicia-leigh has already undertaken important research to recognise childbirth related PTSD and it's...
As part of her new and current research, she is seeking the participation of mothers with infants aged 0-6 months for participation in a clinical interview, observation and online survey. If this is you, check out our links below to see how you can be involved. Your experiences matter and recording them safely and officially helps to prevent future harm and creates the space for others to have their experiences validated.

As you may know, the rates of PTSD in childbirth are growing. These statistics are ones that us here at PBB Media are not okay with. We will also leave some mental health resources below. If you are feeling like you need mental health support in relation to your birth or postpartum, know that you are not alone.

Mental health support for expecting and new parents:

https://forwhenhelpline.org.au / Call 1300 24 23 22 National Helpline on 1300 24 23 22 is now live between 9.00am-4.30pm – Monday to Friday.

Call ForWhen helpline, which is a national service and you can look up your area and link you in to support close to you 1300 24 23 22, forwhenhelpline.org.au

To be involved in Alysha-leigh's study:

To support and participate in this vital research (for this project, anyone with babies 6 months and younger), you can reach her here:

afam4556@uni.sydney.edu.au and www.australianbirthstudy.com

Upcoming free Birth Trauma event in Lismore:

https://www.instagram.com/p/CsDxQZTru4I/?igshid=NTc4MTIwNjQ2YQ==

]]>4324babies,birth,birthtrauma,childbirth,children,fathers,love,maternity,mothers,parenting,parents,postnatal,postpartum,pregnancy,traumafalsefullWhat's IVF like? With Holly Rankin-Smithhttps://www.spreaker.com/episode/what-s-ivf-like-with-holly-rankin-smith--51641586
We also explore the issues related to the IVF industry and the inequality of access, and look at ways we can help amplify the stories of people navigating this journey.

Holly Rankin Smith is a community development worker with a passion for advocacy, activism and social change. With over 15 years experience in the sector, she has worked on projects addressing a range of social challenges from isolated elderly in aged care to at to at risk rural youth. She is also a marriage and funeral celebrant and is fascinated by the ceremonies and rituals through life and death. Holly is passionate about shifting the stigma around IVF since her experience of 3 years trying to conceive with a very broad diagnosis of 'unexplained infertility'. A light through this dark experience was stories and connections with other women experiencing infertility, but this seemed hard to find which is strange when it's experienced by 1 in 6 Australian couples. Holly hopes by sharing her story she can help people who are experiencing infertility feel less alone and help give context for those who know someone going through it.
Contact: @hollyrs

It Starts With The Egg - The book Holly referenced
https://www.amazon.com.au/Starts-Egg-Second-Naturally-Miscarriage-ebook/dp/B07NJ85ZFJ]]>https://api.spreaker.com/episode/51641586Fri, 21 Oct 2022 06:53:29 +0000PBB Media IncorporatedIn this episode, host Rose Ricketson talks with community development worker Holly, about her experience with IVF in Australia. Holly shares a very personal IVF journey that impacted every corner of her life, shedding light upon a very common...
We also explore the issues related to the IVF industry and the inequality of access, and look at ways we can help amplify the stories of people navigating this journey.

Holly Rankin Smith is a community development worker with a passion for advocacy, activism and social change. With over 15 years experience in the sector, she has worked on projects addressing a range of social challenges from isolated elderly in aged care to at to at risk rural youth. She is also a marriage and funeral celebrant and is fascinated by the ceremonies and rituals through life and death. Holly is passionate about shifting the stigma around IVF since her experience of 3 years trying to conceive with a very broad diagnosis of 'unexplained infertility'. A light through this dark experience was stories and connections with other women experiencing infertility, but this seemed hard to find which is strange when it's experienced by 1 in 6 Australian couples. Holly hopes by sharing her story she can help people who are experiencing infertility feel less alone and help give context for those who know someone going through it.
Contact: @hollyrs

It Starts With The Egg - The book Holly referenced
https://www.amazon.com.au/Starts-Egg-Second-Naturally-Miscarriage-ebook/dp/B07NJ85ZFJ]]>3529falsefullBirth After Caesarean with Hazel Keedlehttps://www.spreaker.com/episode/birth-after-caesarean-with-hazel-keedle--51157050
Hazel has more than two decades of experience as a clinician in nursing and midwifery, educator and researcher. Hazel’s research interests are vaginal birth after caesarean, birth trauma and maternity experiences explored primarily using feminist mixed methodologies. Hazel's work is recognised nationally and internationally, with more than50 conference and seminar presentations including 15 as an invited speaker. Hazel has a developing publication track record as an early career researcher, with 15 peer reviewed publications and a best selling book for women based on her PhD findings, Birth after Caesarean, your journey to a better birth.

Linktree: https://linktr.ee/hazelkeedle (this has all the links to my papers, events, etc)
Instagram: @hazelkeedle
Facebook: @VBACmatters
Twitter: @HazelKeedle

Book on Amazon.com.au: https://tinyurl.com/2jmrfb9p]]>https://api.spreaker.com/episode/51157050Sat, 10 Sep 2022 07:36:23 +0000PBB Media IncorporatedRose Ricketson talks with Hazel Keedle, PhD, Lecturer of Midwifery at Western Sydney University and author of her recently released book Birth after Caesarean: Your Journey to a Better Birth. They discuss her research and findings around VBAC in...
Hazel has more than two decades of experience as a clinician in nursing and midwifery, educator and researcher. Hazel’s research interests are vaginal birth after caesarean, birth trauma and maternity experiences explored primarily using feminist mixed methodologies. Hazel's work is recognised nationally and internationally, with more than50 conference and seminar presentations including 15 as an invited speaker. Hazel has a developing publication track record as an early career researcher, with 15 peer reviewed publications and a best selling book for women based on her PhD findings, Birth after Caesarean, your journey to a better birth.

Linktree: https://linktr.ee/hazelkeedle (this has all the links to my papers, events, etc)
Instagram: @hazelkeedle
Facebook: @VBACmatters
Twitter: @HazelKeedle

Book on Amazon.com.au: https://tinyurl.com/2jmrfb9p]]>3638falsefullWhen Midwives give Birth. New research with Sharon Stoliarhttps://www.spreaker.com/episode/when-midwives-give-birth-new-research-with-sharon-stoliar--51086980
Guest: Sharon Stoliar

Produced and presented by Annalee Atia

Recorded on Bundjalung Country on August 13th, 2022

Links:

> Sharon's website plus pre order Sharon's new book Scars of Gold - www.sharonstoliar.com

> A national survey of Australian midwives’ birth choices and outcomes - https://www.sciencedirect.com/science/article/pii/S187151922200302X?dgcid=author

> Insider knowledge as a double-edged sword: an integrative review of midwives’ personal childbearing experiences - https://bmcpregnancychildbirth.biomedcentral.com/articles/10.1186/s12884-022-04962-y

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media Incorporated.

All rights reserved.

www.pbbmedia.org

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at the Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bundjalung nation, neighboring clans and people for caring for this country since time immemorial.]]>https://api.spreaker.com/episode/51086980Wed, 31 Aug 2022 03:29:47 +0000PBB Media IncorporatedIt would be reasonable to assume that the care one provides is the care one would be happy to receive. But this is not what new research reveals. Today on Pregnancy, Birth and Beyond Annalee Atia speaks with Sharon Stoliar - researcher, academic,...
Guest: Sharon Stoliar

Produced and presented by Annalee Atia

Recorded on Bundjalung Country on August 13th, 2022

Links:

> Sharon's website plus pre order Sharon's new book Scars of Gold - www.sharonstoliar.com

> A national survey of Australian midwives’ birth choices and outcomes - https://www.sciencedirect.com/science/article/pii/S187151922200302X?dgcid=author

> Insider knowledge as a double-edged sword: an integrative review of midwives’ personal childbearing experiences - https://bmcpregnancychildbirth.biomedcentral.com/articles/10.1186/s12884-022-04962-y

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media Incorporated.

All rights reserved.

www.pbbmedia.org

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at the Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bundjalung nation, neighboring clans and people for caring for this country since time immemorial.]]>3596academia,australianmothersandbabies,author,babies,birthtrauma,childbirth,equityinhealthcare,maternalmentalhealth,maternitycare,midwifery,newbooks,obstetrics,pbbmedia,postpartum,pregnancy,privatemidwife,research,respectfulmaternitycare,socialdeterminantsofhealth,valuebasedcarefalsefullRural maternity care with Catherine Bellhttps://www.spreaker.com/episode/rural-maternity-care-with-catherine-bell--50992180
Catherine Bell is the Birth Cartographer and creator of The Birth Map, an innovative approach to birth preparation. She is undertaking her PhD to evaluate the potential of The Birth Map in facilitating communication and decision making in maternity services.
As a community activator, she is not afraid to volunteer to ensure the future is one of compassion and connectedness. She sits on the board of Maternal Health Matters, is the ACT President of Maternity Choices Australia, treasurer for Braidwood Youth Performing Arts Association and a committee member for the Braidwood Community Association. She is also a Director of Tender Funerals Canberra Region, a not-for-profit, community-led approach to funeral care, seeking to establish.

You can find her at www.birthmap.life
IG @birthmapping and FB/TheBirthMap

Https://chf.org.au/social-prescribing

To our wonderful listeners. We love hearing from you and receiving your notes, questions and ideas.. how do you feel about this episode?
If you have any questions/comments at any time about this, other interviews or our work at PBB Media, get in touch. You can email us through hello@pbbmedia.org or catch us on socials @pbb_media.]]>https://api.spreaker.com/episode/50992180Mon, 22 Aug 2022 06:22:22 +0000PBB Media IncorporatedToday our host Rose is chatting with Catherine Bell about the need for better maternity care for rural women, consent and communication in maternity care, the need for rural midwives and policy change, and more. Catherine Bell is the Birth...
Catherine Bell is the Birth Cartographer and creator of The Birth Map, an innovative approach to birth preparation. She is undertaking her PhD to evaluate the potential of The Birth Map in facilitating communication and decision making in maternity services.
As a community activator, she is not afraid to volunteer to ensure the future is one of compassion and connectedness. She sits on the board of Maternal Health Matters, is the ACT President of Maternity Choices Australia, treasurer for Braidwood Youth Performing Arts Association and a committee member for the Braidwood Community Association. She is also a Director of Tender Funerals Canberra Region, a not-for-profit, community-led approach to funeral care, seeking to establish.

You can find her at www.birthmap.life
IG @birthmapping and FB/TheBirthMap

Https://chf.org.au/social-prescribing

To our wonderful listeners. We love hearing from you and receiving your notes, questions and ideas.. how do you feel about this episode?
If you have any questions/comments at any time about this, other interviews or our work at PBB Media, get in touch. You can email us through hello@pbbmedia.org or catch us on socials @pbb_media.]]>3887advocacy,birth,care,childbirth,maternity,midwife,motherhood,pregnancy,ruralfalsefullThe Realities of Single Motherhood with Klyne Lovehttps://www.spreaker.com/episode/the-realities-of-single-motherhood-with-klyne-love--50867429
Klyne is a radical advocate for Mother-centred care and feminine embodiment. She works in postpartum education and care, having completed trainings with Julia Jones from Newborn Mothers, Sophie Ward Koren from Milk & Seed and Rachelle Garcia Seliga from Innate Traditions. She is also a Qoya teacher and ultimately these two threads weave together as sacred spaces for women to connect deeply to themselves and access their intuitive Knowing and self-healing. At the core of her work is a burning passion for a collective returning to community and thriving life (not just survival).

She runs both in-person and online workshops.
Connect with her here.

https://www.klyne.love/about-4
Instagram: @ klyne.love
Website: www.klyne.love

If you loved this episode, please leave us a review or get in touch with us! @pbb_media]]>https://api.spreaker.com/episode/50867429Tue, 09 Aug 2022 22:35:40 +0000PBB Media IncorporatedToday's episode is with Klyne Love, who shares generously about her experience with single motherhood throughout floods, housing crises and a lot of grief. Despite being a heavy topic, Klyne has a spirit of hope and optimism and holds a beautiful...
Klyne is a radical advocate for Mother-centred care and feminine embodiment. She works in postpartum education and care, having completed trainings with Julia Jones from Newborn Mothers, Sophie Ward Koren from Milk & Seed and Rachelle Garcia Seliga from Innate Traditions. She is also a Qoya teacher and ultimately these two threads weave together as sacred spaces for women to connect deeply to themselves and access their intuitive Knowing and self-healing. At the core of her work is a burning passion for a collective returning to community and thriving life (not just survival).

She runs both in-person and online workshops.
Connect with her here.

https://www.klyne.love/about-4
Instagram: @ klyne.love
Website: www.klyne.love

If you loved this episode, please leave us a review or get in touch with us! @pbb_media]]>4827falsefull'Birth Time' in Retrospect With Jerusha Suttonhttps://www.spreaker.com/episode/birth-time-in-retrospect-with-jerusha-sutton--50770536
In this episode, Oni Blecher speaks with Jerusha about life since Birth Time; what's happening in the Birth Time movement and where key researchers are at with the aligning Birth Experiences Study.

Enjoy this conversation and find Jerusha through

@jerushasutton

www.jerushasutton.com.au

@birthtimeworld

www.birthtime.world]]>https://api.spreaker.com/episode/50770536Mon, 01 Aug 2022 08:05:43 +0000PBB Media IncorporatedJerusha Sutton is a doula, birth videographer, actor, and recently, one of the faces behind the documentary 'Birth Time'. In this episode, Oni Blecher speaks with Jerusha about life since Birth Time; what's happening in the Birth Time movement and...
In this episode, Oni Blecher speaks with Jerusha about life since Birth Time; what's happening in the Birth Time movement and where key researchers are at with the aligning Birth Experiences Study.

Enjoy this conversation and find Jerusha through

@jerushasutton

www.jerushasutton.com.au

@birthtimeworld

www.birthtime.world]]>3107birth,birthtime,love,maternitycare,parenting,postnatal,postpartum,pregnancyfalsefullLongform episode: Maternal Mental Healthhttps://www.spreaker.com/episode/longform-episode-maternal-mental-health--50700511hello@pbbmedia.org

Our live-stream event took place on Wednesday 6th May and was streamed through Facebook live via Maternal Mental Health Matters.

The focus for the panel discussion is celebrating mothers and marking World Maternal Mental Health Day in a positive way (prevention, solutions-based approach, support etc) - a panel of experts, practitioners and mothers coming together to discuss the latest in maternal health and wellbeing.

Maternal Mental Health Panellists:

* Dr Oscar Serrallach - Integrative Doctor with a special interest in maternal health and postnatal wellbeing. Dr Serrallach was the first to recognise something he termed Postnatal Depletion. The Postnatal Depletion Cure is his first book. 
* Callie Brown - Mother, Coach, writer, speaker and life enthusiast. 
* Dr Sophie Brock- Sociologist, mother, and founder of The Good Enough Mother: a podcast and platform for mothering discussion and resources. Sophie is also AMIRCI President. 
* Alecia Stains - Mother, Maternity Advocate, Director of Maternity Consumer Network and Hypnobirthing Educator. 
* Mary Kirk - Midwife and maternity advocate. Mary is Vice-President of International Confederation of Midwives and founder of Safe Motherhood For All - First Baby Campaign Inc. 
* Ella Noah Bnacroft, proud bundjalung woman, artist, published author, mentor, consultant and founder of “The Returning Indigenous Corporation”. The Returning is an Indigenous charity that brings health and wellness through a nature based approach and connection back to country led by Indigenous facilitators 
* Kirilly Dawn, Barkindji woman, doula and embodiment practitioner. Kirily is also a Development Director at PBB Media Incorporated.  
The panel is hosted by Sally Cusack from our acclaimed Pregnancy, Birth & Beyond podcast

Produced and directed by Annalee Atia, co-founder and Development Director at PBB Media Incorporated.

This panel discussion was recorded on Gadigal lands on Wednesday, 6 May 2020  

This event is brought to you by four major Australian nonprofits: Maternity Choices Australia, Safe Motherhood for All, Maternity Consumer Network and PBB Media Incorporated.

#maternalmhmatters #birthtraumaawarenessweek]]>https://api.spreaker.com/episode/50700511Mon, 25 Jul 2022 04:11:17 +0000PBB Media IncorporatedWelcome to Pregnancy, Birth and Beyond! Today we bring you a special podcast recorded in May 2020 for World Maternal Mental Health day. Birth Trauma Awareness week 2022 just concluded with a powerful theme this year on Birth Injuries. Our panel...hello@pbbmedia.org

Our live-stream event took place on Wednesday 6th May and was streamed through Facebook live via Maternal Mental Health Matters.

The focus for the panel discussion is celebrating mothers and marking World Maternal Mental Health Day in a positive way (prevention, solutions-based approach, support etc) - a panel of experts, practitioners and mothers coming together to discuss the latest in maternal health and wellbeing.

Maternal Mental Health Panellists:

* Dr Oscar Serrallach - Integrative Doctor with a special interest in maternal health and postnatal wellbeing. Dr Serrallach was the first to recognise something he termed Postnatal Depletion. The Postnatal Depletion Cure is his first book. 
* Callie Brown - Mother, Coach, writer, speaker and life enthusiast. 
* Dr Sophie Brock- Sociologist, mother, and founder of The Good Enough Mother: a podcast and platform for mothering discussion and resources. Sophie is also AMIRCI President. 
* Alecia Stains - Mother, Maternity Advocate, Director of Maternity Consumer Network and Hypnobirthing Educator. 
* Mary Kirk - Midwife and maternity advocate. Mary is Vice-President of International Confederation of Midwives and founder of Safe Motherhood For All - First Baby Campaign Inc. 
* Ella Noah Bnacroft, proud bundjalung woman, artist, published author, mentor, consultant and founder of “The Returning Indigenous Corporation”. The Returning is an Indigenous charity that brings health and wellness through a nature based approach and connection back to country led by Indigenous facilitators 
* Kirilly Dawn, Barkindji woman, doula and embodiment practitioner. Kirily is also a Development Director at PBB Media Incorporated.  
The panel is hosted by Sally Cusack from our acclaimed Pregnancy, Birth & Beyond podcast

Produced and directed by Annalee Atia, co-founder and Development Director at PBB Media Incorporated.

This panel discussion was recorded on Gadigal lands on Wednesday, 6 May 2020  

This event is brought to you by four major Australian nonprofits: Maternity Choices Australia, Safe Motherhood for All, Maternity Consumer Network and PBB Media Incorporated.

#maternalmhmatters #birthtraumaawarenessweek]]>7702australia,birthtraumaawarenessweek,btaw2022,childbirth,droscarserralach,drsophiebrock,maternalmentalhealth,maternalmhmatters,maternitycare,matrescence,mentalhealth,motherhood,obstetrics,obstetricviolence,parenting,postnatal,postpartum,reproductivehealthcarefalsefull'Parturescence' and the birth of a parent with midwife Ella Kurzhttps://www.spreaker.com/episode/parturescence-and-the-birth-of-a-parent-with-midwife-ella-kurz--50464021
Today we chat through her work in maternal and child health research at the University of Canberra, as well the term 'parturescence' she coined in her PhD to refer to the opportunities for transformation made possible through childbirth. Ella was awarded the Stephen Parker medal for outstanding thesis for this work.
She recently co-edited the anthology What We Carry: Poetry on Childbearing (Recent Work Press, 2021) and authored My Mother is a Midwife.

What We Carry:
www.amazon.com.au/What-We-Carry-Poetry-Childbearing/dp/0645009091
www.ellakurz.com]]>https://api.spreaker.com/episode/50464021Mon, 04 Jul 2022 23:08:08 +0000PBB Media IncorporatedDr Ella Kurz is a midwife from Ngunnawal Country in the ACT. Today we chat through her work in maternal and child health research at the University of Canberra, as well the term 'parturescence' she coined in her PhD to refer to the opportunities...
Today we chat through her work in maternal and child health research at the University of Canberra, as well the term 'parturescence' she coined in her PhD to refer to the opportunities for transformation made possible through childbirth. Ella was awarded the Stephen Parker medal for outstanding thesis for this work.
She recently co-edited the anthology What We Carry: Poetry on Childbearing (Recent Work Press, 2021) and authored My Mother is a Midwife.

What We Carry:
www.amazon.com.au/What-We-Carry-Poetry-Childbearing/dp/0645009091
www.ellakurz.com]]>3121falsefullMaternal eco-psychology with Allison Davishttps://www.spreaker.com/episode/maternal-eco-psychology-with-allison-davis--50261083Allison is a counsellor, educator and researcher of maternal mental health.
Today we discuss the ecological domain of matrescence - learning to approach the challenges and struggles with a viewpoint of growth and transformation. We look at how our evolution can mirror the evolutionary processes of nature and how we can align ourselves with nature's desire for growth.
Allison's work focuses on the development of mothers' psycho-ecological growth in matrescence, aiming to reframe eco-related distress as resilience, and offering a path through the mental health dangers of idealised 'green motherhood' towards lifestyles that are psychologically healthy, and ecologically sustainable.
Through articulation and application of an ecofeminist-informed developmental approach, she fosters ecological thinking and contact with nature for psychotherapeutic healing and growth.

She works in private practice at Mother Nature Therapy, teaches in the Master of Counseling program at Alliant International University, and researches in the Maternal Psychology Lab at Teachers College, Columbia University.

Links:
https://www.instagram.com/dr.allisondavis/
https://www.instagram.com/mothernaturetherapy/
https://www.mothernaturetherapy.com/climate-circles]]>https://api.spreaker.com/episode/50261083Mon, 20 Jun 2022 09:05:35 +0000PBB Media IncorporatedAllison Davis joins us today from New Mexico, USA. Allison is a counsellor, educator and researcher of maternal mental health. Today we discuss the ecological domain of matrescence - learning to approach the challenges and struggles with a...Allison is a counsellor, educator and researcher of maternal mental health.
Today we discuss the ecological domain of matrescence - learning to approach the challenges and struggles with a viewpoint of growth and transformation. We look at how our evolution can mirror the evolutionary processes of nature and how we can align ourselves with nature's desire for growth.
Allison's work focuses on the development of mothers' psycho-ecological growth in matrescence, aiming to reframe eco-related distress as resilience, and offering a path through the mental health dangers of idealised 'green motherhood' towards lifestyles that are psychologically healthy, and ecologically sustainable.
Through articulation and application of an ecofeminist-informed developmental approach, she fosters ecological thinking and contact with nature for psychotherapeutic healing and growth.

She works in private practice at Mother Nature Therapy, teaches in the Master of Counseling program at Alliant International University, and researches in the Maternal Psychology Lab at Teachers College, Columbia University.

Links:
https://www.instagram.com/dr.allisondavis/
https://www.instagram.com/mothernaturetherapy/
https://www.mothernaturetherapy.com/climate-circles]]>3830falsefullDown to Birth Midwifery with Sarah Smitshttps://www.spreaker.com/episode/down-to-birth-midwifery-with-sarah-smits--50111837
Today we discuss home birth midwifery practice, traditional approaches to maternal care, self-responsibility, community care, postpartum wellbeing and more.

W: www.downtobirthmidwifery.com
Instagram @down_to_birth_midwifery
Details for The Midwife Project Guatemaya
Website: www.midwifeproject.net
Go fund me: www.gofundme.com/f/support-the-midwife-project-guatemaya

To our wonderful listeners.
We love hearing from you and receiving your notes, questions and ideas.. how do you feel about this episode?
If you have any questions/comments at any time about this, other interviews or our work at PBB Media, get in touch. You can email us through hello@pbbmedia.org or catch us on socials @pbb_media.]]>https://api.spreaker.com/episode/50111837Tue, 07 Jun 2022 20:42:03 +0000PBB Media IncorporatedToday's guest is Sarah Smits, who joins us from Lake Atitlan in Guatemala where she is learning traditional Mayan practices. Sarah is a home birth midwife, lactation consultant and body worker who incorporates her experience of travelling the world...
Today we discuss home birth midwifery practice, traditional approaches to maternal care, self-responsibility, community care, postpartum wellbeing and more.

W: www.downtobirthmidwifery.com
Instagram @down_to_birth_midwifery
Details for The Midwife Project Guatemaya
Website: www.midwifeproject.net
Go fund me: www.gofundme.com/f/support-the-midwife-project-guatemaya

To our wonderful listeners.
We love hearing from you and receiving your notes, questions and ideas.. how do you feel about this episode?
If you have any questions/comments at any time about this, other interviews or our work at PBB Media, get in touch. You can email us through hello@pbbmedia.org or catch us on socials @pbb_media.]]>3802falsefullNorthern Rivers Devastating floods and the heartening Community Responsehttps://www.spreaker.com/episode/northern-rivers-devastating-floods-and-the-heartening-community-response--48990565
MUSIC:
The music you will hear on this podcast is by local Artist and song- weaver Olivia Rosebery, her potent song REMEMBER echoing a message of hope for everyone in need during these trying times. Find Olivia on socials @olivia.rosebery.music and www.oliviarosebery.com

DONATE

Pregnancy, Birth and Beyond Fundraiser for Northern Rivers Birthing Families https://gofund.me/777ad721

EPISODE INFORMATION:

Guest: Oni Blecher. Oni is a PBB Media Producer and Creator, Craniosacral, Arvigo, Visceral + Myofascial release practitioner and Poet @thetempleofwords and Village keeper @@earthedtobirth. Find Oni @oni_keeperofthehearth

Get in touch and info about The Pregnancy, Birth and Beyond Community Hub www.pbbmedia.org / hello@pbbmedia.org

SEEK/GIVE support at Northern Rivers Community Volunteer Directory NRVD.ORG

Guardian Article Anatomy of a ‘rain bomb’: scientists strive to understand phenomenon that caused Australia’s east coast floods https://www.theguardian.com/australia-news/2022/mar/05/anatomy-of-a-rain-bomb-scientists-study-phenomenon-2022-australia-east-coast-floods

More links coming soon.

Produced by Annalee Atia for PBB Media. All rights reserved.

www.pbbmedia.org

This episode was recorded on Gadigal lands and Bundjalung Country.

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at the Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bundjalung nation, neighboring clans and people for caring for this country since time immemorial.]]>https://api.spreaker.com/episode/48990565Tue, 08 Mar 2022 12:00:39 +0000PBB Media IncorporatedHi out there to our listeners, its Annalee. It is Tuesday, 8th of March in 2022. We are bringing you a special bulletin on the catastrophic flooding in Northern NSW, Australia. In the early hours of Monday 27th February, a little over a week ago,...
MUSIC:
The music you will hear on this podcast is by local Artist and song- weaver Olivia Rosebery, her potent song REMEMBER echoing a message of hope for everyone in need during these trying times. Find Olivia on socials @olivia.rosebery.music and www.oliviarosebery.com

DONATE

Pregnancy, Birth and Beyond Fundraiser for Northern Rivers Birthing Families https://gofund.me/777ad721

EPISODE INFORMATION:

Guest: Oni Blecher. Oni is a PBB Media Producer and Creator, Craniosacral, Arvigo, Visceral + Myofascial release practitioner and Poet @thetempleofwords and Village keeper @@earthedtobirth. Find Oni @oni_keeperofthehearth

Get in touch and info about The Pregnancy, Birth and Beyond Community Hub www.pbbmedia.org / hello@pbbmedia.org

SEEK/GIVE support at Northern Rivers Community Volunteer Directory NRVD.ORG

Guardian Article Anatomy of a ‘rain bomb’: scientists strive to understand phenomenon that caused Australia’s east coast floods https://www.theguardian.com/australia-news/2022/mar/05/anatomy-of-a-rain-bomb-scientists-study-phenomenon-2022-australia-east-coast-floods

More links coming soon.

Produced by Annalee Atia for PBB Media. All rights reserved.

www.pbbmedia.org

This episode was recorded on Gadigal lands and Bundjalung Country.

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at the Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bundjalung nation, neighboring clans and people for caring for this country since time immemorial.]]>2970childbirth,community,communityjournalism,fundraising,motherhood,northernrivers,nswfloods,parenting,postpartum,pregnancyfalsefullA vagina in the house. Motherhood, blended parenting, painful & vital talk and love with Lissie Turnerhttps://www.spreaker.com/episode/a-vagina-in-the-house-motherhood-blended-parenting-painful-vital-talk-and-love-with-lissie-turner--48261501
Lissie is also a fellow Vagina (as we are lovingly called by the producer of the Vagina Conversations, Zenith Virago) and is working on her next piece for the show, which we touch on too in our conversation. It’s been a while that we have wanted to interview Lissie for the show, she is a wonderful female role model in our community with a colourful past and a powerful salubrious journey of redemption. As women do, we gathered and circled and touched on several themes from this evocative journey. You can find Lissie on on the Living Harmoniously Podcast and through the links below.

Show Links:
https://www.lissieturner.com/
IG @lissieturner

To our wonderful listeners.
We love hearing from you and receiving your notes, questions and ideas.. how do you feel about this topic? Have you had a similar experience or would like to share your insights?

If you have any questions/comments at any time about this, other interviews or our work at PBB Media, get in touch. You can email us through hello@pbbmedia.org or catch us on socials @pbb_media.

Guest/Interviewee: Lissie Turner

Recorded January 2022

Produced and presented by Annalee Atia

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

This episode was recorded on Bundjalung Country.

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at the Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bundjalung nation, neighboring clans and people for caring for this country since time immemorial.]]>https://api.spreaker.com/episode/48261501Wed, 12 Jan 2022 08:41:15 +0000PBB Media IncorporatedLissie Turner is our guest today on Pregnancy, Birth and Beyond. Lissie is a mother, blended family parent, foster carer, grandmother and an accomplished radio host and producer in the music industry. She is the creator of several renowned Yoga and...
Lissie is also a fellow Vagina (as we are lovingly called by the producer of the Vagina Conversations, Zenith Virago) and is working on her next piece for the show, which we touch on too in our conversation. It’s been a while that we have wanted to interview Lissie for the show, she is a wonderful female role model in our community with a colourful past and a powerful salubrious journey of redemption. As women do, we gathered and circled and touched on several themes from this evocative journey. You can find Lissie on on the Living Harmoniously Podcast and through the links below.

Show Links:
https://www.lissieturner.com/
IG @lissieturner

To our wonderful listeners.
We love hearing from you and receiving your notes, questions and ideas.. how do you feel about this topic? Have you had a similar experience or would like to share your insights?

If you have any questions/comments at any time about this, other interviews or our work at PBB Media, get in touch. You can email us through hello@pbbmedia.org or catch us on socials @pbb_media.

Guest/Interviewee: Lissie Turner

Recorded January 2022

Produced and presented by Annalee Atia

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

This episode was recorded on Bundjalung Country.

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at the Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bundjalung nation, neighboring clans and people for caring for this country since time immemorial.]]>2733addiction,birth,blendedfamilies,childbirth,children,fostercare,mother,motherhood,parenthood,postpartum,pregnancy,radio,story,storytelling,wecandohardthings,woman,womeninmusic,womenproducers,womenshealth,yogafalsefullMidwifery in Private Practice, Mothers & Babies report and deskilling in Maternity Carehttps://www.spreaker.com/episode/midwifery-in-private-practice-mothers-babies-report-and-deskilling-in-maternity-care--48032944
In this episode of Pregnancy, Birth and Beyond, we catch up with privately practicing Australian Midwives Astra Joynt and Sunae Reilly. We chat deskilling in midwifery and the maternity care profession, the latest Mothers and Babies report from the Australian Institute of Health Welfare, March of the Midwives in the UK, vexatious reporting in Midwifery and what it takes to be a Jedi Midwife in today’s healthcare landscape. We also touched on Homebirth, vaginal birth of twins, breech birth and being prepared for childbirth.

About our guests:

Sunae Reilly is a private midwife living and working in the Northern Rivers of NSW on the land of the Bundjalung people of the Bundjalung Nation. She finds great joy in seeing women and birthing people find their inner strength and power in pregnancy and birth and supporting them in their transition to parenthood. Sunae is available for antenatal, labour and birth, and postnatal care between Byron Bay and Grafton. You can find her at Artemis Midwifery. www.artemismidwifery.com.au and @artemismidwifery on Instagram

Since 2008 Astra Joynt (Endorsed Midwife) has worked in a variety of settings in both large urban and small regional hospitals, in the community and at home. She passionately believes in maternity care that puts the needs and desires of the woman and her family at the centre of the experience, and that building a trusting relationship is the best way to achieve this. Astra offers Medicare rebatable antenatal & postnatal care to all women, regardless of planned place to birth, with bulk-billing available. Home-birth packages also available. To discuss how Astra can work with you email astra.joynt@gmail.com

Referenced during the interview:

>> Dr Denis Walsh: https://www.nottingham.ac.uk/news/expertiseguide/health-sciences/dr-denis-walsh-.aspx
>> Australia's Mothers and Babies Report December 2021: https://www.aihw.gov.au/reports/mothers-babies/australias-mothers-babies/contents/about
>> Dr Neel Shah interview: https://www.spreaker.com/user/pregnancybirthandbeyond/dr-neel-shah-csection
>> Dr Stu (Stuart James Fischbein, MD): http://www.birthinginstincts.com/
>> Dr Andrew Bisits: https://wch.med.unsw.edu.au/people/associate-professor-andrew-bisits

To our dear listeners!
We'd love to hear from you - how do you feel about deskilling in maternity care? Have you had an experience where you were unable to access appropriate maternity healthcare because of deskilling or a lack of those services in your area (such as publicly funded homebirth or Midwifery continuity models)?
And if you have any questions/comments at any time about this, other interviews or our work at PBB Media, get in touch. You can shoot us a line at hello@pbbmedia.org or catch us on socials @pbb_media !

Guests: Astra Joynt and Sunae Reilly

Produced, edited and presented by Annalee Atia

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

This episode was recorded on Gadigal Lands (Sydney).

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bundjalung nation, neighboring clans and people for caring for this country since time immemorial.]]>https://api.spreaker.com/episode/48032944Thu, 23 Dec 2021 07:13:23 +0000PBB Media IncorporatedMidwifery in Private Practice, Mothers & Babies 2021, March of Midwives and deskilling in Maternity Care In this episode of Pregnancy, Birth and Beyond, we catch up with privately practicing Australian Midwives Astra Joynt and Sunae Reilly. We chat...
In this episode of Pregnancy, Birth and Beyond, we catch up with privately practicing Australian Midwives Astra Joynt and Sunae Reilly. We chat deskilling in midwifery and the maternity care profession, the latest Mothers and Babies report from the Australian Institute of Health Welfare, March of the Midwives in the UK, vexatious reporting in Midwifery and what it takes to be a Jedi Midwife in today’s healthcare landscape. We also touched on Homebirth, vaginal birth of twins, breech birth and being prepared for childbirth.

About our guests:

Sunae Reilly is a private midwife living and working in the Northern Rivers of NSW on the land of the Bundjalung people of the Bundjalung Nation. She finds great joy in seeing women and birthing people find their inner strength and power in pregnancy and birth and supporting them in their transition to parenthood. Sunae is available for antenatal, labour and birth, and postnatal care between Byron Bay and Grafton. You can find her at Artemis Midwifery. www.artemismidwifery.com.au and @artemismidwifery on Instagram

Since 2008 Astra Joynt (Endorsed Midwife) has worked in a variety of settings in both large urban and small regional hospitals, in the community and at home. She passionately believes in maternity care that puts the needs and desires of the woman and her family at the centre of the experience, and that building a trusting relationship is the best way to achieve this. Astra offers Medicare rebatable antenatal & postnatal care to all women, regardless of planned place to birth, with bulk-billing available. Home-birth packages also available. To discuss how Astra can work with you email astra.joynt@gmail.com

Referenced during the interview:

>> Dr Denis Walsh: https://www.nottingham.ac.uk/news/expertiseguide/health-sciences/dr-denis-walsh-.aspx
>> Australia's Mothers and Babies Report December 2021: https://www.aihw.gov.au/reports/mothers-babies/australias-mothers-babies/contents/about
>> Dr Neel Shah interview: https://www.spreaker.com/user/pregnancybirthandbeyond/dr-neel-shah-csection
>> Dr Stu (Stuart James Fischbein, MD): http://www.birthinginstincts.com/
>> Dr Andrew Bisits: https://wch.med.unsw.edu.au/people/associate-professor-andrew-bisits

To our dear listeners!
We'd love to hear from you - how do you feel about deskilling in maternity care? Have you had an experience where you were unable to access appropriate maternity healthcare because of deskilling or a lack of those services in your area (such as publicly funded homebirth or Midwifery continuity models)?
And if you have any questions/comments at any time about this, other interviews or our work at PBB Media, get in touch. You can shoot us a line at hello@pbbmedia.org or catch us on socials @pbb_media !

Guests: Astra Joynt and Sunae Reilly

Produced, edited and presented by Annalee Atia

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

This episode was...]]>3178australianmothersandbabies,babies,birthtrauma,breechbirth,childbirth,deskilling,equityinhealthcare,homebirth,maternalmentalhealth,maternitycare,midwifery,overdiagnosis,pbbmedia,postpartum,pregnancy,privatemidwife,respectfulmaternitycare,socialdeterminantsofhealth,twinbirth,valuebasedcarefalsefullMaternity Choices In The Time of COVID with Annalee Atia From Maternity Choices Australia and Nadine Richardson from SheBirthshttps://www.spreaker.com/episode/maternity-choices-in-the-time-of-covid-with-annalee-atia-from-maternity-choices-australia-and-nadine-richardson-from-shebirths--47712268
In this conversation, Annalee Atia from Maternity Choices Australia and PBB Media speaks with Nadine Richardson about how adverse times can further inspire us to commit to being responsible in advocating for our choices in Pregnancy, Birth, and Beyond. This is not a 'how to' guide, rather a reminder of human rights in healthcare settings, specifically in the pregnancy, birth, and parenting realms.

These times are confusing for most. Our value systems are swimming hard to keep up with variations of instruction and direction. What does this mean for birth ? Our Birth rights are never in lock down.

Thank you for your support. Please feel free to leave reviews, feedback, or to simply get in touch with the team. We love hearing from you.

Enjoy this conversation !]]>https://api.spreaker.com/episode/47712268Tue, 30 Nov 2021 00:03:53 +0000PBB Media IncorporatedThis is a special edition interview coming from the SheBirths podcast ! In this conversation, Annalee Atia from Maternity Choices Australia and PBB Media speaks with Nadine Richardson about how adverse times can further inspire us to commit to...
In this conversation, Annalee Atia from Maternity Choices Australia and PBB Media speaks with Nadine Richardson about how adverse times can further inspire us to commit to being responsible in advocating for our choices in Pregnancy, Birth, and Beyond. This is not a 'how to' guide, rather a reminder of human rights in healthcare settings, specifically in the pregnancy, birth, and parenting realms.

These times are confusing for most. Our value systems are swimming hard to keep up with variations of instruction and direction. What does this mean for birth ? Our Birth rights are never in lock down.

Thank you for your support. Please feel free to leave reviews, feedback, or to simply get in touch with the team. We love hearing from you.

Enjoy this conversation !]]>4897birth,father,fatherhood,health,healthcare,humanrights,love,maternity,maternitychoices,mother,motherhood,parenting,parents,postpartum,pregnancyfalsefullRevolutionising Home Birth with Dr Melanie Jacksonhttps://www.spreaker.com/episode/revolutionising-home-birth-with-dr-melanie-jackson--46947493
In this episode Kirilly Dawn is joined by Dr Melanie Jackson as we unravel some of these questions and take a deep look into the history of home birth, where we are today, and where we need to go. Dr Melanie Jackson is a private midwife living in the Blue Mountains in Sydney who has been attending women giving birth at home for 13 years, and has two homebirthed children herself. Melanie has completed a PhD called ‘Birthing outside the system’ and she also works as a midwifery researcher at western Sydney university.

You can find out more about Melanie and the mentorship she offers for midwives wanting to enter private practice at www.melaniethemidwife.com, her YouTube channel Melanie the Midwife, and on IG and Facebook @melaniethemidwife]]>https://api.spreaker.com/episode/46947493Tue, 12 Oct 2021 23:49:06 +0000PBB Media IncorporatedDuring this pandemic, there has been a huge increase in the demand for home birth in Australia and private practicing midwives are being flooded with calls from women and birthing people looking to birth outside of the hospital system. However, the...
In this episode Kirilly Dawn is joined by Dr Melanie Jackson as we unravel some of these questions and take a deep look into the history of home birth, where we are today, and where we need to go. Dr Melanie Jackson is a private midwife living in the Blue Mountains in Sydney who has been attending women giving birth at home for 13 years, and has two homebirthed children herself. Melanie has completed a PhD called ‘Birthing outside the system’ and she also works as a midwifery researcher at western Sydney university.

You can find out more about Melanie and the mentorship she offers for midwives wanting to enter private practice at www.melaniethemidwife.com, her YouTube channel Melanie the Midwife, and on IG and Facebook @melaniethemidwife]]>3714birth,doula,homebirth,medicare,midwifery,midwives,systemchangefalsefullEva Rose: A Life in Birthhttps://www.spreaker.com/episode/eva-rose-a-life-in-birth--45132080
Eva Rose is an internationally renowned Norwegian birth photographer, videographer, documentary filmmaker, doula, and by virtue of all of these things; an activist for many birth issues. Eva is a third generation photographer, and in 1999, when she was 19, Eva Rose started her career in birth photography for a magazine called ‘Pregnancy’.

Eva has wholly dedicated her life to being with birth. She’s been showing the wider public the intimacies of birth for over 20 years, and through the beauty of this exposure, has normalised many parts of the huge moving picture of pregnancy, birth, and postpartum. With her decades of experience, Eva has seen all kinds of birthing experiences. Now she has a huge instagram following with her grateful followers vouching that her photographs and stories create accessible education. Eva and her partner’s video ‘The Birth of Purdie’ has had 1.9 million views and counting. In her work, Eva frequently sheds light on birth related things people don’t usually talk about; including practices of clinicians, cross cultural ways of birthing, early birth, still birth, and sharing a plethora of various birth stories from her followers.

Last year, Eva and her partner OJ started filming a birth around the world documentary until their filming was cut short by COVID. Now, she is doing other very inspiring things in her home country of Norway. I have been following Eva for a long time now, and was so excited to speak with her. She is passionate and the fire lit inside of her is warm and illuminating. I hope you enjoy this conversation. If you haven’t already, check out Eva’s instagram and her incredible birth photos.

Find Eva at @evarosebirth evarose.carrd.co/ and Youtube: Eva Rose Birth]]>https://api.spreaker.com/episode/45132080Wed, 02 Jun 2021 18:00:12 +0000PBB Media IncorporatedIn this episode, Oni Blecher interviews Eva Rose. Eva Rose is an internationally renowned Norwegian birth photographer, videographer, documentary filmmaker, doula, and by virtue of all of these things; an activist for many birth issues. Eva is a...
Eva Rose is an internationally renowned Norwegian birth photographer, videographer, documentary filmmaker, doula, and by virtue of all of these things; an activist for many birth issues. Eva is a third generation photographer, and in 1999, when she was 19, Eva Rose started her career in birth photography for a magazine called ‘Pregnancy’.

Eva has wholly dedicated her life to being with birth. She’s been showing the wider public the intimacies of birth for over 20 years, and through the beauty of this exposure, has normalised many parts of the huge moving picture of pregnancy, birth, and postpartum. With her decades of experience, Eva has seen all kinds of birthing experiences. Now she has a huge instagram following with her grateful followers vouching that her photographs and stories create accessible education. Eva and her partner’s video ‘The Birth of Purdie’ has had 1.9 million views and counting. In her work, Eva frequently sheds light on birth related things people don’t usually talk about; including practices of clinicians, cross cultural ways of birthing, early birth, still birth, and sharing a plethora of various birth stories from her followers.

Last year, Eva and her partner OJ started filming a birth around the world documentary until their filming was cut short by COVID. Now, she is doing other very inspiring things in her home country of Norway. I have been following Eva for a long time now, and was so excited to speak with her. She is passionate and the fire lit inside of her is warm and illuminating. I hope you enjoy this conversation. If you haven’t already, check out Eva’s instagram and her incredible birth photos.

Find Eva at @evarosebirth evarose.carrd.co/ and Youtube: Eva Rose Birth]]>4993activist,birth,education,love,maternitycare,maternityhealth,norway,parenthood,photography,postnatal,postpartum,pregnancy,videographyfalsefullThe Grave Impact of Maternity Care Meconium Policies on Women.https://www.spreaker.com/episode/the-grave-impact-of-maternity-care-meconium-policies-on-women--44941848
At the time, Tori was a young, fit and healthy pregnant woman, growing up in outback Australia on a 14,000 acre farm, heading to girl’s boarding school in Sydney for high schooling. She later stays on in Sydney for University, eventually meeting her husband and then becoming pregnant with her first child.

Tori is a resilient woman by all accounts. A well educated woman, she was relatively well informed and chose a continuity model of care for her maternity care along with other support. Options that at the time, and even now, are available to few women in Australia.

Even with all that, Tori’s experience of childbirth was traumatic. Tori’s family nearly lost her and her baby. Now mother of four, a clear picture emerges from her first birthing experience - unnecessary interventions from ill-informed policies and those being imposed on her and her body at the wrong time, leading to grave lasting harm that lives on today. The price of this harm being paid by mother, child, family and the wider community - but with very little awareness from the medical systems involved.

Meconium present during the last leg of labour engaged a policy that failed to protect from harm and directly caused further harm to mother and baby.

Follow the link to Dr Rachel Reed’s blog post to find out more about meconium during labour:
https://midwifethinking.com/2015/01/14/the-curse-of-meconium-stained-liquor/

This podcast was recorded on Bundjalung Country, an area encompassing Byron Bay and surrounding flatlands, hills and rivers. We pay our respect to elders past, present and those emerging and deeply acknowledge the traditional custodians of this land whose cultures and customs have nurtured and continue to nurture this land and waters for over 60,000 years and upon which we now work and live. We recognise that the sovereignty of the pre-colonial peoples of these lands was never ceded and that recognition of culture, connection to land and waters and the sovereignty of all indigenous peoples across Australia is a matter of current and vital importance.

First published on Speaker on 21st May, 2021.

Guest: Tori Heath

Produced and presented by Annalee Atia

Original Music by Romy Agam Rom
https://www.romyagamrom.com

All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/44941848Fri, 21 May 2021 04:02:15 +0000PBB Media IncorporatedIt’s 21st May, 2021 and some months back I caught up with Tori Heath, mother of four with a background in psychology, who has worked in child protection and executive recruitment. We meet to recount the story of her first birth experience. At the...
At the time, Tori was a young, fit and healthy pregnant woman, growing up in outback Australia on a 14,000 acre farm, heading to girl’s boarding school in Sydney for high schooling. She later stays on in Sydney for University, eventually meeting her husband and then becoming pregnant with her first child.

Tori is a resilient woman by all accounts. A well educated woman, she was relatively well informed and chose a continuity model of care for her maternity care along with other support. Options that at the time, and even now, are available to few women in Australia.

Even with all that, Tori’s experience of childbirth was traumatic. Tori’s family nearly lost her and her baby. Now mother of four, a clear picture emerges from her first birthing experience - unnecessary interventions from ill-informed policies and those being imposed on her and her body at the wrong time, leading to grave lasting harm that lives on today. The price of this harm being paid by mother, child, family and the wider community - but with very little awareness from the medical systems involved.

Meconium present during the last leg of labour engaged a policy that failed to protect from harm and directly caused further harm to mother and baby.

Follow the link to Dr Rachel Reed’s blog post to find out more about meconium during labour:
https://midwifethinking.com/2015/01/14/the-curse-of-meconium-stained-liquor/

This podcast was recorded on Bundjalung Country, an area encompassing Byron Bay and surrounding flatlands, hills and rivers. We pay our respect to elders past, present and those emerging and deeply acknowledge the traditional custodians of this land whose cultures and customs have nurtured and continue to nurture this land and waters for over 60,000 years and upon which we now work and live. We recognise that the sovereignty of the pre-colonial peoples of these lands was never ceded and that recognition of culture, connection to land and waters and the sovereignty of all indigenous peoples across Australia is a matter of current and vital importance.

First published on Speaker on 21st May, 2021.

Guest: Tori Heath

Produced and presented by Annalee Atia

Original Music by Romy Agam Rom
https://www.romyagamrom.com

All rights reserved.

www.pbbmedia.org]]>1520auspol,auspol2021,australianhealthcare,bettermaternity2021,birthtrauma,childbirth,costofhealthcare,federalelections,maternitycare,motherhood,parenting,pbbmedia,podcast,postpartum,pregnancy,womenandbabies,womenshealthfalsefullBirth Experiences Study: The Biggest of its Kind! What is it and how to get involved.https://www.spreaker.com/episode/birth-experiences-study-the-biggest-of-its-kind-what-is-it-and-how-to-get-involved--44504015
Today on Pregnancy, Birth and Beyond, Oni Blecher speaks with Dr Hazel Keedle researcher at Western Sydney University and Annalee Atia, National President of Maternity Choices Australia and co-founder of our very own PBB Media about a critically important new study looking into the birth and perinatal care experiences of mothers in Australia.

The Birth Experience Study (BESt) can be completed here, only complete this questionnaire if you are Australian and have given birth in Australia in the past five years: https://surveyswesternsydney.au1.qualtrics.com/CP/File.php?F=F_3FeQerXzd8yoeI6

To donate and support the study head to the Community Funding Campaign: https://gofund.me/c92a1829

Maternity Choices Australia: www.maternitychoices.org

Guests:
Dr Hazel Keedle
Annalee Atia

Produced & Edited by Oni Blecher and Annalee Atia
Presented by Oni Blecher

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Budjalung nation, neighbouring clans and people for caring for this country since time immemorial.]]>https://api.spreaker.com/episode/44504015Tue, 27 Apr 2021 04:22:27 +0000PBB Media IncorporatedIf you are someone that understands how important maternity care and the perinatal period are for mother, baby, family and community health and wellbeing, tune in today to learn about vital new research into mothers experiences of maternity healthcare...
Today on Pregnancy, Birth and Beyond, Oni Blecher speaks with Dr Hazel Keedle researcher at Western Sydney University and Annalee Atia, National President of Maternity Choices Australia and co-founder of our very own PBB Media about a critically important new study looking into the birth and perinatal care experiences of mothers in Australia.

The Birth Experience Study (BESt) can be completed here, only complete this questionnaire if you are Australian and have given birth in Australia in the past five years: https://surveyswesternsydney.au1.qualtrics.com/CP/File.php?F=F_3FeQerXzd8yoeI6

To donate and support the study head to the Community Funding Campaign: https://gofund.me/c92a1829

Maternity Choices Australia: www.maternitychoices.org

Guests:
Dr Hazel Keedle
Annalee Atia

Produced & Edited by Oni Blecher and Annalee Atia
Presented by Oni Blecher

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Budjalung nation, neighbouring clans and people for caring for this country since time immemorial.]]>1981babies,birth,childbirth,continuityofcare,equityinhealthcare,humanrightsinchildbirth,maternalmentalhealth,maternitycare,maternitychoices,midwifery,motherhood,mothers,obstetrics,pnda,postnatal,pregnancy,ptsd,research,socialdeterminantsofhealth,womensrightsinchildbirthfalsefullReclaiming the Rebozo with Mayte Acolt and Montse Olmoshttps://www.spreaker.com/episode/reclaiming-the-rebozo-with-mayte-acolt-and-montse-olmos--44429643
In this conversation Montse and Mayte generously share on the cultural use, meaning and place of the Rebozo in their Indigenous communities and in traditional midwifery practices in Mexico, and how this knowledge is traditionally passed down. They share why they started this petition, and why proper training with Indigenous birthworkers is necessary for the Rebozo to be used safely and with respect, acknowledging it as an intervention. They also speak to being in relationship with the communities we learn from, the importance of accountability, how birth work and anti racism work go hand in hand, and give us points for necessary pause and reflection.

Montse Olmos and Mayte Acolt are Totonaca Indigenous birth companions and migrants in the United States. Mayte is a traditional Sobadora since age seven, taught by her grandmother. Montse was raised by her family elders who practiced herbal medicine, Sobadas and energetic healing. They host "What You Didn't Know About the Rebozo" together and share about the history of the Rebozo from an Indigenous perspective, while connecting it to the work of anti-racism, Indigenous liberation and becoming an accomplice to historically oppressed communities. Mayte and Montse began a movement in March 2021 to remove Rebozo birth techniques from Doula Training Organization in the U.S., as a result of the excessive and inappropriate use of this sacred textile amongst Doulas and Midwives. They conduct this work with genuine concern for the commercialization and dilution of the Rebozo and propose that extensive mentorship and hands-on learning from expert Elders is necessary in order to practice Rebozo body-work in an ethical way.

Link to the petition titled "Removing Rebozo Teachings from Doula Trainings"
http://chng.it/K5NyHqD4XD

Montse and Mayte also host a bi-weekly workshop about cultural appropriation of the Rebozo titled "What You Didn't Know About the Rebozo". Any information regarding the workshop can be found on Montse's Linktree: https://linktr.ee/montsedoula

You can follow Montse and Mayte on Instagram here:
Montse Olmos @mujer_dela_tierra
Mayte Acolt @maytethewombdoula]]>https://api.spreaker.com/episode/44429643Thu, 22 Apr 2021 00:44:56 +0000PBB Media IncorporatedIn March 2021 Totonaca Indigenous birth companions Montse Olmos and Mayte Acolt started a petition titled 'Removing Rebozo Teachings From Doula Trainings'. It was a call to the international birth community and large training organisations, to stop...
In this conversation Montse and Mayte generously share on the cultural use, meaning and place of the Rebozo in their Indigenous communities and in traditional midwifery practices in Mexico, and how this knowledge is traditionally passed down. They share why they started this petition, and why proper training with Indigenous birthworkers is necessary for the Rebozo to be used safely and with respect, acknowledging it as an intervention. They also speak to being in relationship with the communities we learn from, the importance of accountability, how birth work and anti racism work go hand in hand, and give us points for necessary pause and reflection.

Montse Olmos and Mayte Acolt are Totonaca Indigenous birth companions and migrants in the United States. Mayte is a traditional Sobadora since age seven, taught by her grandmother. Montse was raised by her family elders who practiced herbal medicine, Sobadas and energetic healing. They host "What You Didn't Know About the Rebozo" together and share about the history of the Rebozo from an Indigenous perspective, while connecting it to the work of anti-racism, Indigenous liberation and becoming an accomplice to historically oppressed communities. Mayte and Montse began a movement in March 2021 to remove Rebozo birth techniques from Doula Training Organization in the U.S., as a result of the excessive and inappropriate use of this sacred textile amongst Doulas and Midwives. They conduct this work with genuine concern for the commercialization and dilution of the Rebozo and propose that extensive mentorship and hands-on learning from expert Elders is necessary in order to practice Rebozo body-work in an ethical way.

Link to the petition titled "Removing Rebozo Teachings from Doula Trainings"
http://chng.it/K5NyHqD4XD

Montse and Mayte also host a bi-weekly workshop about cultural appropriation of the Rebozo titled "What You Didn't Know About the Rebozo". Any information regarding the workshop can be found on Montse's Linktree: https://linktr.ee/montsedoula

You can follow Montse and Mayte on Instagram here:
Montse Olmos @mujer_dela_tierra
Mayte Acolt @maytethewombdoula]]>6564antiracism,birth,culturalappropriation,doula,indigenous,midwifery,patera,pregnancy,rebozo,sobadora,therebozo,traditionalmidwiferyfalsefullOptimising Menstrual Health and Fertility; an Ayurvedic Perspectivehttps://www.spreaker.com/episode/optimising-menstrual-health-and-fertility-an-ayurvedic-perspective--44212430
Dylan Smith is a certified Ayurvedic Practitioner and holistic health educator based in Sydney, Australia, where he runs and operates the Vital Veda clinic for patients and for those who love to nourish themselves with precious herbal elixirs.
Aimed at uncovering the root cause of ailments, Dylan shares wisdom through podcasts, teaching programs and travels the world to teach patients to effortlessly integrate foundational techniques into their daily life so they can thrive.
Regularly travelling to India to train with an internationally renowned family of Ayurvedic doctors, Dylan is devoted to learning, sharing and radiating this ancient knowledge for everyone to utilise and enjoy, to experience total wellness and bliss. Dylan has a passion for treating, a Passion for Education, and a for Herbs and Nature.

Staying and learning from his Guru (teacher) in India for 6 month periods started a beautiful and purposeful learning teaching relationship. revolutionised Dylan’s Ayurvedic practice and increased the effectiveness and success rates of his treatments and prescriptions profoundly.
Since then until today, Dylan continues to travel back and forth to the Raju Clinic in India to work and receive advanced teachings and initiations.

In this conversation, Oni chats to Dylan about health pertaining to the menstrual, pre conception, pregnancy, birth, and postpartum health. We also speak more broadly about Ayurvedic wisdom through the nature of the doshas and the masculine and feminine and how finding balance can positively effect partnership and parenthood. At the end, Dylan lists some of his generous free resources for these periods of life. Enjoy this conversation ! And please leave reviews and feedback to help us produce more of what you need !]]>https://api.spreaker.com/episode/44212430Tue, 06 Apr 2021 02:45:24 +0000PBB Media IncorporatedIn this conversation, Oni Blecher speaks with Dylan Smith. Dylan Smith is a certified Ayurvedic Practitioner and holistic health educator based in Sydney, Australia, where he runs and operates the Vital Veda clinic for patients and for those who...
Dylan Smith is a certified Ayurvedic Practitioner and holistic health educator based in Sydney, Australia, where he runs and operates the Vital Veda clinic for patients and for those who love to nourish themselves with precious herbal elixirs.
Aimed at uncovering the root cause of ailments, Dylan shares wisdom through podcasts, teaching programs and travels the world to teach patients to effortlessly integrate foundational techniques into their daily life so they can thrive.
Regularly travelling to India to train with an internationally renowned family of Ayurvedic doctors, Dylan is devoted to learning, sharing and radiating this ancient knowledge for everyone to utilise and enjoy, to experience total wellness and bliss. Dylan has a passion for treating, a Passion for Education, and a for Herbs and Nature.

Staying and learning from his Guru (teacher) in India for 6 month periods started a beautiful and purposeful learning teaching relationship. revolutionised Dylan’s Ayurvedic practice and increased the effectiveness and success rates of his treatments and prescriptions profoundly.
Since then until today, Dylan continues to travel back and forth to the Raju Clinic in India to work and receive advanced teachings and initiations.

In this conversation, Oni chats to Dylan about health pertaining to the menstrual, pre conception, pregnancy, birth, and postpartum health. We also speak more broadly about Ayurvedic wisdom through the nature of the doshas and the masculine and feminine and how finding balance can positively effect partnership and parenthood. At the end, Dylan lists some of his generous free resources for these periods of life. Enjoy this conversation ! And please leave reviews and feedback to help us produce more of what you need !]]>3129ayurveda,birth,fatherhood,love,maternitycare,maternityhealth,motherhood,parenthood,postnatal,postpartum,pregnancyfalsefullPBB Bulletin - Improving Maternity Care in Australia with Alecia Staineshttps://www.spreaker.com/episode/pbb-bulletin-improving-maternity-care-in-australia-with-alecia-staines--44110383
If you are tuning in from Australia, this is an important message to women, people, families and community members accessing maternity healthcare services. A federal election is coming up and your voice is needed in improving maternity care!

Welcome to Pregnancy, Birth and Beyond, I’m Annalee Atia with a special News Bulletin for Australians listeners today, Tuesday 30th March. I’m speaking with Alecia Staines, Director of one of our largest maternity consumer advocacy organisations - Maternity Consumer Network, she is also the host and creator of the podcast ‘Birth - the forgotten Feminist Issue’ (check it out, its excellent), a Hypnobirthing teacher and mother of five.

We caught up last night after one of Alecia’s classes to discuss our upcoming Federal elections in Australia and how we can use the opportunities federal elections bring about to improve maternity health care services. Some of you might know that I am also the National President of Maternity Choices Australia, our longest standing maternity advocacy organisation and this is the first time I have had the pleasure of interviewing Alecia, after many years of crossing paths through our work.

Join us for a fast-paced and illuminating discussion on how you can participate in improving maternity healthcare services in your area, and why its so important that you do! Share this interview with friends and family, write to your local MP and keep us posted about your progress! All the details are in the show notes following.

WHAT YOU CAN DO TO IMPROVE MATERNITY SERVICES:
Get in touch with your local federal MP and candidates and let them know that maternity care matters to you!

HOW TO DO IT:
Look up the Federal PM for your electorate (your town/where you live is located within a specific electorate). You will also want to look up the candidates for this seat for the three major parties. Email them with your personal note and attach the Brief (see below) if applicable. You can request a meeting with them to ensure they understand just how important these issues are. In your email and within the brief, add your name, contact number and postal address (this will ensure a reply). Follow up with a phone call to your MP.

->> Keep up posted about your progress! Email hello@pbbmedia.org or management@maternitychoices.org.au you can also let us know via socials! Use the hashtag #BetterMaternity2021 and we will find you on FB, IG, Twitter etc!

WHO CAN DO IT?
Anyone who cares about our Australian maternity healthcare services, especially health consumers (people who access healthcare services) and support people.

THE BRIEF / AKA what to ask your elected federal MP's and candidates to commit to this coming election (you can also find this online at www.maternotyconsumernetwork.org.au under campaigns):

Background:
Current maternity spending by government is about $7 billion per year. The current birth rate is around 300,000 births per year.

Outcomes:
Despite having such high financial input, outcomes are relatively poor:
* 1/3 women have birth trauma. 2/3 of this is due to disrespectful treatment
* Only 8% of women can access continuity of midwifery carer- the best type of maternity care
* Caesarean rate 36% - more than double the recommended rate by WHO
* 43% of low risk women having their labour induced. Many are reporting not having informed consent.
* 11-fold variance in 3rd/4th degree tears
* Preterm birth rate of aboriginal babies is between 2 and 7 times that of non-indigenous babies.

Solutions (what to ask your MP to lobby for)
1. Increase continuity of midwifery carer to:
-Reduce unnecessary intervention
-reduce preterm birth rate for Aboriginal women and babies
-increase breastfeeding rates
-reduce birth trauma and PNDA
This is outlined in the 2019 National Strategy for Australian Maternity Services. The Federal Government provides continuity of midwifery carer to women via private midwives.
2. Bundled Funding as suggested by IHPA in 2017, national strategy in 2019 and MBS review of Participating Midwives report in 2019
3. Published data on hospital and clinician outcomes including: Patient Reported Experience Measure and Patient Reported Outcome Measures.

Woman Centred Care:
To ensure regular monitoring and evaluation of the National Strategy for Australian Maternity Services, consumers need to be involved through consultation and decision-making processes.

Contact: Add your personal details here!

For more information about this brief and if you need any support with the process, you can get in touch with Alecia directly:

Alecia Staines, Director Maternity Consumer Network
Phone/text: 0401033348
Email: management@maternityconsumernetwork.org.au

Show Links:

Maternity Consumer Network -
https://www.maternityconsumernetwork.org.au/us

Podcast: Birth - The Forgotten Feminist Issue with Alecia Staines
https://open.spotify.com/show/6bHPMCtZ7B3GhafyYotbL0?si=N_iPY5LUSTinTIK_l3Dmhw

Continuity of Midwifery Carer:
https://www.midwives.org.au/midwifery-continuity-care

Woman-Centred Care - the new Australian Strategic Directions for Maternity Care (yet to be fully implemented and requires constant nudging to move forward in each state):
https://www.health.gov.au/resources/publications/woman-centred-care-strategic-directions-for-australian-maternity-services

Precolonial history of Gadigal people: https://www.centennialparklands.com.au/getmedia/e32ae90a-e730-4c28-82c4-4b17e9e3c5e1/Appendix_S_-_Pre-colonial_Archaeology_report_Val_Attenbrow.pdf.aspx

This podcast was recorded on Gadigal clan lands, an area encompassing the Centennial, Queen’s and Moore Parklands. I pay my respects to elders past, present and those emerging and deeply acknowledge the traditional custodians of this land whose cultures and customs have nurtured and continue to nurture this land and waters for over 60,000 years and upon which we now work and live. I recognise that the sovereignty of the pre-colonial peoples of these lands was never ceded and that recognition of culture, connection to land and waters and the sovereignty of all indigenous peoples across Australia is a matter of current and vital importance.

Recorded on 29th March, 2021

Guest: Alecia Staines
Alecia is a mother-of-5, maternity reform lobbyist, Director of Maternity Consumer Network, former classroom teacher turned birth nerd and lives in Noosa, Queensland. She's received all her maternity care through continuity of midwifery carer in a range of settings- hospital, birth centre and home. She passionate about politics, birth and feminism and ensure women have access to care that supports their needs, allows them to make informed decisions and autonomy in how and where they birth.

>> hashtag #BetterMaternity2021

Produced and presented by Annalee Atia

All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/44110383Tue, 30 Mar 2021 05:58:50 +0000PBB Media IncorporatedPBB Special Bulletin/Interview with Alecia Staines, Director of Maternity Consumer Network If you are tuning in from Australia, this is an important message to women, people, families and community members accessing maternity healthcare services. A...
If you are tuning in from Australia, this is an important message to women, people, families and community members accessing maternity healthcare services. A federal election is coming up and your voice is needed in improving maternity care!

Welcome to Pregnancy, Birth and Beyond, I’m Annalee Atia with a special News Bulletin for Australians listeners today, Tuesday 30th March. I’m speaking with Alecia Staines, Director of one of our largest maternity consumer advocacy organisations - Maternity Consumer Network, she is also the host and creator of the podcast ‘Birth - the forgotten Feminist Issue’ (check it out, its excellent), a Hypnobirthing teacher and mother of five.

We caught up last night after one of Alecia’s classes to discuss our upcoming Federal elections in Australia and how we can use the opportunities federal elections bring about to improve maternity health care services. Some of you might know that I am also the National President of Maternity Choices Australia, our longest standing maternity advocacy organisation and this is the first time I have had the pleasure of interviewing Alecia, after many years of crossing paths through our work.

Join us for a fast-paced and illuminating discussion on how you can participate in improving maternity healthcare services in your area, and why its so important that you do! Share this interview with friends and family, write to your local MP and keep us posted about your progress! All the details are in the show notes following.

WHAT YOU CAN DO TO IMPROVE MATERNITY SERVICES:
Get in touch with your local federal MP and candidates and let them know that maternity care matters to you!

HOW TO DO IT:
Look up the Federal PM for your electorate (your town/where you live is located within a specific electorate). You will also want to look up the candidates for this seat for the three major parties. Email them with your personal note and attach the Brief (see below) if applicable. You can request a meeting with them to ensure they understand just how important these issues are. In your email and within the brief, add your name, contact number and postal address (this will ensure a reply). Follow up with a phone call to your MP.

->> Keep up posted about your progress! Email hello@pbbmedia.org or management@maternitychoices.org.au you can also let us know via socials! Use the hashtag #BetterMaternity2021 and we will find you on FB, IG, Twitter etc!

WHO CAN DO IT?
Anyone who cares about our Australian maternity healthcare services, especially health consumers (people who access healthcare services) and support people.

THE BRIEF / AKA what to ask your elected federal MP's and candidates to commit to this coming election (you can also find this online at www.maternotyconsumernetwork.org.au under campaigns):

Background:
Current maternity spending by government is about $7 billion per year. The current birth rate is around 300,000 births per year.

Outcomes:
Despite having such high financial input, outcomes are relatively poor:
* 1/3 women have birth trauma. 2/3 of this is due to disrespectful treatment
* Only 8% of women can access continuity of midwifery carer- the best type of maternity care
* Caesarean rate 36% - more than double the recommended rate by WHO
* 43% of low risk women having their labour induced. Many are reporting not having informed consent.
* 11-fold variance in 3rd/4th degree tears
* Preterm birth rate of aboriginal babies is between 2 and 7 times that of non-indigenous babies.

Solutions (what to ask your MP...]]>1534auspol,auspol2021,australianhealthcare,bettermaternity2021,childbirth,costofhealthcare,federalelections,maternitycare,maternitychoicesaustralia,maternityconsumernetwork,parenting,pbbmedia,podcast,postpartum,pregnancy,womenandbabies,womenshealthfalsefullBeyond the Birth Plan: Getting Real About Pain and Powerhttps://www.spreaker.com/episode/beyond-the-birth-plan-getting-real-about-pain-and-power--43928194
Rhea runs birth preparation workshops, pre-natal classes, personal birth counselling sessions and speaks in presentations and seminars around Australia and internationally

Rhea’s passion is to educate women about the impact of our birth culture on the outcome of our births. Instead of fear, she wants birthing women and birthing people to go into their labour with confidence in their body and their support people, and the knowledge that will give them the best possibility of natural physiological birth.

Rhea has written two books ! Her first, the popular ‘Birth With Confidence: Savvy choices for normal birth’ and now her recently released second book ‘Beyond the Birth Plan: getting real about pain and power’. I consider both of these books must reads for any person interested in birth, whether that be birth attendants, midwives, pregnant women or people, birthing partners, fathers, parents, or anyone curious to understand the impact on the intersection between our social attitudes and birth.

This is a longer form interview but anyone that knows Rhea’s legacy in the national and international birth world knows that any time hearing Rhea’s insights and wisdom is valuable and necessary. Feel free to listen in segments. At the end of the podcast, Rhea takes us through the chapter structure of her new book and outlines some of the content and what to expect. Enjoy this conversation and please leave your reviews and feedback.]]>https://api.spreaker.com/episode/43928194Wed, 17 Mar 2021 04:37:04 +0000PBB Media IncorporatedIn this podcast episode, Oni Blecher speaks to Rhea Dempsey about her recent book launch of 'Beyond the Birth Plan, Getting Real About Pain and Power'. Rhea Demspsey is a childbirth educator, counsellor, doula trainer, and birth attendant, having...
Rhea runs birth preparation workshops, pre-natal classes, personal birth counselling sessions and speaks in presentations and seminars around Australia and internationally

Rhea’s passion is to educate women about the impact of our birth culture on the outcome of our births. Instead of fear, she wants birthing women and birthing people to go into their labour with confidence in their body and their support people, and the knowledge that will give them the best possibility of natural physiological birth.

Rhea has written two books ! Her first, the popular ‘Birth With Confidence: Savvy choices for normal birth’ and now her recently released second book ‘Beyond the Birth Plan: getting real about pain and power’. I consider both of these books must reads for any person interested in birth, whether that be birth attendants, midwives, pregnant women or people, birthing partners, fathers, parents, or anyone curious to understand the impact on the intersection between our social attitudes and birth.

This is a longer form interview but anyone that knows Rhea’s legacy in the national and international birth world knows that any time hearing Rhea’s insights and wisdom is valuable and necessary. Feel free to listen in segments. At the end of the podcast, Rhea takes us through the chapter structure of her new book and outlines some of the content and what to expect. Enjoy this conversation and please leave your reviews and feedback.]]>5696birth,birthing,books,childbirth,fatherhood,health,love,maternity,motherhood,parenthood,postnatal,postpartum,pregnancyfalsefullThe Subtle Realms of Birth and Babies with Craniosacral teacher Etienne Perismanhttps://www.spreaker.com/episode/the-subtle-realms-of-birth-and-babies-with-craniosacral-teacher-etienne-perisman--43680186
As a meditator of over 40 years, Etienne Peirsman has developed a unique teaching style that adds an extraordinarily compassionate and meditative depth to the methods used by the Upledger Institute and combines a practical, no-nonsense approach with the biodynamic style. Etienne has been teaching for nearly thirty years, bringing his life experience to the classroom. He has schools in Belgium, the Netherlands, New Mexico, Washington, and Hong Kong. Additionally, he guest teaches wherever there is interest. He, along with his late wife Neeto, is author of the book Craniosacral Therapy for Babies and Small Children, which has been translated into 7 languages.

Etienne's specialty is the expression of the Heart, the long tide, and their connection to meditation and enlightenment. Etienne says, “Drop the word therapy. It is not part of who and what we are. Face it, you are perfect and your heart is perfect”. Enjoy this conversation !]]>https://api.spreaker.com/episode/43680186Mon, 01 Mar 2021 03:28:22 +0000PBB Media IncorporatedIn this episode, Oni Blecher speaks with Etienne Peirsman. Etienne is a biology and physical education teacher who has been involved with emotional training, encounter work, primal healing and meditation since 1974. He began teaching craniosacral in...
As a meditator of over 40 years, Etienne Peirsman has developed a unique teaching style that adds an extraordinarily compassionate and meditative depth to the methods used by the Upledger Institute and combines a practical, no-nonsense approach with the biodynamic style. Etienne has been teaching for nearly thirty years, bringing his life experience to the classroom. He has schools in Belgium, the Netherlands, New Mexico, Washington, and Hong Kong. Additionally, he guest teaches wherever there is interest. He, along with his late wife Neeto, is author of the book Craniosacral Therapy for Babies and Small Children, which has been translated into 7 languages.

Etienne's specialty is the expression of the Heart, the long tide, and their connection to meditation and enlightenment. Etienne says, “Drop the word therapy. It is not part of who and what we are. Face it, you are perfect and your heart is perfect”. Enjoy this conversation !]]>4534babies,birth,children,craniosacral,fatherhood,health,lotusbirth,love,maternity,maternityhealth,mother,motherhood,newborn,osteopath,osteopathy,parenthood,parenting,postnatal,postpartum,pregnancyfalsefullNappy Free with Nicole Moorehttps://www.spreaker.com/episode/nappy-free-with-nicole-moore--43453828
Recorded by Sally Cusack in March 2019.
Presented by Kirilly Dawn at 99.9 BayFM Byron Bay on 24 June 2019.
Guest: Nicole Moore

https://www.nappyfree.com.au/

Copyright 2021 PBB Media
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/43453828Sun, 14 Feb 2021 03:07:00 +0000PBB Media IncorporatedNicole Moore, founder of Nappy Free and Birth Into Being Australia, speaks about her passion for nappy free or elimination communication for babies. Recorded by Sally Cusack in March 2019. Presented by Kirilly Dawn at 99.9 BayFM Byron Bay on 24 June...
Recorded by Sally Cusack in March 2019.
Presented by Kirilly Dawn at 99.9 BayFM Byron Bay on 24 June 2019.
Guest: Nicole Moore

https://www.nappyfree.com.au/

Copyright 2021 PBB Media
All rights reserved.

www.pbbmedia.org]]>1670eliminationcommunication,environment,motherhood,nappyfree,parenting,postnatalfalsefullOur Kids Belong With Family with Rärriwuy Hickhttps://www.spreaker.com/episode/our-kids-belong-with-family-with-rarriwuy-hick--43395043
In this episode we speak of themes of child removal, the Stolen Generation, the NT Intervention, abuse and violence by the colonial state. Please listen with care, as these topics and parts of the conversation may be distressing.

We want to acknowledge and pay our respects to the people of the Stolen Generation, to Aboriginal and Torres Strait Islander peoples who have themselves, their ancestors, and their Country, been affected by the Stolen Generation, and to those who are being impacted today by forced child removals by the state. We hope this story offers some healing to you, to know that you aren't alone and that the episode may offer some tips from Rärriwuy as you continue to fight the system - a fight we wish you did not have to endure.

Our Kids Belong With Family is a four year global campaign that aims to raise awareness on the international human rights abuse of Indigenous Children and their families navigating the trauma of child removal by the Australian nation state.

In this powerful and intimate conversation, Rärriwuy shares her story of the heartache, trauma and triumph in her journey to get her kids back. We ask that you listen with respect to her and her family and their privacy. Rärriwuy has also written about the campaign and her journey to create change and accountability for the Australia nation state which has historically and systematically forcibly removed Indigenous children since colonisation began.
https://meanjin.com.au/blog/our-kids-belong-with-family/

You can support Our Kids Belong With Family by posting an image of yourself to social media, holding a piece of paper with "#OurKidsBelongWithFamily" and please use the hashtag and tag the instagram account @ourkidsbelongwithfamily on the 13th of Feb.

You can also donate to the new Go Fund Me campaign for Our Kids Belong With Family, which is raising money to help those families and children who have suffered from being forcibly removed to heal.
https://www.gofundme.com/f/rarriwuy-hick-our-kids-belong-with-family

RESOURCES AND INFORMATION
For those wanting to learn more about the Stolen Generation, and the Australian Government's policies and history of state enforced child removal, please visit:
https://humanrights.gov.au/our-work/education/track-history-timeline-stolen-generations

Grandmother's Against Removal:
https://www.facebook.com/GMAR.GrandmothersAgainstRemovals/
https://aftertheapology.com/ - important film to watch

ID Know Yourself: Mentoring and support for children who have experienced out of home care
https://idknowyourself.com/]]>https://api.spreaker.com/episode/43395043Thu, 11 Feb 2021 05:12:57 +0000PBB Media IncorporatedIn this episode, Kirilly speaks with Rärriwuy Hick, Yolngu woman, actress, artist, storyteller and the founder of Our Kids Belong With Family - a campaign which she started on 13th February 2017, after her nephews were forcibly removed by Territory...
In this episode we speak of themes of child removal, the Stolen Generation, the NT Intervention, abuse and violence by the colonial state. Please listen with care, as these topics and parts of the conversation may be distressing.

We want to acknowledge and pay our respects to the people of the Stolen Generation, to Aboriginal and Torres Strait Islander peoples who have themselves, their ancestors, and their Country, been affected by the Stolen Generation, and to those who are being impacted today by forced child removals by the state. We hope this story offers some healing to you, to know that you aren't alone and that the episode may offer some tips from Rärriwuy as you continue to fight the system - a fight we wish you did not have to endure.

Our Kids Belong With Family is a four year global campaign that aims to raise awareness on the international human rights abuse of Indigenous Children and their families navigating the trauma of child removal by the Australian nation state.

In this powerful and intimate conversation, Rärriwuy shares her story of the heartache, trauma and triumph in her journey to get her kids back. We ask that you listen with respect to her and her family and their privacy. Rärriwuy has also written about the campaign and her journey to create change and accountability for the Australia nation state which has historically and systematically forcibly removed Indigenous children since colonisation began.
https://meanjin.com.au/blog/our-kids-belong-with-family/

You can support Our Kids Belong With Family by posting an image of yourself to social media, holding a piece of paper with "#OurKidsBelongWithFamily" and please use the hashtag and tag the instagram account @ourkidsbelongwithfamily on the 13th of Feb.

You can also donate to the new Go Fund Me campaign for Our Kids Belong With Family, which is raising money to help those families and children who have suffered from being forcibly removed to heal.
https://www.gofundme.com/f/rarriwuy-hick-our-kids-belong-with-family

RESOURCES AND INFORMATION
For those wanting to learn more about the Stolen Generation, and the Australian Government's policies and history of state enforced child removal, please visit:
https://humanrights.gov.au/our-work/education/track-history-timeline-stolen-generations

Grandmother's Against Removal:
https://www.facebook.com/GMAR.GrandmothersAgainstRemovals/
https://aftertheapology.com/ - important film to watch

ID Know Yourself: Mentoring and support for children who have experienced out of home care
https://idknowyourself.com/]]>3866aboriginal,australia,children,family,indigenous,ourkidsbelongwithfamily,stolengenerationfalsefullThe Art of Listening to your Body with Jin Onghttps://www.spreaker.com/episode/the-art-of-listening-to-your-body-with-jin-ong--43279407Psychosomatic awareness is based from the theory that your stored emotions may result in adverse physical and psychological outcomes. With an ever broadening awareness around trauma resulting in physical outcomes or the memory of trauma being encoded in the viscera such as elaborated upon in Bessel Van Der Kolk’s book ‘The Body Keeps The Score’. Jin’s work focusses upon the link between the emotional and the physical and in this interview, we look at how that link can effect our way of looking at our body’s functionality, particularly in the pre conception, conception, pregnancy, birth, and postpartum stages of life.

On the About page of Jin’s website; theartoflisteningtoyourbody.com, there is a short interview with Jin introducing herself and the work that she does. To receive a direct introduction from her, I recommend having a listen.

A part of mine and Jin’s conversation covers infant loss, abortion and miscarriage. If these topics are sensitive or triggering for you or those around you, please listen with care.

Enjoy this conversation !  ]]>https://api.spreaker.com/episode/43279407Thu, 04 Feb 2021 06:30:05 +0000PBB Media IncorporatedIn this interview, Oni Blecher speaks with Jin Ong. Jin Ong is an Osteopath, Psychosomatic Therapist, Personal & Practitioner Coach. Jin lives and works with her partner and children in the beautiful lakeside town of Wanaka, New Zealand. In the recent...Psychosomatic awareness is based from the theory that your stored emotions may result in adverse physical and psychological outcomes. With an ever broadening awareness around trauma resulting in physical outcomes or the memory of trauma being encoded in the viscera such as elaborated upon in Bessel Van Der Kolk’s book ‘The Body Keeps The Score’. Jin’s work focusses upon the link between the emotional and the physical and in this interview, we look at how that link can effect our way of looking at our body’s functionality, particularly in the pre conception, conception, pregnancy, birth, and postpartum stages of life.

On the About page of Jin’s website; theartoflisteningtoyourbody.com, there is a short interview with Jin introducing herself and the work that she does. To receive a direct introduction from her, I recommend having a listen.

A part of mine and Jin’s conversation covers infant loss, abortion and miscarriage. If these topics are sensitive or triggering for you or those around you, please listen with care.

Enjoy this conversation !  ]]>4335birth,body,community,family,fatherhood,health,listening,love,maternity,maternitycare,maternityhealth,motherhood,parenthood,postnatal,postpartum,pregnancy,psychosomaticfalsefullBirth Sovereignty Panelhttps://www.spreaker.com/episode/birth-sovereignty-panel--43107005This episode is a recording of a live panel on 'Birth Sovereignty' by PBB and hosted at the Returning on Bundjalung Country in November 2020. PBB presenter, Barkindji woman Kirilly Dawn, speaks with four incredible birth keepers, mothers and change makers: Bronwyn Bancroft, Angela Coe, Mei Lai Swan and Aimee Aroha, who explore birth sovereignty, the context of modern birth culture through a decolonial lense, and share their stories , experiences and their visions for change.

Panel members include:
Bronwyn Bancroft, Bundjalung elder, artist, mother and sovereign birth advocate;
Angela Coe, Wiradjuri midwife and founder of @birthingourway
Mei Lai Swan, co-founder of Birth for Humankind and Yoga for Humankind
and Aimee Aroha, Maori Australian birth keeper and transpersonal therapist. Each of these women share their knowledge and perspective on what decolonising the dominant birth culture and maternity care system looks & feels like, and offer their vision for change.

This panel was recorded at The Returning, and Aboriginal owned and run not for profit wellbeing event that occurs twice a year on Bundjalung Country. Over 75% of tickets for this event are exchange or scholarship, for Indigenous women, single mothers, refugees and women in need, with the ethos that no woman is left behind, opening up cultural and healing spaces for all in the community. To learn more visit www.thereturningthegathering.com

The songs of kookaburras, cicadas, other winged ones and bubs and children can be heard in this episode as they added to the soundscape of the event on the day (and contributed to the panel in their own way).

To connect with panel members:
Bronwyn Bancroft, Bundjalung artist and elder: www.bronwynbancroft.com
Angela Coe, Wiradjuri Midwife: @birthingourway on Instagram
Mei Lai Swan, co-founder of Birth for Humankind: www.birthforhumankind.org
Aimee Aroha, birthkeeper and transpersonal therapist: www.www.thestonedchrysalis.com or @ripsnorter on instagram

Organisations mentioned in this episode are:
Waminda South Coast:
Birthing on Country - Best start to life — Wamindahttp://www.waminda.org.au and their Go Fund Me: https://au.gofundme.com/f/birthing-on-country

Sisters Inside: https://www.sistersinside.com.au
And their Go Fund Me: https://au.gofundme.com/f/bfvnvt-freethepeople]]>https://api.spreaker.com/episode/43107005Mon, 25 Jan 2021 19:00:17 +0000PBB Media IncorporatedWhat does birth sovereignty, and decolonising the maternity care system, look and feel like? How does the current patriarchal birth culture impact First Nations women and marginalised communities? How can we re-imagine a birth culture that centres and...This episode is a recording of a live panel on 'Birth Sovereignty' by PBB and hosted at the Returning on Bundjalung Country in November 2020. PBB presenter, Barkindji woman Kirilly Dawn, speaks with four incredible birth keepers, mothers and change makers: Bronwyn Bancroft, Angela Coe, Mei Lai Swan and Aimee Aroha, who explore birth sovereignty, the context of modern birth culture through a decolonial lense, and share their stories , experiences and their visions for change.

Panel members include:
Bronwyn Bancroft, Bundjalung elder, artist, mother and sovereign birth advocate;
Angela Coe, Wiradjuri midwife and founder of @birthingourway
Mei Lai Swan, co-founder of Birth for Humankind and Yoga for Humankind
and Aimee Aroha, Maori Australian birth keeper and transpersonal therapist. Each of these women share their knowledge and perspective on what decolonising the dominant birth culture and maternity care system looks & feels like, and offer their vision for change.

This panel was recorded at The Returning, and Aboriginal owned and run not for profit wellbeing event that occurs twice a year on Bundjalung Country. Over 75% of tickets for this event are exchange or scholarship, for Indigenous women, single mothers, refugees and women in need, with the ethos that no woman is left behind, opening up cultural and healing spaces for all in the community. To learn more visit www.thereturningthegathering.com

The songs of kookaburras, cicadas, other winged ones and bubs and children can be heard in this episode as they added to the soundscape of the event on the day (and contributed to the panel in their own way).

To connect with panel members:
Bronwyn Bancroft, Bundjalung artist and elder: www.bronwynbancroft.com
Angela Coe, Wiradjuri Midwife: @birthingourway on Instagram
Mei Lai Swan, co-founder of Birth for Humankind: www.birthforhumankind.org
Aimee Aroha, birthkeeper and transpersonal therapist: www.www.thestonedchrysalis.com or @ripsnorter on instagram

Organisations mentioned in this episode are:
Waminda South Coast:
Birthing on Country - Best start to life — Wamindahttp://www.waminda.org.au and their Go Fund Me: https://au.gofundme.com/f/birthing-on-country

Sisters Inside: https://www.sistersinside.com.au
And their Go Fund Me: https://au.gofundme.com/f/bfvnvt-freethepeople]]>3425aboriginal,birth,decolonise,decolonize,indigenous,sovereigntyfalsefullReducing the C-section Rate, Equitable and Safe Maternity Care with Dr Neel Shahhttps://www.spreaker.com/episode/reducing-the-c-section-rate-equitable-and-safe-maternity-care-with-dr-neel-shah--42992509
A cesarean section, or c-section is the most performed major surgery on the planet, it is also the most controversial. In the many years since they have been introduced, mortality and morbidity rates - the rates which this intervention has been introduced to lower, have increased and women are more likely to die in childbirth in this generation, than their mothers.

Today on the show we bring you the insights and experience of Dr Neel Shah, Assistant Professor of Obstetrics, Gynaecology and Reproductive Biology at Harvard Medical School. Listed among the “40 smartest people in health care” Dr Shah has written more than 50 peer-reviewed academic papers and contributed to four books, including as senior author of Understanding Value-Based Healthcare (McGraw-Hill).

We talk equity and safety in maternity healthcare and reducing the C-section rate. Some alarming stats alongside lots of hope are in the pot today, grab your notebook and writing apparatus and enjoy the powerful slow cooked gen.

“.. that means, in 2021, the biggest risk factor for a mother anywhere in the world to get a c-section, is not her personal risks or her personal preferences but which hospital she goes to”

“The wellbeing of mothers is the bellwether for the wellbeing of all of us”
“If mothers are unwell, society is unwell”. - Dr Neel Shah

Dr. Neel Shah, MD, MPP, FACOG, is an Assistant Professor of Obstetrics, Gynaecology and Reproductive Biology at Harvard Medical School, and Director of the Delivery Decisions Initiative at Harvard’s Ariadne Labs. As an obstetrician-gynaecologist at Beth Israel Deaconess Medical Center in Boston, Dr. Shah cares for patients at critical life moments that range from childbirth to primary care to surgery. As a scientist and social entrepreneur, he is a globally recognised expert in designing solutions that improve health care.
Dr. Shah is also founder of Costs of Care, an NGO that curates insights from clinicians and patients to help delivery systems provide better care. In 2017, he co-founded the March for Moms Association, a coalition of more than 20 leading organisations, to increase public and private investment in the wellbeing of mothers. Dr. Shah currently serves on national advisory boards of the Planned Parenthood Federation of America and the Office of Women’s Health Research at the National Institutes of Health.

Show links:

Find more about Dr Shah here: https://scholar.harvard.edu/shah/home & https://www.hsph.harvard.edu/neel-shah/

Harvard's Ariadne Labs: https://www.ariadnelabs.org/about-us/

March for Mums: https://marchformoms.org

Expecting More: https://www.expectingmore.org

We'd love to hear from you, if you have any questions/comments about this, other interviews or our work at PBB Media, shoot us a line at hello@pbbmedia.org.

Guest: Dr Neel Shah

Produced, edited and presented by Annalee Atia

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.]]>https://api.spreaker.com/episode/42992509Mon, 18 Jan 2021 17:00:03 +0000PBB Media Incorporated“If your c-section is high that means that you’re not supporting people in labour, that’s just a fact.” - Dr Neel Shah A cesarean section, or c-section is the most performed major surgery on the planet, it is also the most controversial. In the...
A cesarean section, or c-section is the most performed major surgery on the planet, it is also the most controversial. In the many years since they have been introduced, mortality and morbidity rates - the rates which this intervention has been introduced to lower, have increased and women are more likely to die in childbirth in this generation, than their mothers.

Today on the show we bring you the insights and experience of Dr Neel Shah, Assistant Professor of Obstetrics, Gynaecology and Reproductive Biology at Harvard Medical School. Listed among the “40 smartest people in health care” Dr Shah has written more than 50 peer-reviewed academic papers and contributed to four books, including as senior author of Understanding Value-Based Healthcare (McGraw-Hill).

We talk equity and safety in maternity healthcare and reducing the C-section rate. Some alarming stats alongside lots of hope are in the pot today, grab your notebook and writing apparatus and enjoy the powerful slow cooked gen.

“.. that means, in 2021, the biggest risk factor for a mother anywhere in the world to get a c-section, is not her personal risks or her personal preferences but which hospital she goes to”

“The wellbeing of mothers is the bellwether for the wellbeing of all of us”
“If mothers are unwell, society is unwell”. - Dr Neel Shah

Dr. Neel Shah, MD, MPP, FACOG, is an Assistant Professor of Obstetrics, Gynaecology and Reproductive Biology at Harvard Medical School, and Director of the Delivery Decisions Initiative at Harvard’s Ariadne Labs. As an obstetrician-gynaecologist at Beth Israel Deaconess Medical Center in Boston, Dr. Shah cares for patients at critical life moments that range from childbirth to primary care to surgery. As a scientist and social entrepreneur, he is a globally recognised expert in designing solutions that improve health care.
Dr. Shah is also founder of Costs of Care, an NGO that curates insights from clinicians and patients to help delivery systems provide better care. In 2017, he co-founded the March for Moms Association, a coalition of more than 20 leading organisations, to increase public and private investment in the wellbeing of mothers. Dr. Shah currently serves on national advisory boards of the Planned Parenthood Federation of America and the Office of Women’s Health Research at the National Institutes of Health.

Show links:

Find more about Dr Shah here: https://scholar.harvard.edu/shah/home & https://www.hsph.harvard.edu/neel-shah/

Harvard's Ariadne Labs: https://www.ariadnelabs.org/about-us/

March for Mums: https://marchformoms.org

Expecting More: https://www.expectingmore.org

We'd love to hear from you, if you have any questions/comments about this, other interviews or our work at PBB Media, shoot us a line at hello@pbbmedia.org.

Guest: Dr Neel Shah

Produced, edited and presented by Annalee Atia

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country...]]>2833babies,birth,birthtrauma,cesarean,childbirth,csection,drneelshah,equityinhealthcare,maternalmentalhealth,maternitycare,mentalhealth,pbbmedia,postpartum,pregnancy,research,respectfulmaternitycare,socialdeterminantsofhealth,valuebasedcare,wellbeingfalsefullThe Birth Matrix with Craniosacral Teacher Hugh Milnehttps://www.spreaker.com/episode/the-birth-matrix-with-craniosacral-teacher-hugh-milne--42792359
This was a special interview for Oni Blecher as it was Hugh that introduced her to what some would call body work, and since 2012, she has completed all of her training with Milne through Milne Institute as well as assisting him and his teachers. Oni says; "The foundations of this visionary work always underpins my understanding of the human experience, as well as allowed me to deeply understand the psychospiritual and psychophysiological nature of birth and early life. Lucky enough to be able to work with pregnant and postpartum mothers, babies, and children, I understand the sometimes hard to explain value of this work and am very grateful to Hugh for coming on the show and explaining from his deep experiential well, what he sees this value as". Enjoy this conversation. If you have feedback or would like to leave a rating for our podcast, this is greatly appreciated and helps us understand your needs around our information sharing.]]>https://api.spreaker.com/episode/42792359Tue, 05 Jan 2021 02:19:08 +0000PBB Media IncorporatedIn this episode, Oni Blecher speaks with Hugh Milne. Hugh Milne is a third-generation Scottish osteopath and now craniosacral teacher and educator through his self-founded education body, ‘Milne Institute’. He spends most of professional time teaching...
This was a special interview for Oni Blecher as it was Hugh that introduced her to what some would call body work, and since 2012, she has completed all of her training with Milne through Milne Institute as well as assisting him and his teachers. Oni says; "The foundations of this visionary work always underpins my understanding of the human experience, as well as allowed me to deeply understand the psychospiritual and psychophysiological nature of birth and early life. Lucky enough to be able to work with pregnant and postpartum mothers, babies, and children, I understand the sometimes hard to explain value of this work and am very grateful to Hugh for coming on the show and explaining from his deep experiential well, what he sees this value as". Enjoy this conversation. If you have feedback or would like to leave a rating for our podcast, this is greatly appreciated and helps us understand your needs around our information sharing.]]>3365babies,birth,children,craniosacral,fatherhood,healthcare,infants,maternity,maternityhealth,motherhood,osteopathy,parenthood,parenting,postnatal,postpartum,pregnancyfalsefullMaternity advocacy and maternal wellbeing with Mother and Consumer Rep Helena Mooneyhttps://www.spreaker.com/episode/maternity-advocacy-and-maternal-wellbeing-with-mother-and-consumer-rep-helena-mooney--42491096
For this episode of the Pregnancy, Birth & Beyond show, Annalee caught up with the remarkable Helena Mooney, a Sydney resident and long-time maternity consumer advocate. They discuss what health advocacy looks like and the many challenges volunteers face in advocating for better and more meaningful maternity services.

From learning new terminology and jargon across several professional areas (such as research, government, health services, specific to maternity care, policy making, medico-legal, insurance etc etc) to finding your voice and calling out the many agendas that too often trump what the patient really needs in the moment to making sure that consumer engagement isn’t left within the bandwidth of tokenism as improvement in experience and outcome are only possible with meaningful engagement coupled with robust policies based in evidence based care and most importantly with effective accountability measures in place at every level.

Further information about Helena and her work is available at https://parentingwithplay.com.au

We'd love to hear from you, if you have any questions/comments about this or other interview or our work at PBB Media, shoot us a line at hello@pbbmedia.org.

Produced, edited and presented by Annalee Atia

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.]]>https://api.spreaker.com/episode/42491096Tue, 15 Dec 2020 01:47:53 +0000PBB Media IncorporatedAround the country and indeed around the world hustling and cajoling, therein the complex webs of healthcare and community lie dedicated individuals and organisations working tirelessly to improve services. There always have been and I suspect, there...
For this episode of the Pregnancy, Birth & Beyond show, Annalee caught up with the remarkable Helena Mooney, a Sydney resident and long-time maternity consumer advocate. They discuss what health advocacy looks like and the many challenges volunteers face in advocating for better and more meaningful maternity services.

From learning new terminology and jargon across several professional areas (such as research, government, health services, specific to maternity care, policy making, medico-legal, insurance etc etc) to finding your voice and calling out the many agendas that too often trump what the patient really needs in the moment to making sure that consumer engagement isn’t left within the bandwidth of tokenism as improvement in experience and outcome are only possible with meaningful engagement coupled with robust policies based in evidence based care and most importantly with effective accountability measures in place at every level.

Further information about Helena and her work is available at https://parentingwithplay.com.au

We'd love to hear from you, if you have any questions/comments about this or other interview or our work at PBB Media, shoot us a line at hello@pbbmedia.org.

Produced, edited and presented by Annalee Atia

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.]]>3289advocacy,auspol,babies,birth,childbirth,healthconsumerrepresentative,maternalmentalhealth,maternityconsumerrep,maternityhealthcare,mentalhealth,midwifery,motherhood,mothers,obstetrics,parenting,postpartum,pregnancyfalsefullEvolutionary Gynaecology: Tending to your root.https://www.spreaker.com/episode/evolutionary-gynaecology-tending-to-your-root--42459185Folks can work with Muse via distance consultations and her Sovereign Vagina Masterclass Series, a cannon of tangible tools for pelvic health, understanding gynecology as "gaiacology," and making gynecology an amazing medicine that is OURS.

You can find Muse through

muse@medicineofthefeminine.com
@medicineofthefeminine
www.medicineofthefeminine.com

Thanks for joining us ! I hope you liked this conversation. All feedback and ratings welcome and appreciated.]]>https://api.spreaker.com/episode/42459185Sun, 13 Dec 2020 17:00:16 +0000PBB Media IncorporatedIn this episode, Oni Blecher speaks to Muse Lokajickova. Muse practices revolutionary care for the generative systems also known as evolutionary gynaecology. Muse has 15 years of hands-on practice weaving tools from western herbalism, indigenous...Folks can work with Muse via distance consultations and her Sovereign Vagina Masterclass Series, a cannon of tangible tools for pelvic health, understanding gynecology as "gaiacology," and making gynecology an amazing medicine that is OURS.

You can find Muse through

muse@medicineofthefeminine.com
@medicineofthefeminine
www.medicineofthefeminine.com

Thanks for joining us ! I hope you liked this conversation. All feedback and ratings welcome and appreciated.]]>3962birth,family,father,fatherhood,gynaecology,health,love,mother,motherhood,parenting,pelvis,postnatal,postpartum,pregnancy,sexualhealthfalsefullThe Amazing True Story of How Babies Are Madehttps://www.spreaker.com/episode/the-amazing-true-story-of-how-babies-are-made--42014939Fiona loves how cartoonists are able to take all their experiences, beliefs, bile and passion, wrap them up in a metaphor and get inky fingers in the process and while having fun.

In this episode, Oni Blecher speaks with Fiona about her book ‘The Amazing True Story of How Babies are Made’. We really speak about sex education for young people, appropriate messaging in education tools and resources, and how this education can imprint and shape not only our attitudes toward sex but also our relationships with our bodies.

Enjoy this conversation and check out the animation of The Amazing True Story of How Babies Are Made through www.amazingbabies.tv or https://www.youtube.com/watch?v=ldXBfTkM5Iw&feature=emb_logo

Find Fiona through
Email: fkatauskas@iprimus.com.au or on Twitter @fionakatauskas or through her website www.fionakatauskas.com]]>https://api.spreaker.com/episode/42014939Sun, 22 Nov 2020 17:00:04 +0000PBB Media IncorporatedFiona Katauskas is a cartoonist, illustrator, and author of “The Amazing True Stories of How Babies Are Made’, a children’s book about conception, and childbirth that is relevant to our current social word. Fiona once studied politics at the...Fiona loves how cartoonists are able to take all their experiences, beliefs, bile and passion, wrap them up in a metaphor and get inky fingers in the process and while having fun.

In this episode, Oni Blecher speaks with Fiona about her book ‘The Amazing True Story of How Babies are Made’. We really speak about sex education for young people, appropriate messaging in education tools and resources, and how this education can imprint and shape not only our attitudes toward sex but also our relationships with our bodies.

Enjoy this conversation and check out the animation of The Amazing True Story of How Babies Are Made through www.amazingbabies.tv or https://www.youtube.com/watch?v=ldXBfTkM5Iw&feature=emb_logo

Find Fiona through
Email: fkatauskas@iprimus.com.au or on Twitter @fionakatauskas or through her website www.fionakatauskas.com]]>3650birth,childhood,maternity,maternitycare,maternitychoices,parenting,postnatal,postpartum,pregnancy,sex,sexeducationfalsefullThe Herstory of Midwifery, Reclaiming Midwifery Expertise and Rights of Protection with Dr Rachel Reedhttps://www.spreaker.com/episode/the-herstory-of-midwifery-reclaiming-midwifery-expertise-and-rights-of-protection-with-dr-rachel-reed--41999388
“Instead of locating all of the risks in the women and all our job is to identify how wrong her body is and to fix it, how about looking at what we’re doing and how that may or may not influence how her body functions and her experience of birth.”

Dr Rachel Reed is a midwife, academic, author, and international speaker who focuses on childbirth physiology, midwifery practice, and women’s rights (and rites). She has provided midwifery care for many women and has attended births in a wide range of settings and circumstances. Rachel is the author of the award-winning blog MidwifeThinking and the co-host of The Midwives' Cauldron podcast. She has published widely in journals and magazines, and her first book Why Induction Matters is a popular resource for women and care providers. Her most recent book Reclaiming Childbirth as a Rite of Passage: weaving ancient wisdom with modern knowledge will be published early 2021.

Her blog MidwifeThinking has been accessed by over 5 million readers from every country in the world. It currently has over 10,000 subscribers and around 1000 visitors per day; and is archived by Pandora (National Library of Australia and Partners). Posts have been translated into a number of languages including French, Russian, German and Spanish; and a number of posts have been published in magazines.
In 2019 MidwifeThinking was awarded the International Maternity Expo – Practice Innovation Award for an ‘outstanding contribution to maternity and midwifery services’.
Access MidwifeThinking here: https://midwifethinking.com

Further information about Rachel and her work is available at www.rachel-reed.website

We'd love to hear from you, if you have any questions about this interview or our work at PBB Media, shoot us a line at hello@pbbmedia.org.

Produced, edited and presented by Annalee Atia

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.]]>https://api.spreaker.com/episode/41999388Mon, 16 Nov 2020 18:00:12 +0000PBB Media IncorporatedIn this episode of Pregnancy, Birth & Beyond, Annalee Atia speaks with Dr Rachel Reed about the history and her story of midwifery and its evolution to the modern day midwife, UK & Australian differences in practice and care both in Midwifery and...
“Instead of locating all of the risks in the women and all our job is to identify how wrong her body is and to fix it, how about looking at what we’re doing and how that may or may not influence how her body functions and her experience of birth.”

Dr Rachel Reed is a midwife, academic, author, and international speaker who focuses on childbirth physiology, midwifery practice, and women’s rights (and rites). She has provided midwifery care for many women and has attended births in a wide range of settings and circumstances. Rachel is the author of the award-winning blog MidwifeThinking and the co-host of The Midwives' Cauldron podcast. She has published widely in journals and magazines, and her first book Why Induction Matters is a popular resource for women and care providers. Her most recent book Reclaiming Childbirth as a Rite of Passage: weaving ancient wisdom with modern knowledge will be published early 2021.

Her blog MidwifeThinking has been accessed by over 5 million readers from every country in the world. It currently has over 10,000 subscribers and around 1000 visitors per day; and is archived by Pandora (National Library of Australia and Partners). Posts have been translated into a number of languages including French, Russian, German and Spanish; and a number of posts have been published in magazines.
In 2019 MidwifeThinking was awarded the International Maternity Expo – Practice Innovation Award for an ‘outstanding contribution to maternity and midwifery services’.
Access MidwifeThinking here: https://midwifethinking.com

Further information about Rachel and her work is available at www.rachel-reed.website

We'd love to hear from you, if you have any questions about this interview or our work at PBB Media, shoot us a line at hello@pbbmedia.org.

Produced, edited and presented by Annalee Atia

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.]]>3041birth,childbirth,drrachelreed,feminism,healthcare,herstory,history,maternity,maternitycare,midwife,midwifery,midwifethinking,motherhood,parenting,postnatal,postpartum,pregnancy,pregnant,rachelreedfalsefullIndigenous Knowledge, Representation and Collaborative Communities with Nidala Barkerhttps://www.spreaker.com/episode/indigenous-knowledge-representation-and-collaborative-communities-with-nidala-barker--41952355https://api.spreaker.com/episode/41952355Tue, 10 Nov 2020 03:43:00 +0000PBB Media IncorporatedNidala Barker is Djugan woman from the Kimberley in Western Australia. She is a musician, storyteller, environmental activist, social justice warrior, and all around an insightful and deep feeling and thinking woman. In this episode, Nidala speaks to...2439aboriginal,australia,community,healing,indigenous,motherhood,naidoc,parenting,reconciliationfalsefullSpecial Edition: Mayan Midwives from Guatemala Speak to Gaby Tudorhttps://www.spreaker.com/episode/special-edition-mayan-midwives-from-guatemala-speak-to-gaby-tudor--41740118
"My journey to Lake Atitlan began in Australia with my desire to learn more about practices that heal your womb. I had heard about womb massage in post-partum while working as doula and was interested in this work. This led me to an internet search of Mayan abdominal massage in Guatemala, which led me to Mariu’s course in Lake Atitlan.

Arriving to the high lake surrounded by volcanoes, I wasn’t sure what I completely expected from the Mayan abdominal course. My rational mind led me to believe that I would learn a marketable skill that I could use to deepen my practice with women. It wasn’t until the candles were lit in the Mayan cross; which give thanks to each type of corn, as well as the land, sky and with Doña Dominga giving thanks to her nahuals, that I realised I was doing some deep healing. It was during Doña Dominga's humble thanksgiving to the gods of the Mayan calendar for her gifts, that I knew that these teachings went deeper than just skills... they brought me to a place of ancestral knowing. Doña Dominga and other indigenous midwives still actively use the Mayan calendar and honour the days nahuals with candles and copal. Mariu, the organiser and facilitator of this training was the magic that wove it all together seamlessly. She has worked with Doña Dominga for several years, learning the diverse herbs and flowers used for making balms for massage and mastering the techniques of womb massage. This work is intuitive but also takes practice and guidance to initiate channels of healing to open. Mariu and Doña Dominga’s integrative work, allows you to feel held in learning the Indigenous ways as well as the usage for our modern world. This work is a homage to ways of the past but also to empower a future generation of healers, creating a bridge between ancestral knowledge and future generations.

Mariu Eugenia Gobbato is a massage therapist and midwifery apprentice. She has been working with Doña Dominga, a Mayan midwife in San Marcos la laguna in Lake Atitlan, Guatemala.

Doña Dominga is a Mayan midwife with over 30 years of experience attending births in her rural community in the Guatemalan highlands.

Recently, large rains and floods have caused a landslide in San Marcos, Lake Atitlan and this has destroyed several houses near Doña Dominga’s home. This destruction has also caused disruption to their midwifery services. Please consider donating to PayPal at mayamassageguatemala@gmail.com or visiting Sobada Maya Abdominal Massage on Facebook to see how you can help.

Thank you,
Gaby Tudor,
Zipolite, Oxaca, Mexico"

Thank you Gaby for this episode and Doña Dominga and Mariu Gobatto for generously sharing your midwifery wisdom.

Enjoy this episode ! ]]>https://api.spreaker.com/episode/41740118Sun, 01 Nov 2020 17:00:02 +0000PBB Media IncorporatedIn this episode, Oni Blecher plays a recording of Gaby Tudor interviewing Mayan Midwives from Guatemala. We are so happy to respectfully share their Indigenous wisdom with you in this special edition podcast with PBB foreign correspondent Gaby. Here...
"My journey to Lake Atitlan began in Australia with my desire to learn more about practices that heal your womb. I had heard about womb massage in post-partum while working as doula and was interested in this work. This led me to an internet search of Mayan abdominal massage in Guatemala, which led me to Mariu’s course in Lake Atitlan.

Arriving to the high lake surrounded by volcanoes, I wasn’t sure what I completely expected from the Mayan abdominal course. My rational mind led me to believe that I would learn a marketable skill that I could use to deepen my practice with women. It wasn’t until the candles were lit in the Mayan cross; which give thanks to each type of corn, as well as the land, sky and with Doña Dominga giving thanks to her nahuals, that I realised I was doing some deep healing. It was during Doña Dominga's humble thanksgiving to the gods of the Mayan calendar for her gifts, that I knew that these teachings went deeper than just skills... they brought me to a place of ancestral knowing. Doña Dominga and other indigenous midwives still actively use the Mayan calendar and honour the days nahuals with candles and copal. Mariu, the organiser and facilitator of this training was the magic that wove it all together seamlessly. She has worked with Doña Dominga for several years, learning the diverse herbs and flowers used for making balms for massage and mastering the techniques of womb massage. This work is intuitive but also takes practice and guidance to initiate channels of healing to open. Mariu and Doña Dominga’s integrative work, allows you to feel held in learning the Indigenous ways as well as the usage for our modern world. This work is a homage to ways of the past but also to empower a future generation of healers, creating a bridge between ancestral knowledge and future generations.

Mariu Eugenia Gobbato is a massage therapist and midwifery apprentice. She has been working with Doña Dominga, a Mayan midwife in San Marcos la laguna in Lake Atitlan, Guatemala.

Doña Dominga is a Mayan midwife with over 30 years of experience attending births in her rural community in the Guatemalan highlands.

Recently, large rains and floods have caused a landslide in San Marcos, Lake Atitlan and this has destroyed several houses near Doña Dominga’s home. This destruction has also caused disruption to their midwifery services. Please consider donating to PayPal at mayamassageguatemala@gmail.com or visiting Sobada Maya Abdominal Massage on Facebook to see how you can help.

Thank you,
Gaby Tudor,
Zipolite, Oxaca, Mexico"

Thank you Gaby for this episode and Doña Dominga and Mariu Gobatto for generously sharing your midwifery wisdom.

Enjoy this episode ! ]]>3191birth,fatherhood,health,indigenous,indigenouswisdom,mayan,mayanmidwives,midwifery,midwives,mother,motherhood,parenting,postnatal,postpartum,pregnancy,traditionalhealthfalsefullIntimate Insider: Visions for revolutionising Child Carehttps://www.spreaker.com/episode/intimate-insider-visions-for-revolutionising-child-care--41561787https://api.spreaker.com/episode/41561787Wed, 21 Oct 2020 02:09:41 +0000PBB Media IncorporatedDuring this episode, Oni Blecher speaks to Sarah Blandiargo about her nineteen-year career in childcare and nannying. Sarah runs Move Make classes, where she combines her heart-based kids yoga classes with meditation and creative craft and play. Since...3702babies,birth,childbirth,childcare,children,family,father,mother,nanny,parenting,postnatal,postpartum,pregnancyfalsefullHomebirth Obstetrician. Normal physiology of birth, politics and performance in maternity care with Dr Stuart Fischbein.https://www.spreaker.com/episode/homebirth-obstetrician-normal-physiology-of-birth-politics-and-performance-in-maternity-care-with-dr-stuart-fischbein--41393029

Normalising a deviation from normal, in any field, directs the baseline off track, misleads us as to what normal is and sets us on a course that becomes very difficult to correct the further down the track we go. When we normalise trauma, we no longer see it. When we normalise bad behaviour, it becomes less apparent and when we normalise a deviation from normal physiology it confuses everyone involved.

So what happens when we normalise deviating from normal physiology? When practices such as routine episiotomy (or when the vulva leading to the vaginal passageway is cut open because of a belief that that the tissues cannot or will not expand by themselves), routine induction of labour (thats when a person giving birth, overwhelmingly women, are told that their bodies will be better off being forced to go into labour rather than initiating the process of physiological labour itself), when in Australia one third of babies are born through major abdominal surgery and in some hospitals in Brazil there is an 85% cesarean section rate? What happens when a deviation from the normal physiological process of childbirth - that’s when a complex living organism separates itself from another complex living organism which has been growing inside it for ten months, what happens when this occurs?
Well, we don’t know the full extent of the impacts of these deviations individually or as a whole, short term and long term. But what we do know is that much unnecessary suffering occurs along the way, for everyone involved. Even, for those that are not aware of it.

In my interview with Dr Fischbein he discusses his incredible journey into becoming LA’s ONLY homebirth Obstetrician and how in a country that is leading in mechanical, managed and assisted childbirth, he practices good old fashioned sticking to the blueprint.

If you have any questions about this interview or our work at PBB Media, shoot us a line at hello@pbbmedia.org.

Some fun facts:
> In the Netherland over 15% of babies are born at home.
> In Australia 98% of women labour and birth in the hospital, 1.5% in a birth centre or on the side of the road and 0.5% at home.
> In Brazil, some hospitals have an 85% Cesarean Section rate.
> If you live in America or the UK and you are a black woman you are five times more likely to die during or not long after childbirth.
> The US has a 31% C section rate, Australia has 34% rate (that's 1 in3!). New Zealand babies are 1 in 4 with a 25.9% rate.
> 1 in 3 women in the Australia and the UK will have their labour induced.
> Induction of labour for selected women giving birth for the first time in Australia in 2017 - 43.1%
> 78% of Australian mothers who gave birth in 2016 had pain relief. That’s almost 4 out of 5 women. 36% of these were epidurals.
> The C section rate in Finland, Iceland and Norway stay steady at around 15% (with increasing age of pregnant mothers, diabetes and other diseases).

“You would never do to another mammal what you do to a human female.. no other mammal would labour like that, they would get up and run away”.

Find Dr Stu here: www.birthinginstincts.com

Links

WHO Statement on Cesarean Section rates: https://apps.who.int/iris/bitstream/handle/10665/161442/WHO_RHR_15.02_eng.pdf;jsessionid=FE71548F72C15166C4C9D770D1F41C11?sequence=1

C Section Rates around the world (article, Belly Belly): https://www.bellybelly.com.au/birth/highest-c-section-rates-by-country/

AIHW (Australian statistics on healthcare) Core Maternity Indicators: https://www.aihw.gov.au/reports/mothers-babies/ncmi-data-visualisations/contents/summary

Induction of Labour - Dr Rachel Reed (book, further links to articles and statistics): https://midwifethinking.com/2018/10/05/why-induction-matters-book-release/

Produced, edited and presented by Annalee Atia

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.]]>https://api.spreaker.com/episode/41393029Sun, 11 Oct 2020 18:00:07 +0000PBB Media IncorporatedObstetricians and Normal Childbirth. Normalising a deviation from normal, in any field, directs the baseline off track, misleads us as to what normal is and sets us on a course that becomes very difficult to correct the further down the track we...

Normalising a deviation from normal, in any field, directs the baseline off track, misleads us as to what normal is and sets us on a course that becomes very difficult to correct the further down the track we go. When we normalise trauma, we no longer see it. When we normalise bad behaviour, it becomes less apparent and when we normalise a deviation from normal physiology it confuses everyone involved.

So what happens when we normalise deviating from normal physiology? When practices such as routine episiotomy (or when the vulva leading to the vaginal passageway is cut open because of a belief that that the tissues cannot or will not expand by themselves), routine induction of labour (thats when a person giving birth, overwhelmingly women, are told that their bodies will be better off being forced to go into labour rather than initiating the process of physiological labour itself), when in Australia one third of babies are born through major abdominal surgery and in some hospitals in Brazil there is an 85% cesarean section rate? What happens when a deviation from the normal physiological process of childbirth - that’s when a complex living organism separates itself from another complex living organism which has been growing inside it for ten months, what happens when this occurs?
Well, we don’t know the full extent of the impacts of these deviations individually or as a whole, short term and long term. But what we do know is that much unnecessary suffering occurs along the way, for everyone involved. Even, for those that are not aware of it.

In my interview with Dr Fischbein he discusses his incredible journey into becoming LA’s ONLY homebirth Obstetrician and how in a country that is leading in mechanical, managed and assisted childbirth, he practices good old fashioned sticking to the blueprint.

If you have any questions about this interview or our work at PBB Media, shoot us a line at hello@pbbmedia.org.

Some fun facts:
> In the Netherland over 15% of babies are born at home.
> In Australia 98% of women labour and birth in the hospital, 1.5% in a birth centre or on the side of the road and 0.5% at home.
> In Brazil, some hospitals have an 85% Cesarean Section rate.
> If you live in America or the UK and you are a black woman you are five times more likely to die during or not long after childbirth.
> The US has a 31% C section rate, Australia has 34% rate (that's 1 in3!). New Zealand babies are 1 in 4 with a 25.9% rate.
> 1 in 3 women in the Australia and the UK will have their labour induced.
> Induction of labour for selected women giving birth for the first time in Australia in 2017 - 43.1%
> 78% of Australian mothers who gave birth in 2016 had pain relief. That’s almost 4 out of 5 women. 36% of these were epidurals.
> The C section rate in Finland, Iceland and Norway stay steady at around 15% (with increasing age of pregnant mothers, diabetes and other diseases).

“You would never do to another mammal what you do to a human female.. no other mammal would labour like that, they would get up and run away”.

Find Dr Stu here: www.birthinginstincts.com

Links

WHO Statement on Cesarean Section rates: https://apps.who.int/iris/bitstream/handle/10665/161442/WHO_RHR_15.02_eng.pdf;jsessionid=FE71548F72C15166C4C9D770D1F41C11?sequence=1

C Section Rates around the world (article, Belly Belly): https://www.bellybelly.com.au/birth/highest-c-section-rates-by-country/

AIHW (Australian statistics on...]]>4614baby,birth,breechbirth,childbirth,csection,drstuartfischbein,epidural,homebirth,labour,maternitycare,midwifery,obstetrician,obstetrics,pbbmedia,perinatal,postnatal,pregnancy,twins,womancentredcare,womenshealthfalsefullMidwife Without Borders: Midwifery for the Good of Allhttps://www.spreaker.com/episode/midwife-without-borders-midwifery-for-the-good-of-all--41315828
"Everyone is unique and I am fascinated by what people learn and what people bring to this world. I love providing continuity of care in my work as a midwife. To work deeply with women and to bring their inner power, connecting with their body wisdom. In the job I am doing now I am focusing on quality of care (specifically midwifery) including improving teamwork and learning culture in the hospital system."

Enjoy this podcast.]]>https://api.spreaker.com/episode/41315828Tue, 06 Oct 2020 00:16:08 +0000PBB Media IncorporatedIn this episode, Oni speaks to Laura Latina. Laura is a midwife originally from Italy. She graduated as a Midwife in 2008. Her curiosity and inspiration for the world took her to travel around the world to meet many women and know different cultures....
"Everyone is unique and I am fascinated by what people learn and what people bring to this world. I love providing continuity of care in my work as a midwife. To work deeply with women and to bring their inner power, connecting with their body wisdom. In the job I am doing now I am focusing on quality of care (specifically midwifery) including improving teamwork and learning culture in the hospital system."

Enjoy this podcast.]]>5483birth,conception,doula,fathers,globalhealth,healthcare,international,love,maternity,maternitycare,medicinessansfronteirs,midwife,parents,postpartum,preconception,pregnancyfalsefullTriplets ! A Young Mother's First Pregnancy and Birthhttps://www.spreaker.com/episode/triplets-a-young-mother-s-first-pregnancy-and-birth--40466209https://api.spreaker.com/episode/40466209Mon, 14 Sep 2020 18:30:12 +0000PBB Media IncorporatedIn this episode, Oni Blecher speaks to Madi Luschwitz about her triplet pregnancy, birth, and postnatal period. Madi, an artist, and her partner Nic, a movement and life coach based in Sydney’s Northern Beaches, got quite the surprise when finding...4046birth,firstbirth,love,motherhood,multiplebirth,parenting,postnatal,postpartum,pregnancy,tripletsfalsefullBirth Trauma Awareness Week - A birth story with Steven Kennedy, founder of Birthing Dadshttps://www.spreaker.com/episode/birth-trauma-awareness-week-a-birth-story-with-steven-kennedy-founder-of-birthing-dads--40829029
In this episode, Oni Blecher speaks with founder of Birthing Dads founder Steven Kennedy. After a traumatic birth experience and subsequent postpartum depression, Steven explored and investigated his own experience and the wider culture's attitudes toward fathers and birth partners within the pregnancy, birth and postpartum realms. Through his journey proessing his own trauma, Steven now seeks to support men, birth partners and birth support in educating and preparing themselves for pregnancy, birth and beyond ! In this interview, Steven shares personally from his experience and speaks about the more vulnerable and tender times during his early parenting journey. Steven also shares his visions for the future and his work in changing a dysfunctional system.]]>https://api.spreaker.com/episode/40829029Fri, 11 Sep 2020 00:14:41 +0000PBB Media IncorporatedBirth Trauma Awareness Week 2020 runs from 7-13th September. Throughout the week, tune in to insightful, thought-provoking and deeply honouring stories and discussions with people who have experienced birth trauma, clinicians and researchers in this...
In this episode, Oni Blecher speaks with founder of Birthing Dads founder Steven Kennedy. After a traumatic birth experience and subsequent postpartum depression, Steven explored and investigated his own experience and the wider culture's attitudes toward fathers and birth partners within the pregnancy, birth and postpartum realms. Through his journey proessing his own trauma, Steven now seeks to support men, birth partners and birth support in educating and preparing themselves for pregnancy, birth and beyond ! In this interview, Steven shares personally from his experience and speaks about the more vulnerable and tender times during his early parenting journey. Steven also shares his visions for the future and his work in changing a dysfunctional system.]]>2582birth,birthtrauma,father,fatherhood,love,parenthood,parenting,postpartum,pregnancy,support,traumafalsefullBirth Trauma Awareness Week - A birth story with mother of two Kristyn Begnallhttps://www.spreaker.com/episode/birth-trauma-awareness-week-a-birth-story-with-mother-of-two-kristyn-begnall--40811207
DEAR LISTENER, PROCEED WITH CAUTION (TRAUMA TRIGGER WARNING): in this episode we speak with Australian mother of two Kristyn about her traumatic birthing experience. The content may be upsetting for some - please proceed with caution.

Birth Trauma Awareness Week 2020 runs from 7-13th September. Throughout the week, tune in to insightful, thought-provoking and deeply honouring stories and discussions with people who have experienced birth trauma, clinicians and researchers in this area and maternity advocates working to change the system.

If you or anyone you know needs or wants support you can connect with these resources:
www.birthtalk.org
www.panda.org.au
https://headtohealth.gov.au

Lifeline (crisis support) 13 11 14

Original score 'Opening' by Romy Agam Rom from her album of the same title.

Produced, edited and presented by Annalee Atia

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.

This special series on Birth Trauma is hosted by Pregnancy, Birth and Beyond and brought to you by Maternal Mental Health Matters Australia, a collaboration between four peak Australian consumer advocacy groups: Safe Motherhood For All, Maternity Choices Australia, Maternity Consumer Network & PBB Media

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/40811207Thu, 10 Sep 2020 07:41:37 +0000PBB Media IncorporatedMaternal Mental Health Matters talks Birth Trauma with mother of two Kristyn Begnall. DEAR LISTENER, PROCEED WITH CAUTION (TRAUMA TRIGGER WARNING): in this episode we speak with Australian mother of two Kristyn about her traumatic birthing...
DEAR LISTENER, PROCEED WITH CAUTION (TRAUMA TRIGGER WARNING): in this episode we speak with Australian mother of two Kristyn about her traumatic birthing experience. The content may be upsetting for some - please proceed with caution.

Birth Trauma Awareness Week 2020 runs from 7-13th September. Throughout the week, tune in to insightful, thought-provoking and deeply honouring stories and discussions with people who have experienced birth trauma, clinicians and researchers in this area and maternity advocates working to change the system.

If you or anyone you know needs or wants support you can connect with these resources:
www.birthtalk.org
www.panda.org.au
https://headtohealth.gov.au

Lifeline (crisis support) 13 11 14

Original score 'Opening' by Romy Agam Rom from her album of the same title.

Produced, edited and presented by Annalee Atia

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.

This special series on Birth Trauma is hosted by Pregnancy, Birth and Beyond and brought to you by Maternal Mental Health Matters Australia, a collaboration between four peak Australian consumer advocacy groups: Safe Motherhood For All, Maternity Choices Australia, Maternity Consumer Network & PBB Media

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org]]>2309advocacy,auspol,birth,birthtrauma,birthtraumaawarenessweek,childbirth,maternalmhmatters,maternitycare,midwifery,motherhood,pbbmedia,pelvicfloor,perinealtrauma,pnd,postnatal,postnataldepression,posttraumaticstress,pregnancy,ptsd,womenshealthfalsefullBirth Trauma Awareness Week with Dr Sarah Buckley: Feeling Private, Safe and Unobservedhttps://www.spreaker.com/episode/birth-trauma-awareness-week-with-dr-sarah-buckley-feeling-private-safe-and-unobserved--40810508
Birth Trauma Awareness Week 2020 runs from 7-13th September. Throughout the week, tune in to insightful, thought-provoking and deeply honouring stories and discussions with people who have experienced birth trauma, clinicians and researchers in this area and maternity advocates working to change the system.

Sally speaks with Dr Sarah Buckley about the hormones of birth and how we can maximise them for the most efficient (and maybe even enjoyable) birth. The key to this is to feel private, safe and unobserved, then we instinctively release the right cocktail hormones at the right time.

Dr Sarah Buckley on the hormones of birth. Dr Buckley is a GP/family physician with qualifications in GP-obstetrics and family planning. She is the mother of four home-born children, and is also a PhD candidate at the University of Queensland,, where her research is focused on oxytocin and the autonomic nervous system in labour and birth, and the impacts of interventions. She is the author of the groundbreaking report Hormonal Physiology of Childbearing, which you can download for free at sarahbuckley.com. She is also the author of Gentle Birth, Gentle Mothering.

Dr Buckley can be found at:
www.sarahbuckley.com

Produced and presented by Sally Cusack
Guest: Dr Sarah Buckley

Original score by Romy Agam Rom - 'Openings'

Copyright 2020 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/40810508Thu, 10 Sep 2020 06:49:41 +0000PBB Media IncorporatedMaternal Mental Health Matters talks Birth Trauma with Dr Sarah Buckley. Birth Trauma Awareness Week 2020 runs from 7-13th September. Throughout the week, tune in to insightful, thought-provoking and deeply honouring stories and discussions with...
Birth Trauma Awareness Week 2020 runs from 7-13th September. Throughout the week, tune in to insightful, thought-provoking and deeply honouring stories and discussions with people who have experienced birth trauma, clinicians and researchers in this area and maternity advocates working to change the system.

Sally speaks with Dr Sarah Buckley about the hormones of birth and how we can maximise them for the most efficient (and maybe even enjoyable) birth. The key to this is to feel private, safe and unobserved, then we instinctively release the right cocktail hormones at the right time.

Dr Sarah Buckley on the hormones of birth. Dr Buckley is a GP/family physician with qualifications in GP-obstetrics and family planning. She is the mother of four home-born children, and is also a PhD candidate at the University of Queensland,, where her research is focused on oxytocin and the autonomic nervous system in labour and birth, and the impacts of interventions. She is the author of the groundbreaking report Hormonal Physiology of Childbearing, which you can download for free at sarahbuckley.com. She is also the author of Gentle Birth, Gentle Mothering.

Dr Buckley can be found at:
www.sarahbuckley.com

Produced and presented by Sally Cusack
Guest: Dr Sarah Buckley

Original score by Romy Agam Rom - 'Openings'

Copyright 2020 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>1792birth,birthtrauma,oxytocin,pregnancyfalsefullBirth Trauma Awareness Week with Rhea Dempsey - Working with pain and changing birth culturehttps://www.spreaker.com/episode/birth-trauma-awareness-week-with-rhea-dempsey-working-with-pain-and-changing-birth-culture--40790838https://api.spreaker.com/episode/40790838Wed, 09 Sep 2020 07:05:36 +0000PBB Media IncorporatedThis week is Birth Trauma Awareness Week 2020, where we are working with other maternity health advocacy groups to raise awareness around traumatic birth and the wider implications for inadequate care throughout the pregnancy, birth and postnatal...3361birth,birthtrauma,culture,fatherhood,love,motherhood,parenting,postnatal,postpartum,pregnancy,traumafalsefullBirth Trauma Awareness Week with Professor Jenny Gamble - Psychological Trauma and Helpful Responseshttps://www.spreaker.com/episode/birth-trauma-awareness-week-with-professor-jenny-gamble-psychological-trauma-and-helpful-responses--40749350
Birth Trauma Awareness Week 2020 runs from 7-13th September. Throughout the week, tune in to insightful, thought-provoking and deeply honouring stories and discussions with people who have experienced birth trauma, clinicians and researchers in this area and maternity advocates working to change the system.

Professor Jenny Gamble is Head of Midwifery at Griffith University (Australia) and Director of the Transforming Maternity Care Collaborative. She speaks to the coontributing factors to psychological trauma in childbirth, women and birthing pooled reporting that their birth was traumatic and the development of trauma symptoms. Professor Gamble also looks at helpful early responses and supportive preventive practices.

Transforming Maternity Care Collaborative:
https://www.transformingmaternity.org.au

Produced, edited and presented by Annalee Atia

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.

This special series on Birth Trauma is hosted by Pregnancy, Birth and Beyond and brought to you by Maternal Mental Health Matters Australia, a collaboration between four peak Australian consumer advocacy groups: Safe Motherhood For All, Maternity Choices Australia, Maternity Consumer Network & PBB Media

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/40749350Mon, 07 Sep 2020 12:28:43 +0000PBB Media IncorporatedMaternal Mental Health Matters talks Birth Trauma with Professor Jenny Gamble. Birth Trauma Awareness Week 2020 runs from 7-13th September. Throughout the week, tune in to insightful, thought-provoking and deeply honouring stories and discussions...
Birth Trauma Awareness Week 2020 runs from 7-13th September. Throughout the week, tune in to insightful, thought-provoking and deeply honouring stories and discussions with people who have experienced birth trauma, clinicians and researchers in this area and maternity advocates working to change the system.

Professor Jenny Gamble is Head of Midwifery at Griffith University (Australia) and Director of the Transforming Maternity Care Collaborative. She speaks to the coontributing factors to psychological trauma in childbirth, women and birthing pooled reporting that their birth was traumatic and the development of trauma symptoms. Professor Gamble also looks at helpful early responses and supportive preventive practices.

Transforming Maternity Care Collaborative:
https://www.transformingmaternity.org.au

Produced, edited and presented by Annalee Atia

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.

This special series on Birth Trauma is hosted by Pregnancy, Birth and Beyond and brought to you by Maternal Mental Health Matters Australia, a collaboration between four peak Australian consumer advocacy groups: Safe Motherhood For All, Maternity Choices Australia, Maternity Consumer Network & PBB Media

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org]]>1102birth,birthtrauma,birthtraumaawarenessweek,childbirth,maternalmhmatters,maternitycare,midwifery,pbbmedia,pelvicfloor,perinealtrauma,pnd,postnatal,postnataldepression,posttraumaticstress,pregnancy,ptsd,researchfalsefullBeing with what is with Vanessa Alexandra Woodhttps://www.spreaker.com/episode/being-with-what-is-with-vanessa-alexandra-wood--40635059Vanessa Alexandra Wood a local to the Northern Rivers, born to a Peruvian Mother and Argentine Father on the border of NSW & VIC in Albury/Wodonga. As a child and young woman growing up in a predominantly white Australian culture Vanessa experiences various forms of discrimination and racism and holds these experiences tight to herself, often locked away. As an adult, mother and practitioner she revisits these big feelings and gives them room, air and space to be felt, honoured and when needed, worked through.

Vanessa is the mother of two creative and beautiful young boys and life partner to Chris. Ten years a Naturopath, Vanessa now cooks and nourishes residents in rehabilitation and recovery from addiction and mental health conditions. Vanessa’s connection to Pachamama has always been the pillar in her life and the guiding force behind her work in the shamanic realms of women’s health and beyond.

Today's guest: Vanessa Alexandra Wood

Produced, edited and presented by Annalee Atia

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/40635059Tue, 01 Sep 2020 15:08:48 +0000PBB Media IncorporatedWe're discussing working through big feelings surrounding racism and discrimination, being a woman and the power we have in our hands in this moment, being with what is, not what should be. Vanessa Alexandra Wood a local to the Northern Rivers, born...Vanessa Alexandra Wood a local to the Northern Rivers, born to a Peruvian Mother and Argentine Father on the border of NSW & VIC in Albury/Wodonga. As a child and young woman growing up in a predominantly white Australian culture Vanessa experiences various forms of discrimination and racism and holds these experiences tight to herself, often locked away. As an adult, mother and practitioner she revisits these big feelings and gives them room, air and space to be felt, honoured and when needed, worked through.

Vanessa is the mother of two creative and beautiful young boys and life partner to Chris. Ten years a Naturopath, Vanessa now cooks and nourishes residents in rehabilitation and recovery from addiction and mental health conditions. Vanessa’s connection to Pachamama has always been the pillar in her life and the guiding force behind her work in the shamanic realms of women’s health and beyond.

Today's guest: Vanessa Alexandra Wood

Produced, edited and presented by Annalee Atia

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org]]>2951ancestry,birth,childbirth,culture,discrimination,growth,motherhood,multicultural,pachamama,postnatal,pregnancy,racism,womanhoodfalsefullSovereignty and Birth with Dr Bronwyn Bancrofthttps://www.spreaker.com/episode/sovereignty-and-birth-with-dr-bronwyn-bancroft--40508407
In this episode, Bronwyn shares her experiences giving birth at home in the 1980’s with her oldest two children, and her third vaginal birth at a birth centre at 42 years.

Bronwyn’s story dives into the way that she found and embodied the strength and courage to birth in the way that was right for her, and speaks to the importance of women reclaiming our sovereignty over our bodies and births for the betterment of society at large.

A powerful storyteller and courageous woman, Bronwyn’s words are medicine to those seeking to find, as Bronwyn puts it, the most courageous person inside ourselves, to help us birth the way we envision it.

Bronwyn has also written and/ or illustrated over 41 children’s books. Those listening in NSW who have given birth recently might recognise Bronwyn’s books ABC and 123 which NSW hospitals give to new mums and bubs to take home. We’re so grateful to Bronwyn for sharing her story, her medicine, and her wisdom with us, and for those of you who are familiar with her art, to hear her powerful words as a sovereign woman who fights and advocates tirelessly for the sovereignty of us all.

Find out more about Bronwyn's work at www.bronwynbancroft.com]]>https://api.spreaker.com/episode/40508407Thu, 27 Aug 2020 01:58:50 +0000PBB Media IncorporatedDr Bronwyn Bancroft is a Bundjalung woman and elder, an acclaimed artist and mother to three children, Jack, Ella and Rubyrose. In this episode, Bronwyn shares her experiences giving birth at home in the 1980’s with her oldest two children, and her...
In this episode, Bronwyn shares her experiences giving birth at home in the 1980’s with her oldest two children, and her third vaginal birth at a birth centre at 42 years.

Bronwyn’s story dives into the way that she found and embodied the strength and courage to birth in the way that was right for her, and speaks to the importance of women reclaiming our sovereignty over our bodies and births for the betterment of society at large.

A powerful storyteller and courageous woman, Bronwyn’s words are medicine to those seeking to find, as Bronwyn puts it, the most courageous person inside ourselves, to help us birth the way we envision it.

Bronwyn has also written and/ or illustrated over 41 children’s books. Those listening in NSW who have given birth recently might recognise Bronwyn’s books ABC and 123 which NSW hospitals give to new mums and bubs to take home. We’re so grateful to Bronwyn for sharing her story, her medicine, and her wisdom with us, and for those of you who are familiar with her art, to hear her powerful words as a sovereign woman who fights and advocates tirelessly for the sovereignty of us all.

Find out more about Bronwyn's work at www.bronwynbancroft.com]]>1953aboriginal,birth,birthingoncountry,freebirth,homebirth,indigenous,pregnancy,sovereignty,womenfalsefullVBAC and Homebirth after Cesarean with academic, mother and Midwife Hazel Keedlehttps://www.spreaker.com/episode/vbac-and-homebirth-after-cesarean-with-academic-mother-and-midwife-hazel-keedle--40378581
Links discussed during this podcast:

1. VBAC Matters page (lots of info & videos): https://www.facebook.com/VBACmatters

2. Hazel's Research, Women’s experiences of planning a vaginal birth after caesarean in different models of maternity care in Australia: https://bit.ly/3aB353j

Hazel is also involved in a new survey exploring the experiences of Australian childbearing women in relation to the COVID19 pandemic, you can take the survey here: https://bit.ly/3h5XDrX

Today's guest: Hazel Keedle

Produced, edited and presented by Annalee Atia for PBB Media

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/40378581Tue, 18 Aug 2020 04:40:45 +0000PBB Media IncorporatedHazel Keedle is a midwifery researcher and lecturer at Western Sydney University and a PhD candidate. Hazel has worked in midwifery group practices, an aboriginal medical service, a variety of hospital settings and as a privately practising midwife in...
Links discussed during this podcast:

1. VBAC Matters page (lots of info & videos): https://www.facebook.com/VBACmatters

2. Hazel's Research, Women’s experiences of planning a vaginal birth after caesarean in different models of maternity care in Australia: https://bit.ly/3aB353j

Hazel is also involved in a new survey exploring the experiences of Australian childbearing women in relation to the COVID19 pandemic, you can take the survey here: https://bit.ly/3h5XDrX

Today's guest: Hazel Keedle

Produced, edited and presented by Annalee Atia for PBB Media

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.

The Pregnancy, Birth and Beyond show is part of a wider nonprofit community media and journalism project, PBB Media.

All rights reserved.

www.pbbmedia.org]]>3185australianhealthcare,australianresearch,babies,biasinresearch,birth,cesarean,childbirth,hbac,healthconsumers,maternitycare,midwifery,motherhood,obstetrics,parenting,pregnancy,research,vaginalbirth,vbac,womenshealthfalsefullCommunicating With Little Ones. How to Create Healthy Family Connectionhttps://www.spreaker.com/episode/communicating-with-little-ones-how-to-create-healthy-family-connection--40011296https://api.spreaker.com/episode/40011296Tue, 11 Aug 2020 02:04:22 +0000PBB Media IncorporatedIn this episode, Oni Blecher speaks with 'Get Promoted Life'; a high level performance and life coach, specialising in optimising the relationship with self and others. This includes effective communication and how to connect more thoroughly and...2563birth,bodylanguage,communication,family,fatherhood,labor,labour,love,maternitycare,motherhood,parenthood,parenting,postnatal,postpartum,pregnancyfalsefullBirth as a Sacred Emergence: Embody Birth with Maha Al Musahttps://www.spreaker.com/episode/birth-as-a-sacred-emergence-embody-birth-with-maha-al-musa--40207268
In this episode of Pregnancy Birth and Beyond, Kirilly Dawn speaks with Maha Al Musa - internationally acclaimed independant childbirth educator and fierce advocate for centering the sacredness of birth in maternity care.

Maha is a mother of three children, and is the founder of EmbodyBirth, and author of 'Dance of the Womb: The Essential Guide to Belly Dance for Pregnancy and Birth'. She birthed her third child, daughter Aminah in a home water lotus birth, at 46 years old, and breastfed her until she self weened at 8.5 years, when Maha was 54.5 years old. As such, Maha is an advocate for extended breastfeeding, home birth, and women being the authorities and experts in what is right for them and their babies.

You can find out more about Maha at www.mahaalmusa.com or Instagram @maha_al_musa
The EmbodyBirth program: https://sales.mahaalmusa.com/embodybirth]]>https://api.spreaker.com/episode/40207268Sat, 08 Aug 2020 05:38:05 +0000PBB Media IncorporatedWhat does it mean to have an embodied pregnancy and birth experience? How can we tap into, and move forward, from our inner knowing? And how can we reclaim the sacredness of birth? In this episode of Pregnancy Birth and Beyond, Kirilly Dawn speaks...
In this episode of Pregnancy Birth and Beyond, Kirilly Dawn speaks with Maha Al Musa - internationally acclaimed independant childbirth educator and fierce advocate for centering the sacredness of birth in maternity care.

Maha is a mother of three children, and is the founder of EmbodyBirth, and author of 'Dance of the Womb: The Essential Guide to Belly Dance for Pregnancy and Birth'. She birthed her third child, daughter Aminah in a home water lotus birth, at 46 years old, and breastfed her until she self weened at 8.5 years, when Maha was 54.5 years old. As such, Maha is an advocate for extended breastfeeding, home birth, and women being the authorities and experts in what is right for them and their babies.

You can find out more about Maha at www.mahaalmusa.com or Instagram @maha_al_musa
The EmbodyBirth program: https://sales.mahaalmusa.com/embodybirth]]>3972bellydance,birth,breastfeeding,dance,embodiment,homebirth,motherhood,parenthood,pregnancy,somaticsfalsefullBONUS EPISODE: Finding Peace through Non-Violent Communication with Paulette Bray-Naraihttps://www.spreaker.com/episode/bonus-episode-finding-peace-through-non-violent-communication-with-paulette-bray-narai--40066144
NVC was developed by Dr Marshall Rosenberg in the US in the 1960's and has been used since that time to bring groups with vastly opposing views together to form peaceful agreements. The NVC process has 4 main steps:
1. When faced with a situation, observe what is happening objectively.
2. Sense your feelings in response to the situation.
3. Connect your feelings with a need.
4. Make a request (of yourself or the other person), without having attachment to your particular request.

This process is described in full in Dr Rosenberg's book "Non-Violent Communication".

In this podcast we examine some common statements that can lead to disagreement, and then reframe these statements using NVC. Through this process we come to see how judgements in the use of certain words close down curiosity and open-minded discussion, and how by contrast the NVC process keeps seemingly opposing parties engaged with finding solutions.

Also mentioned is the work of US based NVC trainer, Miki Kashtan who can be found at www.thefearlessheart.org.

Paulette can be found at:
www.expresspeace.com
and
www.byronbayhealthycommunication.com.au/

Produced and presented by Sally Cusack
Guest: Paulette Bray-Narai

Copyright 2020 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/40066144Thu, 30 Jul 2020 23:45:05 +0000PBB Media IncorporatedSally speaks with Paulette Bray-Narai, a certified Nonviolent Communication (NVC) instructor about how we can reframe the challenges we find in life through the practice of NVC. NVC was developed by Dr Marshall Rosenberg in the US in the 1960's and...
NVC was developed by Dr Marshall Rosenberg in the US in the 1960's and has been used since that time to bring groups with vastly opposing views together to form peaceful agreements. The NVC process has 4 main steps:
1. When faced with a situation, observe what is happening objectively.
2. Sense your feelings in response to the situation.
3. Connect your feelings with a need.
4. Make a request (of yourself or the other person), without having attachment to your particular request.

This process is described in full in Dr Rosenberg's book "Non-Violent Communication".

In this podcast we examine some common statements that can lead to disagreement, and then reframe these statements using NVC. Through this process we come to see how judgements in the use of certain words close down curiosity and open-minded discussion, and how by contrast the NVC process keeps seemingly opposing parties engaged with finding solutions.

Also mentioned is the work of US based NVC trainer, Miki Kashtan who can be found at www.thefearlessheart.org.

Paulette can be found at:
www.expresspeace.com
and
www.byronbayhealthycommunication.com.au/

Produced and presented by Sally Cusack
Guest: Paulette Bray-Narai

Copyright 2020 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>3536community,nonviolentcommunication,nvc,parentingfalsefullWith Women: Homebirth, Midwifery and Yoni Steaming: Sali's Story.https://www.spreaker.com/episode/with-women-homebirth-midwifery-and-yoni-steaming-sali-s-story--39996558https://api.spreaker.com/episode/39996558Tue, 28 Jul 2020 00:22:39 +0000PBB Media IncorporatedIn this episode, Oni Blecher interviews Sali McIntyre. Sali is an Australian midwife, antenatal educator at Tweed hospital, Arvigo practitioner and teacher, and mother of four adult children, all born at home. Sali founded and runs 'Heart and Soul of...3037antenatal,homebirth,love,maternity,midwife,midwifery,motherhood,parenting,postpartum,womenshealthfalsefullBecoming A mother and Mattering, Dr Belinda Barnett on her personal and professional experiencehttps://www.spreaker.com/episode/becoming-a-mother-and-mattering-dr-belinda-barnett-on-her-personal-and-professional-experience--39864474Belinda recently completed a PhD at the University of Queensland, her thesis titled “Becoming a mother and mattering in early 21st century Australia”.

Confired on March 27th, 'Becoming a mother and mattering in early 21st century Australia: An exploration of women's perinatal transitions and equity in wellbeing' looks at the value of mothers in our society. We discussed her personal and professional experiences that led her her current work, her research and a recent submissions to the QLD human rights commission.

Information mentioned in this podcast:

1. Application of the Human Rights Act of Queensland to the provision of public maternity services in Queensland Policy brief for the Queensland Human Rights Commission
2. Maternal health brief for meetings with Queensland Health Minister, Queensland Shadow Health Minister, State Members of Parliament and candidates for October 2020 Queensland election.
Both can be found here - http://www.maternitychoices.org.au/campaigns--projects.html

3. Belinda's thesis - Becoming a mother and mattering in early 21st century Australia: An exploration of women's perinatal transitions and equity in wellbeing can be found through the University of Queensland e-library (no gateway):
https://espace.library.uq.edu.au/view/UQ:f2faace

Today's guest: Dr Belinda Barnett

Produced, edited and presented by Annalee Atia for PBB Media

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.

The Pregnancy, Birth and Beyond show is part of a wider community media and journalism project.

All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/39864474Mon, 20 Jul 2020 16:10:20 +0000PBB Media IncorporatedToday on the show we are speaking with Dr Belinda Barnett. Dr Barnett is a maternal health researcher, psychologist and community advocate for the protection of mothers’ human rights. Belinda recently completed a PhD at the University of Queensland,...Belinda recently completed a PhD at the University of Queensland, her thesis titled “Becoming a mother and mattering in early 21st century Australia”.

Confired on March 27th, 'Becoming a mother and mattering in early 21st century Australia: An exploration of women's perinatal transitions and equity in wellbeing' looks at the value of mothers in our society. We discussed her personal and professional experiences that led her her current work, her research and a recent submissions to the QLD human rights commission.

Information mentioned in this podcast:

1. Application of the Human Rights Act of Queensland to the provision of public maternity services in Queensland Policy brief for the Queensland Human Rights Commission
2. Maternal health brief for meetings with Queensland Health Minister, Queensland Shadow Health Minister, State Members of Parliament and candidates for October 2020 Queensland election.
Both can be found here - http://www.maternitychoices.org.au/campaigns--projects.html

3. Belinda's thesis - Becoming a mother and mattering in early 21st century Australia: An exploration of women's perinatal transitions and equity in wellbeing can be found through the University of Queensland e-library (no gateway):
https://espace.library.uq.edu.au/view/UQ:f2faace

Today's guest: Dr Belinda Barnett

Produced, edited and presented by Annalee Atia for PBB Media

Pregnancy, Birth and Beyond comes to you from Bundjalung Country at Cavanbah or Byron Bay and we acknowledge with respect and reverence the Arakwal people of the Bunjulung nation, neighbouring clans and people for caring for this country since time immemorial.

The Pregnancy, Birth and Beyond show is part of a wider community media and journalism project.

All rights reserved.

www.pbbmedia.org]]>2313auspol,australianmaternitycare,birth,childbirth,equityinwellbeing,humanrights,maternity,maternitycare,maternityleave,matrescence,motherhood,pbbmedia,perinatal,podcast,postnatal,pregnancy,research,unpaidwork,womenshealth,womensrightsinchildbirthfalsefullEndometriosis: Out of the Shadowshttps://www.spreaker.com/episode/endometriosis-out-of-the-shadows--39265264https://api.spreaker.com/episode/39265264Mon, 13 Jul 2020 18:00:13 +0000PBB Media IncorporatedOni Blecher speaks to Naturopath and soon-to-be mother, Layla Metcafle about her observations of often mysterious and misunderstood condition Endometriosis. Layla shares from her well experienced professional vantage point and from her own personal...3073antenatal,baby,chronicpain,cyclehealth,endometriosis,fatherhood,love,menstrual,mother,motherhood,naturopath,parenthood,postpartumfalsefullMotherhood Incarcerated: Systemic Racism and the (in)Justice System's Profound Impact on Womenhttps://www.spreaker.com/episode/motherhood-incarcerated-systemic-racism-and-the-in-justice-system-s-profound-impact-on-women--37829084
In this episode of Pregnancy Birth and Beyond, presenter Kirilly Dawn speaks with Debbie Kilroy OAM, founder of Sisters Inside, about the targeted impact of the Prison Industrial Complex on mothers, women and girls. Debbie is one of Australia’s leading advocates for protecting the human rights of women and children through decarceration - the process of moving away from using prisons and other systems of social control in response to crime and social issues. In this conversation, Debbie discusses why she is a prison abolitionist, why she started Sisters Inside after her own experience of prison, and the justice a world without prisons would provide. She unravels the racial capitalist system which is responsible for the alarmingly yet strategically high incarceration rates of women, particularly Aboriginal and Torres Strait Islander women and girls. We also speak about reproductive justice, maternity care inside, and the realities many women face when being pregnant and birthing in prison. And lastly Debbie speaks to the Free Her campaign run by Sisters Inside, which has now raised over a million dollars to pay off the fines of women in Western Australia who are being incarcerated for poverty, many of whom are Aboriginal women. 

Debbie Kilroy OAM
Debbie’s passion for justice is the result of her personal experience of the criminal (in)justice system and an unwavering belief that prison represents a failure of justice.

During her time in prison, Debbie worked hard for a degree in Social Work and took on the huge task of turning her life around. Since then, she has qualified as a Gestalt Therapist and Legal Practitioner, and has completed a Graduate Diploma of Forensic Mental Health.

After her release in 1992, Debbie established Sisters Inside, which advocates for the human rights of women in the criminal justice system and responds to gaps in the services available to them.
Sisters Inside has won international recognition for its work and its unique structure which ensures it is driven by women with lived prison experience.

In 2003, Debbie was awarded the Order of Australia Medal for services to the community for working with women in prison. She was also awarded the Australian Human Rights Medal in 2004 and a Churchill Fellowship to explore decarceration strategies and programs internationally in 2014. In 2017, Debbie was appointed to the Queensland Government Sentencing Advisory Council. Debbie was admitted to the legal profession by the Supreme Court of Queensland in 2007 – a rare achievement for someone with serious convictions. She now has her own law firm and (in addition to her work as CEO of Sisters Inside) is one of Queensland’s leading criminal solicitors.

To read more about Debbie and her work at Sisters Inside visit:
www.sistersinside.com.au

To donate to Sister's Inside 'Free Her' campaign assisting women in Western Australia visit:
https://www.gofundme.com/f/bfvnvt-freethepeople]]>https://api.spreaker.com/episode/37829084Wed, 08 Jul 2020 23:13:32 +0000PBB Media IncorporatedIn 2018 the Australian Human Rights Commission stated that the trend towards incarceration saw a 77% increase of women in prison, with Aboriginal and Torres Strait Islander women making up the majority of this increase. Indigenous women and girls are...
In this episode of Pregnancy Birth and Beyond, presenter Kirilly Dawn speaks with Debbie Kilroy OAM, founder of Sisters Inside, about the targeted impact of the Prison Industrial Complex on mothers, women and girls. Debbie is one of Australia’s leading advocates for protecting the human rights of women and children through decarceration - the process of moving away from using prisons and other systems of social control in response to crime and social issues. In this conversation, Debbie discusses why she is a prison abolitionist, why she started Sisters Inside after her own experience of prison, and the justice a world without prisons would provide. She unravels the racial capitalist system which is responsible for the alarmingly yet strategically high incarceration rates of women, particularly Aboriginal and Torres Strait Islander women and girls. We also speak about reproductive justice, maternity care inside, and the realities many women face when being pregnant and birthing in prison. And lastly Debbie speaks to the Free Her campaign run by Sisters Inside, which has now raised over a million dollars to pay off the fines of women in Western Australia who are being incarcerated for poverty, many of whom are Aboriginal women. 

Debbie Kilroy OAM
Debbie’s passion for justice is the result of her personal experience of the criminal (in)justice system and an unwavering belief that prison represents a failure of justice.

During her time in prison, Debbie worked hard for a degree in Social Work and took on the huge task of turning her life around. Since then, she has qualified as a Gestalt Therapist and Legal Practitioner, and has completed a Graduate Diploma of Forensic Mental Health.

After her release in 1992, Debbie established Sisters Inside, which advocates for the human rights of women in the criminal justice system and responds to gaps in the services available to them.
Sisters Inside has won international recognition for its work and its unique structure which ensures it is driven by women with lived prison experience.

In 2003, Debbie was awarded the Order of Australia Medal for services to the community for working with women in prison. She was also awarded the Australian Human Rights Medal in 2004 and a Churchill Fellowship to explore decarceration strategies and programs internationally in 2014. In 2017, Debbie was appointed to the Queensland Government Sentencing Advisory Council. Debbie was admitted to the legal profession by the Supreme Court of Queensland in 2007 – a rare achievement for someone with serious convictions. She now has her own law firm and (in addition to her work as CEO of Sisters Inside) is one of Queensland’s leading criminal solicitors.

To read more about Debbie and her work at Sisters Inside visit:
www.sistersinside.com.au

To donate to Sister's Inside 'Free Her' campaign assisting women in Western Australia visit:
https://www.gofundme.com/f/bfvnvt-freethepeople]]>2484abolitionist,decarceration,defundthepolice,freeher,motherhood,pregnancy,prisonabolition,sistersinsidefalsefullSPECIAL EDITION: A New Chapter for PBB!https://www.spreaker.com/episode/special-edition-a-new-chapter-for-pbb--35345125
Catch some of the history from our current and previous team in this episode. This is a cut down version from our Facebook Live event recorded on 27 June 2020, which you can view here:
https://www.facebook.com/PregnancyBirthAndBeyondRadio/videos/2440410122918294/

More about the history of PBB Media can be found at: https://www.pbbmedia.org/our-history.html

Episodes mentioned:
Paul Crebar on becoming a father: https://www.spreaker.com/user/pregnancybirthandbeyond/paul-crebar-on-expectant-fatherhood
https://www.spreaker.com/user/pregnancybirthandbeyond/paul-crebar-on-becoming-a-father
Sean's show on male privilege: https://www.spreaker.com/user/pregnancybirthandbeyond/pbb05022018lukeaddinsallmalepriviledge-1
Caroline's show with Anna Watts on the chakras of birth: https://www.spreaker.com/user/pregnancybirthandbeyond/the-chakras-of-pregnancy-and-birth-with-
Dr Oscar on the peak of postnatal depletion being 5 years after birth: https://www.spreaker.com/user/pregnancybirthandbeyond/dr-oscar-serrallach-on-postnatal-depleti
Sean's first interview with Sally: https://www.spreaker.com/user/pregnancybirthandbeyond/the-missing-link-in-birth-preparation_1

You can find Paulie Glow's song Obstacles Make me Grow on Spotify and at https://luminousyouth.com/paulie_glow/

Aired live on 99.9BayFM in Byron Bay, Australia on 29 June 2020.

Produced and presented by Sally Cusack and Annalee Atia for PBB Media
PBB Team/Guests: Oni Blecher, Kirilly Dawn, Taneal Cadou-Blake, Sean Tonnet, Caroline Cowley, Dr Oscar Serrallach, Anna Watts, Paul Crebar/Paulie Glow.

Copyright 2020 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/35345125Thu, 02 Jul 2020 06:13:04 +0000PBB Media IncorporatedThis is a special edition of Pregnancy, Birth and Beyond that commemorates our last broadcast after 9 years and 9 months of continuous weekly shows from 99.9 BayFM in Byron Bay. HOWEVER! Our weekly podcasts will continue each and every week. Catch...
Catch some of the history from our current and previous team in this episode. This is a cut down version from our Facebook Live event recorded on 27 June 2020, which you can view here:
https://www.facebook.com/PregnancyBirthAndBeyondRadio/videos/2440410122918294/

More about the history of PBB Media can be found at: https://www.pbbmedia.org/our-history.html

Episodes mentioned:
Paul Crebar on becoming a father: https://www.spreaker.com/user/pregnancybirthandbeyond/paul-crebar-on-expectant-fatherhood
https://www.spreaker.com/user/pregnancybirthandbeyond/paul-crebar-on-becoming-a-father
Sean's show on male privilege: https://www.spreaker.com/user/pregnancybirthandbeyond/pbb05022018lukeaddinsallmalepriviledge-1
Caroline's show with Anna Watts on the chakras of birth: https://www.spreaker.com/user/pregnancybirthandbeyond/the-chakras-of-pregnancy-and-birth-with-
Dr Oscar on the peak of postnatal depletion being 5 years after birth: https://www.spreaker.com/user/pregnancybirthandbeyond/dr-oscar-serrallach-on-postnatal-depleti
Sean's first interview with Sally: https://www.spreaker.com/user/pregnancybirthandbeyond/the-missing-link-in-birth-preparation_1

You can find Paulie Glow's song Obstacles Make me Grow on Spotify and at https://luminousyouth.com/paulie_glow/

Aired live on 99.9BayFM in Byron Bay, Australia on 29 June 2020.

Produced and presented by Sally Cusack and Annalee Atia for PBB Media
PBB Team/Guests: Oni Blecher, Kirilly Dawn, Taneal Cadou-Blake, Sean Tonnet, Caroline Cowley, Dr Oscar Serrallach, Anna Watts, Paul Crebar/Paulie Glow.

Copyright 2020 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>2039community,communityradio,family,parentingfalsefullOptimise your chances of natural vaginal birth with Midwife Annahttps://www.spreaker.com/episode/optimise-your-chances-of-natural-vaginal-birth-with-midwife-anna--28737355
We're going discuss how to optimise your chances of having a physiological vaginal birth and the importance of listening to positive natural birth stories during your pregnancy and changing the birth narrative.

Find out more about Anna's work and access the special discount for Pregnancy, Birth & Beyond listeners (25% off online programs, use code: EMPOWEREDBIRTH) here - www.thespiritualmidwife.net

Listen to The Natural Birth Podcast here - www.anchor.fm/thenaturalbirthpodcast

Today's guest: Anna Sangeet

Produced, edited and presented by Annalee Atia
All rights reserved.

www.pbbmedia.org

PS - if you would like to send us questions or comments, share your story with us and our listeners, apply to become a PBBM contributor or just say hello, send us an email via hello@pbbmedia.org. If you loved the show, don't forget to like/follow us on socials and most importantly rate/review the podcast on iTunes (this helps others find us more easily!).

Love to you all out there wherever you are, stay safe and take care.
The PBB Media team.]]>https://api.spreaker.com/episode/28737355Sun, 07 Jun 2020 20:00:02 +0000PBB Media IncorporatedHello dears! Annalee here.. Today's episode of Pregnancy, Birth and Beyond is all about optimising natural vaginal childbirth, I am so happy to be having Anna the Spiritual Midwife on the show today. Anna is a midwife and childbirth educator who is...
We're going discuss how to optimise your chances of having a physiological vaginal birth and the importance of listening to positive natural birth stories during your pregnancy and changing the birth narrative.

Find out more about Anna's work and access the special discount for Pregnancy, Birth & Beyond listeners (25% off online programs, use code: EMPOWEREDBIRTH) here - www.thespiritualmidwife.net

Listen to The Natural Birth Podcast here - www.anchor.fm/thenaturalbirthpodcast

Today's guest: Anna Sangeet

Produced, edited and presented by Annalee Atia
All rights reserved.

www.pbbmedia.org

PS - if you would like to send us questions or comments, share your story with us and our listeners, apply to become a PBBM contributor or just say hello, send us an email via hello@pbbmedia.org. If you loved the show, don't forget to like/follow us on socials and most importantly rate/review the podcast on iTunes (this helps others find us more easily!).

Love to you all out there wherever you are, stay safe and take care.
The PBB Media team.]]>1907babies,birth,childbirth,childbirthpreperation,maternalmentalhealth,maternity,maternitycare,midwife,motherhood,naturalbirth,parenting,pbbmedia,perinatalcare,physiologicalchildbirth,postnatal,postnatalcare,pregnancy,pregnancysupport,thespiritualmidwifefalsefullBirth is Just the Beginning with Catherine Bellhttps://www.spreaker.com/episode/birth-is-just-the-beginning-with-catherine-bell--28797080
References:

Catherine is the author of The Birth Map, a guide for parents preparing for birth and postnatal life: www.bellabirth.org.

"Matrescence" - the time of "mother-becoming" (Dana Raphael) - https://www.pbbmedia.org/matrescence.html

Safe co-sleeping guidelines - important to set up for this even if you don't intend co-sleeping, as there are very high chances it could happen inadvertently, so you want to make sure it's safe (ie, NOT on the couch): https://cosleeping.nd.edu/

Safe Motherhood for All (check out their First Baby Campaign): https://www.safemotherhoodforall.org.au/

White Ribbon Alliance for reproductive, maternal and newborn health and rights.: https://www.whiteribbonalliance.org/

Anxiety and Depression support: www.panda.org.au, www.beyondblue.org.au, Lifeline: 13 11 14

First aired live on 99.9BayFM in Byron Bay, Australia on 25 May 2020.

Produced and presented by Sally Cusack for PBB Media
Guest: Catherine Bell, www.bellabirth.org

Copyright 2020 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/28797080Mon, 01 Jun 2020 09:03:14 +0000PBB Media IncorporatedIn this show Sally speaks with mother, doula, author and maternity services advocate, Catherine Bell, about the importance of thoroughly exploring your options for life after birth, the postnatal period and having a clear plan in place. As Catherine...
References:

Catherine is the author of The Birth Map, a guide for parents preparing for birth and postnatal life: www.bellabirth.org.

"Matrescence" - the time of "mother-becoming" (Dana Raphael) - https://www.pbbmedia.org/matrescence.html

Safe co-sleeping guidelines - important to set up for this even if you don't intend co-sleeping, as there are very high chances it could happen inadvertently, so you want to make sure it's safe (ie, NOT on the couch): https://cosleeping.nd.edu/

Safe Motherhood for All (check out their First Baby Campaign): https://www.safemotherhoodforall.org.au/

White Ribbon Alliance for reproductive, maternal and newborn health and rights.: https://www.whiteribbonalliance.org/

Anxiety and Depression support: www.panda.org.au, www.beyondblue.org.au, Lifeline: 13 11 14

First aired live on 99.9BayFM in Byron Bay, Australia on 25 May 2020.

Produced and presented by Sally Cusack for PBB Media
Guest: Catherine Bell, www.bellabirth.org

Copyright 2020 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>2366matrescence,motherhood,perinatalcare,postnatal,postnatalsupportfalsefullEarth Building and Food Growing; Motherhood in Community with Dani Wolffhttps://www.spreaker.com/episode/earth-building-and-food-growing-motherhood-in-community-with-dani-wolff--28579814https://api.spreaker.com/episode/28579814Fri, 29 May 2020 03:05:19 +0000PBB Media IncorporatedOni Blecher interviews Dani Wolff about her experience in learning and teaching food growing, earth building, and creating intentional community through earth nurturing principles. Having recently become a mother herself, Dani talks about how to apply...2606birth,community,earth,earthbuilding,fatherhood,foodeconomy,foodgrowing,joy,love,motherhood,parenting,postnatal,postpartum,pregnancyfalsefullBirthing Dads with Steven Kennedy. How to transition with confidence into fatherhoodhttps://www.spreaker.com/episode/birthing-dads-with-steven-kennedy-how-to-transition-with-confidence-into-fatherhood--27820826https://api.spreaker.com/episode/27820826Wed, 20 May 2020 01:47:25 +0000PBB Media IncorporatedOni Blecher interviews Steven Kennedy about his work with Birthing Dads and inquires into Steven's birth story. Steven speaks to preparing fathers for birth and the postnatal period. He speaks about how fathers and male birth support are the 'sleeping...3302baby,birth,childcare,children,fathers,love,mentalhealth,motherhood,parenting,postnatal,postpartum,pregnancy,relationshipfalsefullTrends in Birth and Self-Care for Mothershttps://www.spreaker.com/episode/trends-in-birth-and-self-care-for-mothers--26186131
Firstly Sally speaks with Moran Liviani, mother of 3 girls and doula based in Brisbane. Moran talks about the trends she's noticing with her clients during the COVID-19 pandemic. She says all of her clients would choose homebirth, if they could afford it. And that these are families who would have never considered homebirth before but they have now come to see birthing in hospital as dangerous and birthing at home safer. She also discusses the significant drop in inductions of labour.

A recent Lancet study on the safety of homebirth for low risk women: https://doi.org/10.1016/j.eclinm.2020.100319

Moran and her work as a doula and childbirth educator can be found at: www.2life.com.au.

In the second half, Nicola Liebke, mother of 3 boys and one step-daughter, teacher, postnatal doula and parent group leader shares why she believes self-care for mothers is so important during this time where so many find themselves teaching their kids at home while also balancing their work and other commitments. Nicola also shares her top 5 tips for self-care for mothers during this time: physical care, creative care, nature care, mind care and joining a women's circle.

Nicola can be found at www.moonhutmamas.com where she facilitates online women's circles.

Thank you Moran and Nicola!

First aired live on 99.9BayFM in Byron Bay, Australia on 27 April 2020.

Produced and presented by Sally Cusack for PBB Media
Guests: Moran Liviani, www.2life.com.au and Nicola Liebke, www.moonhutmamas.com

Copyright 2020 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/26186131Tue, 05 May 2020 09:15:20 +0000PBB Media IncorporatedThis episode is in two parts: Firstly Sally speaks with Moran Liviani, mother of 3 girls and doula based in Brisbane. Moran talks about the trends she's noticing with her clients during the COVID-19 pandemic. She says all of her clients would...
Firstly Sally speaks with Moran Liviani, mother of 3 girls and doula based in Brisbane. Moran talks about the trends she's noticing with her clients during the COVID-19 pandemic. She says all of her clients would choose homebirth, if they could afford it. And that these are families who would have never considered homebirth before but they have now come to see birthing in hospital as dangerous and birthing at home safer. She also discusses the significant drop in inductions of labour.

A recent Lancet study on the safety of homebirth for low risk women: https://doi.org/10.1016/j.eclinm.2020.100319

Moran and her work as a doula and childbirth educator can be found at: www.2life.com.au.

In the second half, Nicola Liebke, mother of 3 boys and one step-daughter, teacher, postnatal doula and parent group leader shares why she believes self-care for mothers is so important during this time where so many find themselves teaching their kids at home while also balancing their work and other commitments. Nicola also shares her top 5 tips for self-care for mothers during this time: physical care, creative care, nature care, mind care and joining a women's circle.

Nicola can be found at www.moonhutmamas.com where she facilitates online women's circles.

Thank you Moran and Nicola!

First aired live on 99.9BayFM in Byron Bay, Australia on 27 April 2020.

Produced and presented by Sally Cusack for PBB Media
Guests: Moran Liviani, www.2life.com.au and Nicola Liebke, www.moonhutmamas.com

Copyright 2020 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>1958birth,homebirth,inductionoflabour,motherhood,onlinewomenscircles,self-care,supportduringcovid19falsefullDr Igor Tabrizian on Pre-conception Nutrition, Covid-19 and taking a stand as Physicianshttps://www.spreaker.com/episode/dr-igor-tabrizian-on-pre-conception-nutrition-covid-19-and-taking-a-stand-as-physicians--25877690
The Health Lodge takes a modern and advanced approach to medicine and healthcare and provides meaningful continuity of care to its patients. Practitioners come with a holistic whole-person attitude to healthcare and work together as a team. Clients can access the care, experience and support of Integrative General Practitioners, Naturopaths, Psychologists, Acupuncturists, Physiotherapists, Health Coaches and more, all in one place. If needed the team of care providers work together to support the one patient, pooling valuable insights and solutions together.

Dr Igor Tabrizian is an integrative GP with a Functional Medicine approach. Working in hospital medicine for 14 years and then going into combined private and general practice specialising in nutritional medicine. He looks ay at inflammation, genetics, cytokines (inflammatory messages), gut microbiome, neurotransmitters, mineral and toxic metal levels, inflammatory markers, family history and life story when treating patients. He then prioritises which issues to remedy first and works through the solution(s) as needed. Dr Tabrizian specialises in supporting patients with ASD (Autism Spectrum Disorder), child behavioural issues, pre-conception nutrition, auto-immune disorders and inflammation.

We discussed pre conception nutrition and why it is so important for both partners and especially the mother to be well prepared and healthy before becoming pregnant, we touched of course on Covid-19 and unpacked some of the common childhood disorders and how many of these can be related to nutrition and inflammation. I had a wonderful time chatting with Dr Tabrizian and I am looking forward to picking his brain again in the future!

If you want to find out more about this episode and others like it, check out our website pbbmedia.org and we would love to hear from you! Did you enjoy this episode, have any comments, would love for us to cover a specific topic? Let us know through hello@pbbmedia.org or through our socials on Facebook, Twitter and Instagram, search for PBB Media.

More info about Dr Tabrizian and the Health Lodge can be found here www.thehealthlodge.com.au

Pre-recorded the week before and aired live on 99.9BayFM in Byron Bay, Australia on April 14th, 2020.

Produced, edited and presented by Annalee Atia for PBB Media
Guest: Dr Igor Tabrizian

All rights reserved.

www.pbbmedia.org

+

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>https://api.spreaker.com/episode/25877690Mon, 27 Apr 2020 20:00:06 +0000PBB Media IncorporatedHello there wonderful people, its Annalee from PBB, in this episode of Pregnancy, Birth and Beyond I am chatting with Dr Igor Tabrizian from the Byron Bay Health Lodge (in Australia). The Health Lodge takes a modern and advanced approach to...
The Health Lodge takes a modern and advanced approach to medicine and healthcare and provides meaningful continuity of care to its patients. Practitioners come with a holistic whole-person attitude to healthcare and work together as a team. Clients can access the care, experience and support of Integrative General Practitioners, Naturopaths, Psychologists, Acupuncturists, Physiotherapists, Health Coaches and more, all in one place. If needed the team of care providers work together to support the one patient, pooling valuable insights and solutions together.

Dr Igor Tabrizian is an integrative GP with a Functional Medicine approach. Working in hospital medicine for 14 years and then going into combined private and general practice specialising in nutritional medicine. He looks ay at inflammation, genetics, cytokines (inflammatory messages), gut microbiome, neurotransmitters, mineral and toxic metal levels, inflammatory markers, family history and life story when treating patients. He then prioritises which issues to remedy first and works through the solution(s) as needed. Dr Tabrizian specialises in supporting patients with ASD (Autism Spectrum Disorder), child behavioural issues, pre-conception nutrition, auto-immune disorders and inflammation.

We discussed pre conception nutrition and why it is so important for both partners and especially the mother to be well prepared and healthy before becoming pregnant, we touched of course on Covid-19 and unpacked some of the common childhood disorders and how many of these can be related to nutrition and inflammation. I had a wonderful time chatting with Dr Tabrizian and I am looking forward to picking his brain again in the future!

If you want to find out more about this episode and others like it, check out our website pbbmedia.org and we would love to hear from you! Did you enjoy this episode, have any comments, would love for us to cover a specific topic? Let us know through hello@pbbmedia.org or through our socials on Facebook, Twitter and Instagram, search for PBB Media.

More info about Dr Tabrizian and the Health Lodge can be found here www.thehealthlodge.com.au

Pre-recorded the week before and aired live on 99.9BayFM in Byron Bay, Australia on April 14th, 2020.

Produced, edited and presented by Annalee Atia for PBB Media
Guest: Dr Igor Tabrizian

All rights reserved.

www.pbbmedia.org

+

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>2131australianhealthcare,autismspectrumdisorder,birth,breastfeeding,childbirth,coronavirus,covid19,doctors,functionalmedicine,generalpractice,healthcare,integrativemedicine,maternitycare,mortherhood,nutrition,parenting,postnatal,preconception,pregnancy,wellbeingfalsefullLaura and Russell Brand on Joyful Creative Play and Conscious Birth Choiceshttps://www.spreaker.com/episode/laura-and-russell-brand-on-joyful-creative-play-and-conscious-birth-choices--25789460https://api.spreaker.com/episode/25789460Mon, 20 Apr 2020 05:32:13 +0000PBB Media IncorporatedOni Blecher interviews dynamic couple Laura and Russell Brand on the importance of play, creativity and making a fun mess while also discussing the deeper topics of birth politics, making conscious informed decisions for birth, parenting philosophy...3838birth,creativity,fatherhood,joy,laurabrand,love,motherhood,parenthood,pbbmedia,play,postnatal,postpartum,pregnancy,russellbrand,thejoyjournal,wellbeingfalsefullTreating the Cause. Dr. Greg Emerson on Immune and Fetal Healthhttps://www.spreaker.com/episode/treating-the-cause-dr-greg-emerson-on-immune-and-fetal-health--25124431https://api.spreaker.com/episode/25124431Thu, 09 Apr 2020 07:57:54 +0000PBB Media IncorporatedOni Blecher interviews Dr. Greg Emerson on his wealth of experience as an emergency medicine specialist come integrative doctor. He discusses building immunity, viral combative measures and how these measures affect healthy fetal growth, birth and...3307birth,fatherhood,immunty,integrative,integrativhealth,love,maternitycare,medicine,motherhood,pandemic,postnatal,postpartum,pregnancy,resilience,virusfalsefullBirth in Crisis with Jane Hardwicke Collingshttps://www.spreaker.com/episode/birth-in-crisis-with-jane-hardwicke-collings--24796285Together with a group of women, Jane has founded Hygieia Health, a not for profit dedicated to making such changes. They recently surveyed over 800 women and found that 80% are re-assessing their birth and maternity care options in the middle of this pandemic. Jane shares how we as a community must come together to adapt to meet the needs of women and babies, and the impact that this pandemic will have if we don't - particularly on mothers mental health.

Jane is the founder of The School of Shamanic Womancraft, has been a home birth midwife for over thirty years. and can be found at www.janehardwickecollings.com

This interview was recorded on Bundjalung country on Thursday 2 April, which must be acknowledged as much is changing daily during this pandemic. In adherence to social distancing, this interview was recorded virtually, and due to the current demand on these services, there are a few glitches and technical difficulties which we apologise for.

Contact information for this episode:
Mamatoto Support for Birth in Crisis Facebook Group: https://www.facebook.com/groups/205614144006691/

Hygieia Health: hygieia.health.2020@gmail.com

Jane Hardwicke Collings: jane@schoolofshamanicwomancraft.com

Kirilly Dawn: kirilly@pbbmedia.org]]>https://api.spreaker.com/episode/24796285Sat, 04 Apr 2020 01:49:17 +0000PBB Media IncorporatedJane Hardwicke Collings is fiercely rallying the birth community, as well as the community at large, to come together during this time of crisis to enact real and radical change in the care birthing women are receiving during the Coronavirus pandemic....Together with a group of women, Jane has founded Hygieia Health, a not for profit dedicated to making such changes. They recently surveyed over 800 women and found that 80% are re-assessing their birth and maternity care options in the middle of this pandemic. Jane shares how we as a community must come together to adapt to meet the needs of women and babies, and the impact that this pandemic will have if we don't - particularly on mothers mental health.

Jane is the founder of The School of Shamanic Womancraft, has been a home birth midwife for over thirty years. and can be found at www.janehardwickecollings.com

This interview was recorded on Bundjalung country on Thursday 2 April, which must be acknowledged as much is changing daily during this pandemic. In adherence to social distancing, this interview was recorded virtually, and due to the current demand on these services, there are a few glitches and technical difficulties which we apologise for.

Contact information for this episode:
Mamatoto Support for Birth in Crisis Facebook Group: https://www.facebook.com/groups/205614144006691/

Hygieia Health: hygieia.health.2020@gmail.com

Jane Hardwicke Collings: jane@schoolofshamanicwomancraft.com

Kirilly Dawn: kirilly@pbbmedia.org]]>2810birth,birthcentre,community,corona,coronavirus,health,homebirth,mamatoto,maternity,motherhood,pandemic,pregnancy,womenfalsefullGoing Local, Hope in a Time of Crisishttps://www.spreaker.com/episode/going-local-hope-in-a-time-of-crisis--24732018https://api.spreaker.com/episode/24732018Thu, 02 Apr 2020 04:28:28 +0000PBB Media IncorporatedOni Blecher speaks to Helena Norberg-Hodge about her work in bringing Ancient wisdom into our future projections by moving away from globalised capital into more localised economies and how this effects mothering, family and village living2283birth,ecenomy,father,helenanorberghodge,local,love,mother,parenting,postnatal,postpartum,pregnancyfalsefull17 Years and Counting: Homeschooling with Avalon Darneshhttps://www.spreaker.com/episode/17-years-and-counting-homeschooling-with-avalon-darnesh--24613094
In this show Sally talks with a very experienced homeschooling mum who has always worked at home as well.

Avalon Darnesh is a mother in a blended family with her partner Brett and together they have five children aged 7 to 17. Avalon also has a free offering she created five years ago about how parents can get their own goals met while your kids are at home: https://www.blossomingwoman.com.au/blog/get-shit-done

Also mentioned is Motherhood Mentor, Marion Rose: www.marionrose.net.

First aired live on 99.9BayFM in Byron Bay, Australia on 30 March 2020.

Produced and presented by Sally Cusack for PBB Media
Guest: Avalon Darnesh www.blossomingwoman.com.au

All rights reserved.

www.pbbmedia.org

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>https://api.spreaker.com/episode/24613094Mon, 30 Mar 2020 03:59:27 +0000PBB Media IncorporatedAs the reality of the extent of the impact of COVID-19 is sinking in, we’re seeing our lives change in ways we never thought would happen. Many schools are closing down their campuses and reverting to online learning, or preparing to do so. So...
In this show Sally talks with a very experienced homeschooling mum who has always worked at home as well.

Avalon Darnesh is a mother in a blended family with her partner Brett and together they have five children aged 7 to 17. Avalon also has a free offering she created five years ago about how parents can get their own goals met while your kids are at home: https://www.blossomingwoman.com.au/blog/get-shit-done

Also mentioned is Motherhood Mentor, Marion Rose: www.marionrose.net.

First aired live on 99.9BayFM in Byron Bay, Australia on 30 March 2020.

Produced and presented by Sally Cusack for PBB Media
Guest: Avalon Darnesh www.blossomingwoman.com.au

All rights reserved.

www.pbbmedia.org

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>2117homeschooling,motherhood,parenting,workingfromhomefalsefullMotherhood under the Big Top with Moira Campbellhttps://www.spreaker.com/episode/motherhood-under-the-big-top-with-moira-campbell--24007660
Moira's biggest lesson yet: that her body has an innate ability to heal itself.

So much in this conversation! Enjoy.

Moira can be found at: ascensionbyronbay.com.au

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2020
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia on 30 January 2019.

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2020
www.pbbmedia.org]]>https://api.spreaker.com/episode/24007660Mon, 23 Mar 2020 07:34:00 +0000PBB Media IncorporatedCircus aerialist and mother Moira Campbell shares with Sally her unique life journey full of vital lessons, from joining the circus, to meeting her husband Alex, packing up their life in London and moving to Byron Bay, healing from chronic illness and...
Moira's biggest lesson yet: that her body has an innate ability to heal itself.

So much in this conversation! Enjoy.

Moira can be found at: ascensionbyronbay.com.au

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2020
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia on 30 January 2019.

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2020
www.pbbmedia.org]]>2179circuslife,healingjourney,motherhood,parenthood,womanhoodfalsefullMedically Induced Menopause, a Positive Experience. With Farah Clerethttps://www.spreaker.com/episode/medically-induced-menopause-a-positive-experience-with-farah-cleret--23972244
Farah has a Degree and honours from Manchester University in Philosophy and Psychology and trained in Nutrition at the Institute of Optimum Nutrition in London, UK qualifying in 2002. She spent many years in private clinics and also at Higher Nature, a well known and highly respected UK supplement company advising clients on Nutritional Protocols, designing Practitioner Education Modules and contributing to the development of new products and formulas.

You can find out more about Farah and her work on www.farahcleret.net

You are tuned to Pregnancy, Birth & Beyond - Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes, Spotify and Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia on February 17th, 2020.

Produced and presented by Annalee Atia for PBB Media
Guest: Farah Claret

All rights reserved.

www.pbbmedia.org

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>https://api.spreaker.com/episode/23972244Tue, 17 Mar 2020 10:20:27 +0000PBB Media IncorporatedIn this episode of Pregnancy, Birth and Beyond, we are speaking with Farah Cleret, mother of two, Functional Nutritionist and recently diagnosed with cervical cancer. Post treatment, Farah went into medically induced menopause. Farah has a Degree...
Farah has a Degree and honours from Manchester University in Philosophy and Psychology and trained in Nutrition at the Institute of Optimum Nutrition in London, UK qualifying in 2002. She spent many years in private clinics and also at Higher Nature, a well known and highly respected UK supplement company advising clients on Nutritional Protocols, designing Practitioner Education Modules and contributing to the development of new products and formulas.

You can find out more about Farah and her work on www.farahcleret.net

You are tuned to Pregnancy, Birth & Beyond - Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes, Spotify and Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia on February 17th, 2020.

Produced and presented by Annalee Atia for PBB Media
Guest: Farah Claret

All rights reserved.

www.pbbmedia.org

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>1782birth,cancer,cervicalcancer,medicallyinducedmenopause,menopause,motherhood,parenting,perinatal,postnatal,pregnancy,womenshealthfalsefullChanging the System from the Inside Out with Midwife Sheree Stewarthttps://www.spreaker.com/episode/changing-the-system-from-the-inside-out-with-midwife-sheree-stewart--23778449
References:
Galingera Maternity Service, Sunshine Hospital, Melbourne Vic:
http://www.westernhealth.org.au/Services/Womens_and_Children/MaternityServices/Pages/Options-for-pregnancy-care.aspx

www.shereestewart.com.au

Me and White Supremacy www.laylafsaad.com

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2020
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia on 09/03/2020.

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>https://api.spreaker.com/episode/23778449Thu, 12 Mar 2020 06:30:20 +0000PBB Media IncorporatedSheree Stewart is an Aboriginal speaker, midwife, doula, published author, transpersonal art therapist and now a hot air balloon pilot! She is also a mother to six children and is the manager of the Koori Maternity Service at Sunshine Hospital in...
References:
Galingera Maternity Service, Sunshine Hospital, Melbourne Vic:
http://www.westernhealth.org.au/Services/Womens_and_Children/MaternityServices/Pages/Options-for-pregnancy-care.aspx

www.shereestewart.com.au

Me and White Supremacy www.laylafsaad.com

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2020
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia on 09/03/2020.

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>1795birth,continuityofcare,culturallyappropriatecare,decolonisingmaternitycare,examineyourprivilege,pregnancyfalsefullPsychotherapist Sean Tonnet on thirteen years of Fatherhoodhttps://www.spreaker.com/episode/psychotherapist-sean-tonnet-on-thirteen-years-of-fatherhood--23306183
Produced and presented by Oni Blecher
Copyright PBB Media and Oni Blecher 2020
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia in December 2019.

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>https://api.spreaker.com/episode/23306183Sat, 29 Feb 2020 01:44:43 +0000PBB Media IncorporatedSean Tonnet, Psychologist, father and contributor for Pregnancy, Birth and Beyond speaks to his experience as a father so far with deep psychological insight. Sean was once the prime ministers bodyguard before moving from the city to the Northern...
Produced and presented by Oni Blecher
Copyright PBB Media and Oni Blecher 2020
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia in December 2019.

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>2037beyond,birth,childpsychology,fatherhood.,motherhood,parenthood,parentpscyhology,pbbm,pregnancy,psychologyfalsefullTalking to our Kids about Racism with Robin DiAngelo, PhDhttps://www.spreaker.com/episode/talking-to-our-kids-about-racism-with-robin-diangelo-phd--22825617
In this show we will be examining the most fundamental of our social fractures, racism, racial inequality, your role in it, and what you can do as a parent or someone who spends time with children can do about it.

Note: Robin participated in this interview from her home in Seattle, Washington and acknowledged the traditional owners of that land, the Duwamish people. She pays rent to the Duwamish people under this scheme: https://www.realrentduwamish.org/

References:
www.robindiangelo.com

Me and White Supremacy www.laylafsaad.com

Ibram X Kendi, PhD: https://www.ibramxkendi.com/

Racial bias in pain assessment and treatment recommendations, and false beliefs about biological differences between blacks and whites
https://www.ncbi.nlm.nih.gov/pubmed/27044069

Bias at the intersection of race and gender: Evidence from preschool‐aged children https://onlinelibrary.wiley.com/doi/abs/10.1111/desc.12788

Resources for parents and more: https://robindiangelo.com/resources/

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2020
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia on 03/02/2020.

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>https://api.spreaker.com/episode/22825617Wed, 12 Feb 2020 04:51:00 +0000PBB Media IncorporatedFor more than two decades Dr Robin DiAngelo, a white mother, childbirth educator turned racial and social justice educator and author of White Fragility from Seattle, Washington in the US has been examining how from her birth onwards, she...
In this show we will be examining the most fundamental of our social fractures, racism, racial inequality, your role in it, and what you can do as a parent or someone who spends time with children can do about it.

Note: Robin participated in this interview from her home in Seattle, Washington and acknowledged the traditional owners of that land, the Duwamish people. She pays rent to the Duwamish people under this scheme: https://www.realrentduwamish.org/

References:
www.robindiangelo.com

Me and White Supremacy www.laylafsaad.com

Ibram X Kendi, PhD: https://www.ibramxkendi.com/

Racial bias in pain assessment and treatment recommendations, and false beliefs about biological differences between blacks and whites
https://www.ncbi.nlm.nih.gov/pubmed/27044069

Bias at the intersection of race and gender: Evidence from preschool‐aged children https://onlinelibrary.wiley.com/doi/abs/10.1111/desc.12788

Resources for parents and more: https://robindiangelo.com/resources/

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2020
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia on 03/02/2020.

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>2533parenting,racism,whitefragility,whiteprivilege,whitesupremacyfalsefullDying as a rite of passagehttps://www.spreaker.com/episode/dying-as-a-rite-of-passage--22676009
Interviewed guest: Zenith Virago

Produced and presented by Oni Blecher
Copyright PBB Media, Oni Blecher and Zenith Virago 2020

First aired on 99.9 BayFM Byron Bay Australia on 27th January 2020.

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.

www.pbbmedia.org]]>https://api.spreaker.com/episode/22676009Wed, 05 Feb 2020 02:35:00 +0000PBB Media IncorporatedZenith Virago is a woman grounded in the gifts of understanding the nuances of humanity and the basic need for people to mark important times in their lives with sacredness. Zenith serves those traveling through birth, marriage and death. Highly...
Interviewed guest: Zenith Virago

Produced and presented by Oni Blecher
Copyright PBB Media, Oni Blecher and Zenith Virago 2020

First aired on 99.9 BayFM Byron Bay Australia on 27th January 2020.

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.

www.pbbmedia.org]]>1898birth,death,deathwalker,firstnation,parenting,pbbmedia,postpartum,pregnancy,rite,riteofpassagefalsefullFrom Doctor to Doula: Reclaiming Your Magic with Dr Danielle Arabenahttps://www.spreaker.com/episode/from-doctor-to-doula-reclaiming-your-magic-with-dr-danielle-arabena--22759438
Produced and presented by Kirilly Dawn
Copyright PBB Media and Kirilly Dawn 2020
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia on 20/01/2020.

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>https://api.spreaker.com/episode/22759438Tue, 28 Jan 2020 14:09:00 +0000PBB Media IncorporatedDr Danielle Arabena is a mother, General Practitioner, Shamanic Healer and Doula of Torres Strait Islander descent. In this interview with Kirilly Dawn, Dr Danielle speaks about her journey as a Healer, from navigating the medical field, to ultimately...
Produced and presented by Kirilly Dawn
Copyright PBB Media and Kirilly Dawn 2020
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia on 20/01/2020.

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>3551birth,doctor,doula,healer,health,indigenous,motherhood,pregnancy,witchfalsefullIdentical Twins: Nature or Nurture?https://www.spreaker.com/episode/identical-twins-nature-or-nurture--21935449
In the last part of the show midwife Dr Robyn Thompson explains how best to support mothers immediately after birth and in the weeks after.

Our thanks to Craig Jones (www.moogoo.com.au) and Dr Robyn Thompson (www.thethompsonmethod.com)

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2020
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia on 6 January 2020.

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>https://api.spreaker.com/episode/21935449Wed, 22 Jan 2020 03:07:00 +0000PBB Media IncorporatedIf we raise two genetically identical individuals in exactly the same way will they turn out to have similar personalities? Craig Jones speaks with Sally about his experiences as a father of twin girls and a third daughter and what he's learned about...
In the last part of the show midwife Dr Robyn Thompson explains how best to support mothers immediately after birth and in the weeks after.

Our thanks to Craig Jones (www.moogoo.com.au) and Dr Robyn Thompson (www.thethompsonmethod.com)

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2020
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia on 6 January 2020.

+++++++++++

This episode is sponsored by MooGoo Skin Care. www.moogoo.com.au.

For a limited time our listeners can get a 15% discount on online purchases by quoting the code PBBPODCAST.]]>1630fatherhood,identicaltwins,parenting,postnatalfalsefullMason and Tahnee from Superfeast on reproductive and pre conception healthhttps://www.spreaker.com/episode/mason-and-tahnee-from-superfeast-on-reproductive-and-pre-conception-health--22109728https://api.spreaker.com/episode/22109728Fri, 29 Nov 2019 00:00:00 +0000PBB Media IncorporatedOni Blecher interviews Mason and Tahnee from tonic and medicinal mushroom company Superfeast speak to reproductive and preconception health as well as their own enlightenments and lessons from their journeys in parenthood. With their wealth of...1926birth,health,parenting,preconception,pregnancy,reproduction,reproductivehealth,superfeast,taoistfalsefullThe latest Australian Research on Homebirth with Dr Melanie Jacksonhttps://www.spreaker.com/episode/the-latest-australian-research-on-homebirth-with-dr-melanie-jackson--20165631
Find out more about Dr Jackson's work at www.melaniethemidwife.com and on YouTube under - Melanie The Midwife.

The Maternal and perinatal outcomes by planned place of birth in Australia 2000 – 2012: a linked population data study can be found here https://bmjopen.bmj.com/content/9/10/e029192

You are tuned to Pregnancy, Birth & Beyond. Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes and Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia on November 4th, 2019.
Produced and hosted by Annalee Atia for PBB Media
Guest: Dr Melanie Jackson

All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/20165631Thu, 21 Nov 2019 21:18:47 +0000PBB Media IncorporatedIn this episode of Pregnancy, Birth and Beyond, we are speaking with Dr Melanie Jackson, also lovingly known as Melanie the Midwife. We're discussing the latest in Australian Homebirth Research, Continuity of Maternity Care and also, why women choose...
Find out more about Dr Jackson's work at www.melaniethemidwife.com and on YouTube under - Melanie The Midwife.

The Maternal and perinatal outcomes by planned place of birth in Australia 2000 – 2012: a linked population data study can be found here https://bmjopen.bmj.com/content/9/10/e029192

You are tuned to Pregnancy, Birth & Beyond. Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes and Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia on November 4th, 2019.
Produced and hosted by Annalee Atia for PBB Media
Guest: Dr Melanie Jackson

All rights reserved.

www.pbbmedia.org]]>1670australianhealthcare,babies,birth,childbirth,continuityofcare,freebirth,homebirth,maternitycare,midwifery,midwiferycontinuityofcare,motherhood,parenting,perinatal,postnatal,preconception,pregnancy,researchfalsefullThe Importance of Health & Wellness for Dadshttps://www.spreaker.com/episode/the-importance-of-health-wellness-for-dads--20017870
Download or stream now!]]>https://api.spreaker.com/episode/20017870Thu, 14 Nov 2019 01:16:25 +0000PBB Media IncorporatedVery excited to have super dad and wellness guru Horst Tomsan from Knox and Aya join our presenter Sean Tonnet on this podcast. With summer on our doorstep, there is never a better time to think about our health and well-being. Obesity now impacts...
Download or stream now!]]>1671fathering,fitness,health,horsttomsan,obesity,parent,seantonnet,welnnessfalsefullTravelling through Menopause with Moana Pearlhttps://www.spreaker.com/episode/travelling-through-menopause-with-moana-pearl--19903968
Find Moana on https://sacredwisewoman.com.au/about-moana-pearl/

First aired on 99.9 BayFM, Byron Bay Australia on 28 October 2019.

++++++

Copyright PBB Media 2019
Produced and presented by Oni Blecher]]>https://api.spreaker.com/episode/19903968Thu, 07 Nov 2019 10:48:34 +0000PBB Media IncorporatedOni Blecher speaks with Moana Pearl, a multi modal transformational facilitator who and has been involved in sacred women’s business and women’s spirituality for more than 25 years. Moana helps us understand the individual and collective rite of peri...
Find Moana on https://sacredwisewoman.com.au/about-moana-pearl/

First aired on 99.9 BayFM, Byron Bay Australia on 28 October 2019.

++++++

Copyright PBB Media 2019
Produced and presented by Oni Blecher]]>1640menopause,perimenopause,ritesofpassage,womanhoodfalsefullAccessing the Mother you Want to be with Jessie Harroldhttps://www.spreaker.com/episode/accessing-the-mother-you-want-to-be-with-jessie-harrold--19665763
Oni Blecher presents this episode in which Jessie speaks with PBB presenter Kirilly Dawn. Jessie discusses the immense transition that is motherhood, what it takes to ease that transition and the support required for it. She also covers the themes of matrescence and patrescence.

www.jessieharrold.com

First aired on 99.9 BayFM Byron Bay Australia on 14 October 2019.

Produced and presented by Oni Blecher
Copyright PBB Media, Kirilly Dawn and Oni Blecher 2019.
www.pbbmedia.org]]>https://api.spreaker.com/episode/19665763Thu, 24 Oct 2019 09:49:05 +0000PBB Media IncorporatedJessie Harrold is a doula, coach, women’s mentor, author of the recent book Project Body Love and her upcoming title, MotherSHIFT. Jessie’s work centres around supporting women to connect with themselves, their community and the earth during radical...
Oni Blecher presents this episode in which Jessie speaks with PBB presenter Kirilly Dawn. Jessie discusses the immense transition that is motherhood, what it takes to ease that transition and the support required for it. She also covers the themes of matrescence and patrescence.

www.jessieharrold.com

First aired on 99.9 BayFM Byron Bay Australia on 14 October 2019.

Produced and presented by Oni Blecher
Copyright PBB Media, Kirilly Dawn and Oni Blecher 2019.
www.pbbmedia.org]]>1888birth,motherhood,postnatal,pregnancyfalsefullInspiring Childhood Education with Jane Hanckelhttps://www.spreaker.com/episode/inspiring-childhood-education-with-jane-hanckel--19663189
You are tuned to Pregnancy, Birth & Beyond. Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes and Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia in 2019.
Produced and hosted by Annalee Atia for PBB Media
Guest: Jane Hanckel

All rights reserved.

www.inspirededucation.com.au
https://www.pozible.com/project/meaningful-values-the-inspired-app

www.pbbmedia.org]]>https://api.spreaker.com/episode/19663189Thu, 24 Oct 2019 06:15:32 +0000PBB Media IncorporatedIn this episode of Pregnancy, Birth and Beyond, we are speaking with Jane Hanckel, a long standing passionate social entrepreneur. Jane has had a passion for childhood education and supporting the health of families and communities that started early...
You are tuned to Pregnancy, Birth & Beyond. Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes and Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia in 2019.
Produced and hosted by Annalee Atia for PBB Media
Guest: Jane Hanckel

All rights reserved.

www.inspirededucation.com.au
https://www.pozible.com/project/meaningful-values-the-inspired-app

www.pbbmedia.org]]>2299birth,childhood,education,film,health,motherhood,parenting,pbbmedia,podcast,postpartum,pregnancyfalsefullBecoming Dad: A Guide for New Fathershttps://www.spreaker.com/episode/becoming-dad-a-guide-for-new-fathers--19137696
On this show PBB special guest Simon Hall, a highly experienced and regarded Child and Family worker, brings his specialised work with dads and dads-to-be onto the airwaves, sharing his wisdom and experience with presenter Sean Tonnet.]]>https://api.spreaker.com/episode/19137696Wed, 18 Sep 2019 11:31:29 +0000PBB Media IncorporatedThe transition to fatherhood is a physical, emotional, psychological and spiritual journey. It has the capacity to transform men and have an impact on their lives and their future in many ways. It challenges men to redefine themselves as individuals,...
On this show PBB special guest Simon Hall, a highly experienced and regarded Child and Family worker, brings his specialised work with dads and dads-to-be onto the airwaves, sharing his wisdom and experience with presenter Sean Tonnet.]]>1671becomingdad,fatherhood,seantonnetfalsefullInfant Sleep... and The Art and the Science of Raising a Boyhttps://www.spreaker.com/episode/infant-sleep-and-the-art-and-the-science-of-raising-a-boy--19008765
As a biologist Katharina applied her scientific knowledge, as well as her own intuition, to each stage of raising her son. Their family is now living in northern Sweden and Katharina's son, Jann Billker, now 15, spends as much time as he can in Swedish Lapland a further 6 hours north. There Jann is working with the Alaskan Husky dogs at Lapland Wilderness Tours where he is also honing his skills as a photographer and of course learning another language. Who knows where this unique collection of life experiences will take him!

https://www.researchgate.net/profile/Katharina_Wulff
http://www.laplandwildernesstours.com/

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2019
www.pbbmedia.org

Our thanks to Dr Katharina Wulff.

First aired on 99.9 BayFM Byron Bay Australia on 26 August 2019.]]>https://api.spreaker.com/episode/19008765Thu, 05 Sep 2019 08:43:40 +0000PBB Media IncorporatedSally speaks with biologist and infant sleep expert Dr Katharina Wulff about huge variations in infant sleep, cultural expectations we have regarding infant sleep, and how accepting the immense variability in their sleep and instead learning about...
As a biologist Katharina applied her scientific knowledge, as well as her own intuition, to each stage of raising her son. Their family is now living in northern Sweden and Katharina's son, Jann Billker, now 15, spends as much time as he can in Swedish Lapland a further 6 hours north. There Jann is working with the Alaskan Husky dogs at Lapland Wilderness Tours where he is also honing his skills as a photographer and of course learning another language. Who knows where this unique collection of life experiences will take him!

https://www.researchgate.net/profile/Katharina_Wulff
http://www.laplandwildernesstours.com/

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2019
www.pbbmedia.org

Our thanks to Dr Katharina Wulff.

First aired on 99.9 BayFM Byron Bay Australia on 26 August 2019.]]>2076drkatharinawulff,infantsleep,parenting,postnatalfalsefull52 Weeks Ep. 1: Conception to pregnancy with Kimberley Lipschushttps://www.spreaker.com/episode/52-weeks-ep-1-conception-to-pregnancy-with-kimberley-lipschus--18986934Produced by Lara Martin]]>https://api.spreaker.com/episode/18986934Tue, 03 Sep 2019 09:44:58 +0000PBB Media IncorporatedWeek 1: Beginning the journey to parenting starts with conception. Conception is about having fun. Here Kimberley Lipschus, Psychotherapist, story teller and film maker shares with you connecting as a couple preparing and conceiving for pregnancy....Produced by Lara Martin]]>243birth,conception,consciousconception,fertility,pbbmedia,preconsception,pregnancyfalsefull52 Weeks Ep. 2: Prepare for parenting with Kimberley Lipschushttps://www.spreaker.com/episode/52-weeks-ep-2-prepare-for-parenting-with-kimberley-lipschus--18986858Produced by Lara Martin]]>https://api.spreaker.com/episode/18986858Tue, 03 Sep 2019 09:42:37 +0000PBB Media IncorporatedWeek 2: This episode psychotherapist, film maker and story teller talks, Kimberley Lipschus shares practical ways you and your partner can prepare for parenting so that you are on the same page, even before pregnancy. Connect with Kimberley at...Produced by Lara Martin]]>278parenting,pbbmediafalsefull52 Weeks Ep. 3: When a baby comes along so do relationship changes with Sean Tonnethttps://www.spreaker.com/episode/52-weeks-ep-3-when-a-baby-comes-along-so-do-relationship-changes-with-sean-tonnet--18986840Week 3: This episode Sean Tonnet, relationship therapist talks on relationships. Expect changes and build support; communicate and share thoughts before the birth about your relationship now there is three (or more!). Connect with Sean at seantonnet.com.au
Produced by Lara Martin]]>https://api.spreaker.com/episode/18986840Tue, 03 Sep 2019 09:40:32 +0000PBB Media IncorporatedImportance points of Relationships health Week 3: This episode Sean Tonnet, relationship therapist talks on relationships. Expect changes and build support; communicate and share thoughts before the birth about your relationship now there is three (or...Week 3: This episode Sean Tonnet, relationship therapist talks on relationships. Expect changes and build support; communicate and share thoughts before the birth about your relationship now there is three (or more!). Connect with Sean at seantonnet.com.au
Produced by Lara Martin]]>196dad,fatherhood,parenting,pbbmedia,relationshipsfalsefull52 Weeks Ep. 4: Birth story with Anniehttps://www.spreaker.com/episode/52-weeks-ep-4-birth-story-with-annie--18986808https://api.spreaker.com/episode/18986808Tue, 03 Sep 2019 09:35:47 +0000PBB Media IncorporatedWeek 4: Birth story with Annie Byrant353birthstory,childbirth,homebirth,naturalbirth,pbbmediafalsefull52 Weeks Ep. 5: Birth story with Nataliehttps://www.spreaker.com/episode/52-weeks-ep-5-birth-story-with-natalie--18986859https://api.spreaker.com/episode/18986859Tue, 03 Sep 2019 09:26:32 +0000PBB Media IncorporatedWeek 5: birth story with Natalie.235conception,pbbmedia,pregnancyfalsefull52 Weeks Ep. 6: What is the safest form of maternity care? What are my rights in birth? with Sally Cusackhttps://www.spreaker.com/episode/52-weeks-ep-6-what-is-the-safest-form-of-maternity-care-what-are-my-rights-in-birth-with-sally-cusack--18986678
In this episode we will look at the quality of Respect for your rights to bodily autonomy and informed decision making. pbbmedia.org]]>https://api.spreaker.com/episode/18986678Tue, 03 Sep 2019 09:02:52 +0000PBB Media IncorporatedWeek 6: Part 1 of 4 episodes on informed decision making in maternity care; What is the safest form of maternity care? What are my rights in birth? By Sally Cusack. While there are no guarantees in life, including birth, these qualities are crucial...
In this episode we will look at the quality of Respect for your rights to bodily autonomy and informed decision making. pbbmedia.org]]>211falsefull52 Weeks Ep. 7: Am I allowed? with Sally Cusackhttps://www.spreaker.com/episode/52-weeks-ep-7-am-i-allowed-with-sally-cusack--18986677https://api.spreaker.com/episode/18986677Tue, 03 Sep 2019 09:01:02 +0000PBB Media IncorporatedWeek 7: Part 2 of 4 episodes on informed decision making in maternity care; Am I allowed, with Sally Cusack. When you are pregnant your unborn baby has no separate legal rights to you. You hold the responsibility for making the decisions for the two...222birth,birthrights,informedconcent,knowyourrights,maternityadvocacy,pbbmedia,pregnancyfalsefull52 Weeks Ep. 8: How Knowing your Carer Leads to Optimal Birthing with Sally Cusackhttps://www.spreaker.com/episode/52-weeks-ep-8-how-knowing-your-carer-leads-to-optimal-birthing-with-sally-cusack--18986672https://api.spreaker.com/episode/18986672Tue, 03 Sep 2019 08:57:35 +0000PBB Media IncorporatedWeek 8: Part 3 of 4 episode on informed decision making in maternity care: How Knowing your Carer Leads to Optimal Birthing with Sally Cusack. In all areas of health, the best outcomes are achieved when you have continuous care with the same clinician...228falsefull52 Weeks Ep. 9: Choosing your maternity carer with Sally Cusackhttps://www.spreaker.com/episode/52-weeks-ep-9-choosing-your-maternity-carer-with-sally-cusack--18986671There are a range of maternity care options available in Australia including private obstetric care, GP care that is shared with the local hospital, care provided by a team of midwives under the supervision of hospital obstetricians, and private or public midwifery led continuity of care. With all those choices, which is the safest one to choose? pbbmedia.org]]>https://api.spreaker.com/episode/18986671Tue, 03 Sep 2019 08:55:00 +0000PBB Media IncorporatedWeek 9: Part 4 or 4 episodes on informed decision making in maternity care; Choosing your maternity carer, with Sally Cusack co-founder of PBBmedia, maternity advocate and mother talks on your rights in childbirth. There are a range of maternity care...There are a range of maternity care options available in Australia including private obstetric care, GP care that is shared with the local hospital, care provided by a team of midwives under the supervision of hospital obstetricians, and private or public midwifery led continuity of care. With all those choices, which is the safest one to choose? pbbmedia.org]]>221birth,homebirth,hospitalbirth,informedconsent,naturalbirth,pbbmedia,pregnancy,rightsinchildbirthfalsefull52 Weeks Ep. 10: Continuity of midwifery care with Ti Harrisonhttps://www.spreaker.com/episode/52-weeks-ep-10-continuity-of-midwifery-care-with-ti-harrison--18986666https://api.spreaker.com/episode/18986666Tue, 03 Sep 2019 08:51:23 +0000PBB Media IncorporatedWeek 10: Are you wondering what model of care you want for your pregnancy, heard of case load or continuity midwifery? Ti Harrison, midwife of 30 years shares with you what it is like as a midwife to work in a continuity case load model of care.246birth,caseloadmidwifery,continutity,midwifery,natural,naturalbirth,pbbmediafalsefull52 Weeks Ep. 11: Tuning into your relationship before baby comes with Kimberley Lipschushttps://www.spreaker.com/episode/52-weeks-ep-11-tuning-into-your-relationship-before-baby-comes-with-kimberley-lipschus--18986639https://api.spreaker.com/episode/18986639Tue, 03 Sep 2019 08:48:53 +0000PBB Media IncorporatedWeek 11: Kimberley takes a closer look at relationships. Tuning in and tuning up before baby comes along.217baby,pbbmedia,pregnancyfalsefull52 Weeks Ep. 12: Same page parenting with Kimberley Lipschushttps://www.spreaker.com/episode/52-weeks-ep-12-same-page-parenting-with-kimberley-lipschus--18986635https://api.spreaker.com/episode/18986635Tue, 03 Sep 2019 08:45:56 +0000PBB Media IncorporatedWeek 12: This episode psychotherapist, film maker and story teller talks, Kimberley Lipschus shares practical ways you and your partner can prepare for parenting so that you are on the same page, even before pregnancy. Connect with Kimberley at...225mothering,parenting,pbbmediafalsefull52 Weeks Ep. 13: What is imprinting with Dr Holly Goldberghttps://www.spreaker.com/episode/52-weeks-ep-13-what-is-imprinting-with-dr-holly-goldberg--18986633https://api.spreaker.com/episode/18986633Tue, 03 Sep 2019 08:42:24 +0000PBB Media IncorporatedWeek 13: Have you heard of the therm imprinting? Dr Holly Goldberg explains how imprinting on the newborn is formed.What is interesting about this episode is that, even if early trauma is unavoidable, healing and repair is always possible. Connect...268imprintingnewborn,limbic,pbbmedia,pregnancyfalsefull52 Weeks Ep. 14: What worked for me in labour and birth with Annalee Atiahttps://www.spreaker.com/episode/52-weeks-ep-14-what-worked-for-me-in-labour-and-birth-with-annalee-atia--18985547https://api.spreaker.com/episode/18985547Tue, 03 Sep 2019 06:18:28 +0000PBB Media IncorporatedWeek 14: Three key things that supported me in labour with Annalee.285falsefull52 Weeks Ep. 15: Birth story with Meggiehttps://www.spreaker.com/episode/52-weeks-ep-15-birth-story-with-meggie--18985544https://api.spreaker.com/episode/18985544Tue, 03 Sep 2019 06:17:06 +0000PBB Media IncorporatedWeek 15: Becoming a mum with Meggie.229falsefull52 Weeks Ep. 16: Prenatal yoga with Emma Granthttps://www.spreaker.com/episode/52-weeks-ep-16-prenatal-yoga-with-emma-grant--18985378https://api.spreaker.com/episode/18985378Tue, 03 Sep 2019 05:37:40 +0000PBB Media IncorporatedWeek 16: We all the importance of keeping maintaining fitness during pregnancy. Prenatal yoga is one way millions of pregnant women around the globe stay healthy, fit and flexible in preparation for having a baby. Here we hear from Emma Grant of Red...22452weeks,naturalbirth,pbbmedia,prenatalyoga,redtentyogafalsefull52 Weeks Ep. 17: Movement in pregnancy with Maha Al Musahttps://www.spreaker.com/episode/52-weeks-ep-17-movement-in-pregnancy-with-maha-al-musa--18985351https://api.spreaker.com/episode/18985351Tue, 03 Sep 2019 05:23:51 +0000PBB Media IncorporatedWeek 17: Maha Al Musa founder of Embodied birth and belly dance for birth since 1997, share with you the importance of prenatal movement as preparation for autonomous birth. Maha says The living book is within, read her. Connect with Maha at...236birth,hospitalbirth,mahaalmusa,naturalbirth,pbbmediafalsefull52 Weeks Ep. 18: At birth with Paul; birth storyhttps://www.spreaker.com/episode/52-weeks-ep-18-at-birth-with-paul-birth-story--18985321https://api.spreaker.com/episode/18985321Tue, 03 Sep 2019 05:13:23 +0000PBB Media IncorporatedWeek 18: Paul on becoming a father. Paul shares his role and experience as a man/ partner during the antenatal period. Paul say, he came out of it with a huge appreciation for the human experience. Paul also shares how is was able to support his...227birth,homebirth,naturalbirth,pbbmedia,spiritualbirthfalsefull52 Weeks Ep. 19: Becoming a dad with Sean Tonnethttps://www.spreaker.com/episode/52-weeks-ep-19-becoming-a-dad-with-sean-tonnet--18985256https://api.spreaker.com/episode/18985256Tue, 03 Sep 2019 05:05:02 +0000PBB Media IncorporatedWeek 19: This episode relationship therapist Sean Tonnet talks on becoming your best self as a dad. Connect with Sean at seantonnet.com.au239birth,dadbirthstory,fatherhoodfalsefull52 Weeks Ep. 20: Your changing role and identity in becoming a parent/ father with Sean Tonnethttps://www.spreaker.com/episode/52-weeks-ep-20-your-changing-role-and-identity-in-becoming-a-parent-father-with-sean-tonnet--18985297Produced by Lara Martin]]>https://api.spreaker.com/episode/18985297Tue, 03 Sep 2019 05:04:37 +0000PBB Media IncorporatedWeek 20: This episode relationship therapist Sean Tonnet talks on dads and partners supporting their partner during pregnancy and beyond. Connect with Sean at seantonnet.com.au Produced by Lara MartinProduced by Lara Martin]]>209becomingadad,birth,fatherhood,parentingfalsefull52 Weeks Ep. 21:Birth story on becoming a dad and role of the father/ partner in birth with Paulhttps://www.spreaker.com/episode/52-weeks-ep-21-birth-story-on-becoming-a-dad-and-role-of-the-father-partner-in-birth-with-paul--18985218Produced by Lara Martin]]>https://api.spreaker.com/episode/18985218Tue, 03 Sep 2019 04:48:16 +0000PBB Media IncorporatedWeek 21: Paul, on becoming a father. Here Paul shares with you how he was able to support his partner through labour and birth to becoming a dad. Produced by Lara MartinProduced by Lara Martin]]>237birth,dadsbirthstory,fathersatbirth,homebirthfalsefull52 Weeks Ep. 22: Birth the great humbling; birth story with Annie Byranthttps://www.spreaker.com/episode/52-weeks-ep-22-birth-the-great-humbling-birth-story-with-annie-byrant--18985139https://api.spreaker.com/episode/18985139Tue, 03 Sep 2019 04:34:27 +0000PBB Media IncorporatedWeek 22: Annie Byrant, storyteller and mother shares her story of maiden to mother. Connect with Annie at talesandsongs.com353birth,homebirth,naturalbirth,pbbmediafalsefull52 Weeks Ep. 23: What is a doula with Anna Wattshttps://www.spreaker.com/episode/52-weeks-ep-23-what-is-a-doula-with-anna-watts--18985097https://api.spreaker.com/episode/18985097Tue, 03 Sep 2019 04:17:50 +0000PBB Media IncorporatedWeek 23: Anna Watts founder of Celebration of Birth Doula Academy, talks on doula's and their role, what you can expect from a doula. Connect with Anna celebrationofbirth.com198birthdoula,childbirth,doula,naturalbirth,pbbmediafalsefull52 Weeks Ep. 24: Doula tips for labour and birth with Nataliehttps://www.spreaker.com/episode/52-weeks-ep-24-doula-tips-for-labour-and-birth-with-natalie--18985065https://api.spreaker.com/episode/18985065Tue, 03 Sep 2019 04:11:26 +0000PBB Media IncorporatedWeek 24: Is there a magic formula to a great birth? The answer is unfortunately no, yet there are a number of ways you can prepare and things you can do in labour and birth for a greater likelihood of a physiological birth or a birth that you feel...251falsefull52 Weeks Ep. 25: Positive hospital birth story with Erinhttps://www.spreaker.com/episode/52-weeks-ep-25-positive-hospital-birth-story-with-erin--18985029https://api.spreaker.com/episode/18985029Tue, 03 Sep 2019 03:58:45 +0000PBB Media IncorporatedWeek 25: Erin, mother of two shares with you her two birth stories, what she learnt from her first experience and what she did differently the second time round for a more positive birth.273birth,hospitalbirth,natutalbirthinhospital,pregnancyfalsefull52 Weeks Ep. 26: From disempowered to empowered; birth story with Martina Driftwoodhttps://www.spreaker.com/episode/52-weeks-ep-26-from-disempowered-to-empowered-birth-story-with-martina-driftwood--18984904www.facebook.com/birthinnaturesarms]]>https://api.spreaker.com/episode/18984904Tue, 03 Sep 2019 03:26:22 +0000PBB Media IncorporatedWeek 26: Mother of two and hypno-birthing childbirth educator shares her journey from disempowered to empowered birth. Connect with Martin at www.facebook.com/birthinnaturesarmswww.facebook.com/birthinnaturesarms]]>218babies,birth,naturalbirth,pregnancyfalsefull52 Weeks Ep. 27: Mindfulness for birth with Virginia Bobrohttps://www.spreaker.com/episode/52-weeks-ep-27-mindfulness-for-birth-with-virginia-bobro--18984809https://api.spreaker.com/episode/18984809Tue, 03 Sep 2019 03:02:28 +0000PBB Media IncorporatedWeek 27: Virginia Bobro on mindfulness during pregnancy. Virginia goes on to discuss Rigidity vs flexibility in birth preparation and post birth. Noticing your own thoughts, fears and patterns of avoidance in relation to beliefs about what it is to...334birth,naturalbirth,pregnancyfalsefull52 Weeks Ep. 28: Water immersion for labour and birth with midwife Bronwyn Moirhttps://www.spreaker.com/episode/52-weeks-ep-28-water-immersion-for-labour-and-birth-with-midwife-bronwyn-moir--18984765Water birth isn't a modern invention, as early as 1805 the first water birth was recorded in a French medial journal. Later in the 1960's and 70's water birth started to reemerge in Europe and the western world. Today, most hospitals have the facility for water immersion and water birth. And the great thing is you get to decided if that is an option for you. Connect with Bronwyn at holisticmidwifery.com.au]]>https://api.spreaker.com/episode/18984765Tue, 03 Sep 2019 02:52:25 +0000PBB Media IncorporatedWeek 28. You maybe starting to think more about the kind of birth experience you want and what your options are. Here we hear from endorsed midwife Bronwyn Moir on water birth. Water birth isn't a modern invention, as early as 1805 the first water...Water birth isn't a modern invention, as early as 1805 the first water birth was recorded in a French medial journal. Later in the 1960's and 70's water birth started to reemerge in Europe and the western world. Today, most hospitals have the facility for water immersion and water birth. And the great thing is you get to decided if that is an option for you. Connect with Bronwyn at holisticmidwifery.com.au]]>263baby,birth,naturalbirh,pregnancy,waterbirthfalsefull52 Weeks Ep. 29: Feeling the fear and doing it anyway with Maha Al Musahttps://www.spreaker.com/episode/52-weeks-ep-29-feeling-the-fear-and-doing-it-anyway-with-maha-al-musa--18982933https://api.spreaker.com/episode/18982933Mon, 02 Sep 2019 21:17:57 +0000PBB Media IncorporatedWeek 29: Worry, fear, concerns, it is a normal part of any pregnancy or upcoming birth. Maha Al Musa founder of Embodied Birth shares with you a simple yet effective practice to examine your fears about birth. Feeling the fear and doing it anyway....210childbirth,fearofbirth,mahaalmusa,naturalbirthfalsefull52 Weeks Ep. 30: Using your breath in labour and birth with Martina Driftwoodhttps://www.spreaker.com/episode/52-weeks-ep-30-using-your-breath-in-labour-and-birth-with-martina-driftwood--18982878If you haven't guessed it already, it's using your breath. Breath awareness and practices date back centuries, women all over the globe instinctually use their breath to help them in labour and to birth their baby.

Here Hypno-birthing childbirth educator Martina, shares with you three different breathing techniques for labour and birth. Connect with Martina at facebook.com/birthinnaturesarms]]>https://api.spreaker.com/episode/18982878Mon, 02 Sep 2019 21:08:15 +0000PBB Media IncorporatedWeek 30: One of the key tools for labour and birth is completely within you, you already know how to do it, plus it is scientifically proven to reduce stress and induce relaxation by activating the parasympathetic nervous system. If you haven't...If you haven't guessed it already, it's using your breath. Breath awareness and practices date back centuries, women all over the globe instinctually use their breath to help them in labour and to birth their baby.

Here Hypno-birthing childbirth educator Martina, shares with you three different breathing techniques for labour and birth. Connect with Martina at facebook.com/birthinnaturesarms]]>248childbirth,hypnobirthing,naturalbirthfalsefull52 Weeks Ep. 31: Birth story - 3 key elements to make your birth a positive one with Annalee Atiahttps://www.spreaker.com/episode/52-weeks-ep-31-birth-story-3-key-elements-to-make-your-birth-a-positive-one-with-annalee-atia--18978582https://api.spreaker.com/episode/18978582Mon, 02 Sep 2019 11:15:35 +0000PBB Media IncorporatedWeek 31: This episode we hear from Annalee, mother, co-founder of Pregnancy Birth & Beyond Media, nutritionist and birth advocate Annalee Atia on birthing her first born and three key elements that made it a positive experience. Connect with...285birth,homebirth,naturalbirth,positviebirth,pregnancyfalsefull52 Weeks Ep. 32: Positive birth story with Nataliehttps://www.spreaker.com/episode/52-weeks-ep-32-positive-birth-story-with-natalie--18977844https://api.spreaker.com/episode/18977844Mon, 02 Sep 2019 10:33:08 +0000PBB Media IncorporatedWeek 32: This episode we hear from Natalie, doula and mother of her birthing experience. Natalie also shares with you what worked well for her, and what she would do differently next time. Connect with Natalie at thebyrondoula.com235falsefull52 Weeks Ep. 33: Active birth with Anna Wattshttps://www.spreaker.com/episode/52-weeks-ep-33-active-birth-with-anna-watts--18975323https://api.spreaker.com/episode/18975323Mon, 02 Sep 2019 00:15:06 +0000PBB Media IncorporatedWeek 33: Anna Watts founder of Celebration of Birth Doula Academy, talks on Active birth including practical tips for your labour and birth.319activebirth,birth,naturalbirthfalsefull52 Weeks Ep. 34: Natural labour pain relief methods with midwife Sunae Reillyhttps://www.spreaker.com/episode/52-weeks-ep-34-natural-labour-pain-relief-methods-with-midwife-sunae-reilly--18975261https://api.spreaker.com/episode/18975261Mon, 02 Sep 2019 00:00:10 +0000PBB Media IncorporatedWeek 34: Part one on pain management for labour with midwife Sunae Reilly. Wanting a physiological birth (aka natural) you will benefit from knowing your options for being present with your labour and birth.245birth,childbirth,labour,labourpainfalsefull52 Weeks Ep. 35: What are your pharmacological pain relief options in a hospital with midwife Sunae Reillyhttps://www.spreaker.com/episode/52-weeks-ep-35-what-are-your-pharmacological-pain-relief-options-in-a-hospital-with-midwife-sunae-reilly--18975217https://api.spreaker.com/episode/18975217Sun, 01 Sep 2019 23:48:13 +0000PBB Media IncorporatedWeek 35: Part two on pain management for labour. Registered midwife Sunae Reilly discusses your pharmacological pain relief options, if birthing in a hospital, for labour and birth.274falsefull52 Weeks Ep. 36: Let's talk perineum and tips to support it after birth with Larahttps://www.spreaker.com/episode/52-weeks-ep-36-let-s-talk-perineum-and-tips-to-support-it-after-birth-with-lara--18975140https://api.spreaker.com/episode/18975140Sun, 01 Sep 2019 23:33:52 +0000PBB Media IncorporatedWeek 36: This episode Lara, childbirth mentor and doula, discusses the perineum with you. What you could expect during labour and birth and ways you can support your perineum post birth. Connect with Lara at consciousbirth.com269falsefull52 Weeks Ep. 37: Birth story, home birth transfer to caesarian with Kari Azumahttps://www.spreaker.com/episode/52-weeks-ep-37-birth-story-home-birth-transfer-to-caesarian-with-kari-azuma--18975046https://api.spreaker.com/episode/18975046Sun, 01 Sep 2019 23:22:09 +0000PBB Media IncorporatedWeek 37: Kari Azuma, feminine leadership coach, talks on her home birth transfer to caesarian. How she came to see her birth as an empowering experience despite her birth plan having to change. Connect with Kari kariazuma.com289birth,birthtrauma,caesarian,homebirth,motherhood,pregnancyfalsefull52 Weeks Ep. 38: Undisturbed birth Part 1 featuring Michel Odenthttps://www.spreaker.com/episode/52-weeks-ep-38-undisturbed-birth-part-1-featuring-michel-odent--18970588The neocortex is the thinking part of the brain. When the neocortex is activated during labour a mother is taken out of her primitive brain where her birth hormones most smoothly function. There are three key elements of undisturbed birth; safety, privacy and warmth.
Produced by Lara Martin
pbbmedia.org]]>https://api.spreaker.com/episode/18970588Sun, 01 Sep 2019 09:46:24 +0000PBB Media IncorporatedWeek 38: Undisturbed birth Part 1 featuring Dr Michel Odent on the fetal ejection reflex. The neocortex is the thinking part of the brain. When the neocortex is activated during labour a mother is taken out of her primitive brain where her birth...The neocortex is the thinking part of the brain. When the neocortex is activated during labour a mother is taken out of her primitive brain where her birth hormones most smoothly function. There are three key elements of undisturbed birth; safety, privacy and warmth.
Produced by Lara Martin
pbbmedia.org]]>247falsefull52 Weeks Ep. 39: Undisturbed birth Part 2 featuring Sarah Buckleyhttps://www.spreaker.com/episode/52-weeks-ep-39-undisturbed-birth-part-2-featuring-sarah-buckley--18970546Birth sanctuary refers to a safe and private, often homelike environment in which a woman labours and births. Undisturbed birth has been described by O'dent and Buckley as the smoothest hormonal orchestration for birth to unfold physiologically. Undisturbed birth is where the mother feels safe, both physically and emotionally, is unobserved and has a warm sanctum. Featured are Dr Sarah Buckley sarahbuckley.com]]>https://api.spreaker.com/episode/18970546Sun, 01 Sep 2019 09:38:58 +0000PBB Media IncorporatedWeek 39: This episode you about birth sanctuary and undisturbed birth. Birth sanctuary refers to a safe and private, often homelike environment in which a woman labours and births. Undisturbed birth has been described by O'dent and Buckley as the...Birth sanctuary refers to a safe and private, often homelike environment in which a woman labours and births. Undisturbed birth has been described by O'dent and Buckley as the smoothest hormonal orchestration for birth to unfold physiologically. Undisturbed birth is where the mother feels safe, both physically and emotionally, is unobserved and has a warm sanctum. Featured are Dr Sarah Buckley sarahbuckley.com]]>242birth,homebirth,naturalbirth,undisturbedbirthfalsefull52 Weeks Ep. 40: Positive birth story with Meggiehttps://www.spreaker.com/episode/52-weeks-ep-40-positive-birth-story-with-meggie--18968811https://api.spreaker.com/episode/18968811Sun, 01 Sep 2019 01:04:15 +0000PBB Media IncorporatedWeek 40: Mother of two Meggie shares her story of the birth of her first baby.229falsefull52 Weeks Ep. 41: Placenta with Lara, Kirrah and Janehttps://www.spreaker.com/episode/52-weeks-ep-41-placenta-with-lara-kirrah-and-jane--18968755Connect with Kirrah at traditionalwisdom.com.au
More from Jane at janehardwickecollings.com]]>https://api.spreaker.com/episode/18968755Sun, 01 Sep 2019 00:57:52 +0000PBB Media IncorporatedWeek 41: This episode you hear about the placenta function, placenta encapsulation from Kirrah Stewart and an extract from Jane Hardwicke Collings blog on the placenta with Minmia. Connect with Kirrah at traditionalwisdom.com.au More from Jane at...Connect with Kirrah at traditionalwisdom.com.au
More from Jane at janehardwickecollings.com]]>271birth,placenta,placentaecapsulationfalsefull52 Weeks Ep. 42: Home birth story with Dr Oscar Serrallachhttps://www.spreaker.com/episode/52-weeks-ep-42-home-birth-story-with-dr-oscar-serrallach--18968703https://api.spreaker.com/episode/18968703Sun, 01 Sep 2019 00:35:45 +0000PBB Media IncorporatedWeek 42: Dr Oscar Serrallach father of 3 shares with you his journey to parenthood, including his role during the labour and birth of this children. oscarserrallach.com251baby,birth,drhomebirth,homebirth,naturalbirthfalsefull52 Weeks Ep. 43: Keeping birthing mother and baby close after hospital birth with Midwife Sunae Reillyhttps://www.spreaker.com/episode/52-weeks-ep-43-keeping-birthing-mother-and-baby-close-after-hospital-birth-with-midwife-sunae-reilly--18968621https://api.spreaker.com/episode/18968621Sun, 01 Sep 2019 00:23:31 +0000PBB Media IncorporatedWeek 43: Registered midwife Sunae Reilly talks on the value of keeping the birthing mother and baby close after hospital birth, even when intervention may be required.185baby,birth,hospitalbirth,midwifery,motherhood,naturalbirthinhospitalfalsefull52 Weeks Ep. 44: Spiritual postpartum with Erica Angelicahttps://www.spreaker.com/episode/52-weeks-ep-44-spiritual-postpartum-with-erica-angelica--18968272https://api.spreaker.com/episode/18968272Sat, 31 Aug 2019 22:52:50 +0000PBB Media IncorporatedWeek 44: Erica continues on the theme of birth as a rite of passage bringing a deeper awareness to the postpartum period. The final stage of birth as a rite of passage, known as the return. Erica also shares practical tips for the postpartum time....218baby,birth,birthasariteofpassage,parenting,postpartumfalsefull52 Weeks Ep. 45: Your postpartum with Dr Oscar Serrallachhttps://www.spreaker.com/episode/52-weeks-ep-45-your-postpartum-with-dr-oscar-serrallach--18968240https://api.spreaker.com/episode/18968240Sat, 31 Aug 2019 22:37:10 +0000PBB Media IncorporatedWeek 45: This episode we hear from Dr Oscar Serrallach, Functional doctor, author of The Postnatal Depletion Cure and public speaker. Oscar shares with you the importance of a good postnatal plan and how a mother can create a real cocoon at home for...251birth,droscarserrallach,motherhood,mothering,postpartum,thepostpartumdepletioncurefalsefull52 Weeks Ep. 46: The importance of postpartum with midwife Bronwyn Moirhttps://www.spreaker.com/episode/52-weeks-ep-46-the-importance-of-postpartum-with-midwife-bronwyn-moir--18968200https://api.spreaker.com/episode/18968200Sat, 31 Aug 2019 22:27:11 +0000PBB Media IncorporatedWeek 4: Often pregnancy is seen as a big lead up to birth, with little to no preparation for what comes next, postpartum. When you leave hospital or if you had a home birth, it can feel like you're expected to naturally know how to navigate the next...257baby,breastfeeding,lismorebirthhouse,postpartum,pregnancyfalsefull52 Weeks Ep. 47: Breastfeeding and gut health with The Milk Meghttps://www.spreaker.com/episode/52-weeks-ep-47-breastfeeding-and-gut-health-with-the-milk-meg--18968153https://api.spreaker.com/episode/18968153Sat, 31 Aug 2019 22:17:22 +0000PBB Media IncorporatedWeek 47: This week we have Meg Nagle otherwise known as The milk meg. Health and breastmilk really go hand in hand. We hear from Meg about how breastmilk supports a healthy immune system and gut and what you can do to improve your gut so your baby...288baby,breastfeeding,guthealth,pregnancy,themilkmegfalsefull52 Weeks Ep. 48: Love your body - baby fat with Emma Granthttps://www.spreaker.com/episode/52-weeks-ep-48-love-your-body-baby-fat-with-emma-grant--18965172https://api.spreaker.com/episode/18965172Sat, 31 Aug 2019 22:10:11 +0000PBB Media IncorporatedWeek 48: This episode Emma Grant of Red Tent Yoga shares with you on Loving your body – prenatally and postnatally. Emma sheds light on the topic of body/ baby fat (the weight you gain during pregnancy) but here fat is not a dirty word, it is...257babyfat,bodypositivitymovement,postbirthbodyfalsefull52 Weeks Ep. 49: Love your body mediation with Emma Granthttps://www.spreaker.com/episode/52-weeks-ep-49-love-your-body-mediation-with-emma-grant--18965114https://api.spreaker.com/episode/18965114Sat, 31 Aug 2019 11:46:47 +0000PBB Media IncorporatedWeek 49: In this episode Emma Grant from Red Tent Yoga shares with you a short practice to connect with and send some love to your pregnant or postnatal body. Connect with Emma at redtentyoga.com.au148birth,bodypositivity,loveyourbody,postpartum,postpartumbody,yogafalsefull52 Weeks Ep. 50: Your baby's needs with Dr Howard Chiltonhttps://www.spreaker.com/episode/52-weeks-ep-50-your-baby-s-needs-with-dr-howard-chilton--18965096https://api.spreaker.com/episode/18965096Sat, 31 Aug 2019 11:38:12 +0000PBB Media IncorporatedWeek 50: Dr Howard Chilton Father, grandfather neonatal paediatrician, of more than four decades in the UK, USA and Australia, author of two books Baby on Board and Your Cherished Baby talks on your newborn baby's needs. Connect with Dr Howard at...300baby,birth,cryingbaby,parentingfalsefull52 Weeks Ep. 51: Baby attachment with Kimberley Lipschushttps://www.spreaker.com/episode/52-weeks-ep-51-baby-attachment-with-kimberley-lipschus--18965045https://api.spreaker.com/episode/18965045Sat, 31 Aug 2019 11:21:32 +0000PBB Media IncorporatedWeek 51: This episode psychotherapist, film maker and story teller talks Kimberley Lipschus on baby attachment. Connect with Kimberley at kimberleylipschus.com266attachment,baby,newborn,parentingfalsefull52 Weeks Ep. 52: Team parenting with Sean Tonnethttps://www.spreaker.com/episode/52-weeks-ep-52-team-parenting-with-sean-tonnet--18964862https://api.spreaker.com/episode/18964862Sat, 31 Aug 2019 10:23:47 +0000PBB Media IncorporatedWeek 52: This episode relationship therapist Sean Tonnet talks on 'team parenting' right from the start. Connect with Sean at seantonnet.com.au212baby,birth,parenting,teamparentingfalsefullDemystifying toxin-free living with Georgia Lawsonhttps://www.spreaker.com/episode/demystifying-toxin-free-living-with-georgia-lawson--18831253Tune in to this episode to hear Kirilly chat with Georgia about why toxin-free products matter, the nasties to look out for, and how we can take small steps today to make this a simple and gentle practice in our lives.

The Clean Collective have offered a discount code of 15% for listeners of Pregnancy Birth and Beyond, valid until October 31. Use the code: BEYOND15
The discount applies to every full priced item, other than gift cards.

* Study by The Environmental Working Group]]>https://api.spreaker.com/episode/18831253Wed, 28 Aug 2019 01:55:57 +0000PBB Media IncorporatedToday, babies are born with around 200 chemicals in their umbilical chord*. That's a shocking figure and is providing just some insight into the harsh impact that plastics and pollutants are having on our future generations. It's also one of the...Tune in to this episode to hear Kirilly chat with Georgia about why toxin-free products matter, the nasties to look out for, and how we can take small steps today to make this a simple and gentle practice in our lives.

The Clean Collective have offered a discount code of 15% for listeners of Pregnancy Birth and Beyond, valid until October 31. Use the code: BEYOND15
The discount applies to every full priced item, other than gift cards.

* Study by The Environmental Working Group]]>1670birth,conscious,eco,eco-friendly,organic,parenting,pregnancy,toxinsfalsefullInduction Matters with Dr Rachel Reedhttps://www.spreaker.com/episode/induction-matters-with-dr-rachel-reed--18672900
As the rate of this intervention increases, Dr Rachel Reed, midwife and academic from the Univ. of the Sunshine Coast believes it is worth some close examination to make sure we're getting the best possible outcomes from it. Rachel discusses the risks, how it works, what can help a woman's decision making process and how she can 'own' her induction should she choose it.

Rachel has recently published a book "Why Induction Matters".

Interview recorded on 24 July 2019.

Rachel also mentions the UK's NICE Guidelines on how women should be informed of the risks of induction, which is a useful guidance for any family and health service to follow. https://pathways.nice.org.uk/pathways/induction-of-labour

We also hear briefly from Dr Sarah Buckley about the physiology required for induction to work (recorded at the Midwifery Today conference 2014).

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2019
www.pbbmedia.org

Our thanks to Dr Rachel Reed and Dr Sarah Buckley

First aired on 99.9 BayFM Byron Bay Australia on 29 July 2019.]]>https://api.spreaker.com/episode/18672900Tue, 30 Jul 2019 07:00:44 +0000PBB Media IncorporatedOver 30% of pregnant parents have their labours synthetically induced and that number is rising steadily each year. Induction of labour is used for situations such as a diagnosis of gestational diabetes, suspected big babies, over-due pregnancies and...
As the rate of this intervention increases, Dr Rachel Reed, midwife and academic from the Univ. of the Sunshine Coast believes it is worth some close examination to make sure we're getting the best possible outcomes from it. Rachel discusses the risks, how it works, what can help a woman's decision making process and how she can 'own' her induction should she choose it.

Rachel has recently published a book "Why Induction Matters".

Interview recorded on 24 July 2019.

Rachel also mentions the UK's NICE Guidelines on how women should be informed of the risks of induction, which is a useful guidance for any family and health service to follow. https://pathways.nice.org.uk/pathways/induction-of-labour

We also hear briefly from Dr Sarah Buckley about the physiology required for induction to work (recorded at the Midwifery Today conference 2014).

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2019
www.pbbmedia.org

Our thanks to Dr Rachel Reed and Dr Sarah Buckley

First aired on 99.9 BayFM Byron Bay Australia on 29 July 2019.]]>1866birth,inductionoflabour,rachelreed,sarahbuckley,whyinductionmattersfalsefullTwin Pregnancy with parents Jeremy and Hanahttps://www.spreaker.com/episode/twin-pregnancy-with-parents-jeremy-and-hana--18643967
All Pregnancy, Birth and Beyond podcast are now ACM CPD (Australian College of Midwives Continuing Professional Development) recognised.

You are tuned to Pregnancy, Birth & Beyond, Contemporary Conversations where Stories, Science, Traditions & New Ideas meet to inform and inspire! Our show is coming to you from the studios of BayFM in Byron Bay, broadcasting across Australia on the Community Radio Network and podcast via iTunes, Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia in 2019.
Hosted by Oni Blecher
Guests: Jeremy & Hana
Produced and edited by Annalee Atia for PBB Media

All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/18643967Fri, 26 Jul 2019 03:09:24 +0000PBB Media IncorporatedIn this episode of Pregnancy, Birth and beyond Oni Blecher speaks with parents Jeremy and Hana pregnant for the third time, this time round with twins. Hear about their previous birth experiences, their current maternity care and their hopes, desires...
All Pregnancy, Birth and Beyond podcast are now ACM CPD (Australian College of Midwives Continuing Professional Development) recognised.

You are tuned to Pregnancy, Birth & Beyond, Contemporary Conversations where Stories, Science, Traditions & New Ideas meet to inform and inspire! Our show is coming to you from the studios of BayFM in Byron Bay, broadcasting across Australia on the Community Radio Network and podcast via iTunes, Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia in 2019.
Hosted by Oni Blecher
Guests: Jeremy & Hana
Produced and edited by Annalee Atia for PBB Media

All rights reserved.

www.pbbmedia.org]]>2339birth,childbirth,continuityofcare,fatherhood,fathers,maternitycare,midwifery,midwiferyledcare,midwives,motherhood,mothers,obstetriccare,parenting,perinatalcare,postpartum,postpartumcare,pregnancy,twinpregnancy,twinsfalsefullLiterary Festivals Bringing Joy and Inspiration to Familieshttps://www.spreaker.com/episode/literary-festivals-bringing-joy-and-inspiration-to-families--18609623
First aired live on 99.9BayFM in Byron Bay, Australia on 22 July 2019.
Produced and hosted by Sally Cusack for PBB Media
www.pbbmedia.org
www.byronwritersfestival.com]]>https://api.spreaker.com/episode/18609623Mon, 22 Jul 2019 10:04:47 +0000PBB Media IncorporatedSally speaks with Anika Ebner and Gabby LeBrun from the Byron Writers Festival about the kids' programming, and the inspiration for parents there as well. Authors mentioned include Zanni Louise, Clementine Ford, Alison Lester, John Flanagan, David...
First aired live on 99.9BayFM in Byron Bay, Australia on 22 July 2019.
Produced and hosted by Sally Cusack for PBB Media
www.pbbmedia.org
www.byronwritersfestival.com]]>1762byronwritersfestivalfalsefullTamara on her 4 very different pregnancy and birth experienceshttps://www.spreaker.com/episode/tamara-on-her-4-very-different-pregnancy-and-birth-experiences--18523196
All Pregnancy, Birth and Beyond podcast are now ACM CPD (Continuing Professional Development) points recognised.

You are tuned to Pregnancy, Birth & Beyond. Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes and Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia in 2019.
Produced and hosted by Annalee Atia for PBB Media
Guest: Tamara Fenwick

All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/18523196Thu, 11 Jul 2019 14:52:33 +0000PBB Media IncorporatedIn this episode of Pregnancy, Birth and beyond Annalee Atia speaks with New South Wales mother of four Tamara Fenwick as she reflects back on her four very different birthing experiences. From hospital birth to birthing in an ambulance and then onto...
All Pregnancy, Birth and Beyond podcast are now ACM CPD (Continuing Professional Development) points recognised.

You are tuned to Pregnancy, Birth & Beyond. Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes and Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia in 2019.
Produced and hosted by Annalee Atia for PBB Media
Guest: Tamara Fenwick

All rights reserved.

www.pbbmedia.org]]>1671babies,baby,birth,childbirth,continuityofcare,family,homebirth,hospitalbirth,maternity,maternitycare,midwifery,motherhood,parenting,perinatal,postnatal,postpartum,pregnancy,womenshealthfalsefullThe Mind, Body, Spirit Connection in Pregnancy and Birthhttps://www.spreaker.com/episode/the-mind-body-spirit-connection-in-pregnancy-and-birth--18481568https://api.spreaker.com/episode/18481568Sun, 07 Jul 2019 12:49:32 +0000PBB Media IncorporatedIn this episode of Pregnancy, Birth and Beyond, host Kirilly Dawn chats with craniosacral therapist and birth attendant Oni Blecher, on the relationship of the body, mind and spirit during pregnancy and birth.1671birth,bodywork,motherhood,parenting,pregnancyfalsefullSetting a place for Death with Zenith Viragohttps://www.spreaker.com/episode/setting-a-place-for-death-with-zenith-virago--18403910A rich discussion on death and dying and living well with Zenith Virago for most family and community members. In this episode of Pregnancy, Birth and Beyond Annalee Atia speaks with Zenith Virago about the relevance of setting a place for death at your table and being an elder in your community. Death is an eventual part of life for all of us and like many other aspects of life, we have the choice to either integrate it into or seperate it from - our everyday reality. This grounding and honest conversation is great for most family members from 14yo and above - parents listen in first to determine if suitable for your children and circumstances and wonderful for all of us whether we have been touched by death or not.

Find out more about Zenith's work here: www.naturaldeathcarecentre.org

All Pregnancy, Birth and Beyond podcast are now ACM CPD (Continuing Professional Development) points recognised.

You are tuned to Pregnancy, Birth & Beyond. Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes and Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia on April 22nd, 2019.
Produced and hosted by Annalee Atia for PBB Media
Guest: Zenith Virago
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/18403910Thu, 27 Jun 2019 23:14:57 +0000PBB Media Incorporated"To do death well, we need to live well", Zenith Virago. A rich discussion on death and dying and living well with Zenith Virago for most family and community members. In this episode of Pregnancy, Birth and Beyond Annalee Atia speaks with Zenith...A rich discussion on death and dying and living well with Zenith Virago for most family and community members. In this episode of Pregnancy, Birth and Beyond Annalee Atia speaks with Zenith Virago about the relevance of setting a place for death at your table and being an elder in your community. Death is an eventual part of life for all of us and like many other aspects of life, we have the choice to either integrate it into or seperate it from - our everyday reality. This grounding and honest conversation is great for most family members from 14yo and above - parents listen in first to determine if suitable for your children and circumstances and wonderful for all of us whether we have been touched by death or not.

Find out more about Zenith's work here: www.naturaldeathcarecentre.org

All Pregnancy, Birth and Beyond podcast are now ACM CPD (Continuing Professional Development) points recognised.

You are tuned to Pregnancy, Birth & Beyond. Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes and Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia on April 22nd, 2019.
Produced and hosted by Annalee Atia for PBB Media
Guest: Zenith Virago
All rights reserved.

www.pbbmedia.org]]>2437annaleeatia,birth,childbirth,community,death,deathanddying,deathwalker,dying,elder,elderhood,parenting,pbbmedia,pregnancy,pregnancybirthandbeyond,zenithviragofalsefullExtras: Nicole on Updated Nappy Free 20190324https://www.spreaker.com/episode/extras-nicole-on-updated-nappy-free-20190324--18344781https://api.spreaker.com/episode/18344781Sat, 22 Jun 2019 08:43:42 +0000PBB Media IncorporatedRecorded by Sally at Doula Conf. 20191557falsefullPost Natal Depletion: A Guide for Dadshttps://www.spreaker.com/episode/post-natal-depletion-a-guide-for-dads--18248051
Supporting woman and families with recovery from post natal depletion is the life work of our special guest Dr Oscar Serrallach. Dr Serrallach was first to recognise something he termed Post-Natal Depletion, describing the broader clinical pattern of many women presenting with these symptoms after having children. He has since dedicated his work towards researching this condition and applying the practice of Functional Medicine to help his clients with their recovery.

On this show, Dr Oscar and Sean Tonnet will nut through some of the most significant facts and actions Dads can make in supporting themselves, their woman and their children around this essential topic.

First aired on 99.9 Bay FM in Byron Bay on 3rd June 2019.

Produced and presented by Sean Tonnet
Copyright 2019 PBB Media and Sean Tonnet
www.pbbmedia.org]]>https://api.spreaker.com/episode/18248051Wed, 12 Jun 2019 11:06:10 +0000PBB Media IncorporatedMost mothers have experienced exhaustion, pain, forgetfulness, indecision, low energy levels, moodiness, or some form of baby brain. And it's no wonder: The process of growing a baby depletes a mother's body in substantial ways. As a result, a woman...
Supporting woman and families with recovery from post natal depletion is the life work of our special guest Dr Oscar Serrallach. Dr Serrallach was first to recognise something he termed Post-Natal Depletion, describing the broader clinical pattern of many women presenting with these symptoms after having children. He has since dedicated his work towards researching this condition and applying the practice of Functional Medicine to help his clients with their recovery.

On this show, Dr Oscar and Sean Tonnet will nut through some of the most significant facts and actions Dads can make in supporting themselves, their woman and their children around this essential topic.

First aired on 99.9 Bay FM in Byron Bay on 3rd June 2019.

Produced and presented by Sean Tonnet
Copyright 2019 PBB Media and Sean Tonnet
www.pbbmedia.org]]>1671babybirth,becomingadad,dads,family,fatherhood,oscarserrallach,postnataldepletion,seantonnet,supportfalsefullConnection, Sustainability & Women's Wellbeinghttps://www.spreaker.com/episode/connection-sustainability-women-s-wellbeing--17953749
Find out more about Ella Noah Bancroft at www.yhicreation.com and www.thereturning.com.au
First aired on 99.9 BayFM Byron Bay on 15 April 2019
Copyright PBB Media, Kirilly Dawn and Ella Noah Bancroft
www.pbbmedia.org]]>https://api.spreaker.com/episode/17953749Fri, 17 May 2019 00:28:29 +0000PBB Media IncorporatedElla Noah Bancroft is a Bundjalung woman, artist, storyteller, teacher, connection coach and mentor. A poetic feminist and social entrepreneur, Ella’s passion in protecting the Earth fuel her many projects. She is the founder of non-profit sustainable...
Find out more about Ella Noah Bancroft at www.yhicreation.com and www.thereturning.com.au
First aired on 99.9 BayFM Byron Bay on 15 April 2019
Copyright PBB Media, Kirilly Dawn and Ella Noah Bancroft
www.pbbmedia.org]]>1671birth,connection,empowerment,environment,female,feminism,health,indigenous,motherhood,parenting,pregnancy,sensuality,sustainability,tantra,wellbeing,yogafalsefullEndometriosis, Fertility, Postnatal Support: How Naturopathy can Helphttps://www.spreaker.com/episode/endometriosis-fertility-postnatal-support-how-naturopathy-can-help--17810433
Emma McLaughlin is a Naturopath from the Health Lodge, Byron Bay.
www.thehealthlodge.com.au

+++++++++

First aired on 8 April 2019 on 99.9 BayFM Byron Bay Australia.

Copyright PBB Media and Kimberley Lipschus 2019
Produced and presented by Kimberley Lipschus
www.pbbmedia.org
www.kimberleylipschus.com]]>https://api.spreaker.com/episode/17810433Thu, 02 May 2019 02:06:17 +0000PBB Media IncorporatedEmma McLaughlin is a mother and naturopath who specialises in women's health, with her own lived experience of struggling in the postnatal years with depletion when her children were young. In this show she speaks with host Kimberley about how...
Emma McLaughlin is a Naturopath from the Health Lodge, Byron Bay.
www.thehealthlodge.com.au

+++++++++

First aired on 8 April 2019 on 99.9 BayFM Byron Bay Australia.

Copyright PBB Media and Kimberley Lipschus 2019
Produced and presented by Kimberley Lipschus
www.pbbmedia.org
www.kimberleylipschus.com]]>2062hormones,postnatal,pregnancy,womenshealthfalsefullKerrie Adams, from Midwife to Mother and why she sees things so differently now.https://www.spreaker.com/episode/kerrie-adams-from-midwife-to-mother-and-why-she-sees-things-so-differently-now--17662671
She currently writes a blog about the realities of working in the system as a midwife. This highlights how midwives ‘show up’ in practice and how that impacts birth outcomes for women and babies. You can find her at kerrieadams.com.

You are tuned to Pregnancy, Birth & Beyond. Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes and Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia on April 1st, 2019.
Produced and hosted by Annalee Atia for PBB Media
Guest: Kerrie Adams
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/17662671Thu, 18 Apr 2019 10:40:59 +0000PBB Media IncorporatedIn this episode of Pregnancy, Birth and Beyond, we are speaking with Kerrie Adams, Advocate for women’s choices in birth and for physiological birth. Midwife for the past 13 years, 11 of them in Australia and mostly Sydney based. Kerrie has a varied...
She currently writes a blog about the realities of working in the system as a midwife. This highlights how midwives ‘show up’ in practice and how that impacts birth outcomes for women and babies. You can find her at kerrieadams.com.

You are tuned to Pregnancy, Birth & Beyond. Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes and Spreaker and through your favourite podcast providers.

First aired live on 99.9BayFM in Byron Bay, Australia on April 1st, 2019.
Produced and hosted by Annalee Atia for PBB Media
Guest: Kerrie Adams
All rights reserved.

www.pbbmedia.org]]>2158auspol,australianmaternitycare,babies,baby,birth,childbirth,maternitycare,midwife,midwifery,parenting,pbbmedia,pregnancy,pregnancybirthandbeyond,women,womenshealthfalsefullHow to have THAT Conversation with your Kids - with Lily Isobellahttps://www.spreaker.com/episode/how-to-have-that-conversation-with-your-kids-with-lily-isobella--17600694
Lily is the founder of the One a Day Project and Courageous Conversations.

Lily Isobella: www.lilyisobella.com.au

+++++

Produced and presented by Kimberley Lipschus.
Copyright PBB Media and Kimberley Lipschus 2019
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia on 25 March 2019]]>https://api.spreaker.com/episode/17600694Fri, 05 Apr 2019 07:44:00 +0000PBB Media IncorporatedLily Isobella is a mother of 3 and has worked for the past two decades to reverse the amount of violence in our society. Through her career and life experience she has come to see that the key to changing this situation is speaking frankly about...
Lily is the founder of the One a Day Project and Courageous Conversations.

Lily Isobella: www.lilyisobella.com.au

+++++

Produced and presented by Kimberley Lipschus.
Copyright PBB Media and Kimberley Lipschus 2019
www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay Australia on 25 March 2019]]>1671auspol,birth,families,menshealth,motherhood,parenting,pbbmedia,pregnancy,sexeducation,teens,violenceagainstwomen,womenshealthfalsefullAyurveda: Living in Harmony with Nature with Christina Covingtonhttps://www.spreaker.com/episode/ayurveda-living-in-harmony-with-nature-with-christina-covington--17459441
Christina Covington is a certified Ayurvedic consultant and certified intern with Dr Vasant Lad in India. She is also a mother to two children, now 22 and 16 and passionate about bringing Ayurveda’s wisdom to women’s health, in particular the stages of menses, birth and menopause.

Our guest: Christina Covington, Founder Embodyed Ayurveda
https://www.embodyedayurveda.com/

Produced and presented by Kimberley Lipschus
Copyright PBB Media and Kimberley Lipschus 2019

First aired on 99.9 BayFM Byron Bay 4 March 2019]]>https://api.spreaker.com/episode/17459441Fri, 22 Mar 2019 02:44:00 +0000PBB Media IncorporatedThe mind-body connection has been proven in just the last few decades, yet Ayurveda, the system of treating illness and optimising health from India, based all of its understanding of the body and the mind from this connection. Christina Covington...
Christina Covington is a certified Ayurvedic consultant and certified intern with Dr Vasant Lad in India. She is also a mother to two children, now 22 and 16 and passionate about bringing Ayurveda’s wisdom to women’s health, in particular the stages of menses, birth and menopause.

Our guest: Christina Covington, Founder Embodyed Ayurveda
https://www.embodyedayurveda.com/

Produced and presented by Kimberley Lipschus
Copyright PBB Media and Kimberley Lipschus 2019

First aired on 99.9 BayFM Byron Bay 4 March 2019]]>1671ayurveda,ayurvedicmedicine,birth,childbirth,menshealth,parenting,pbbmedia,postnatal,pregnancy,womenshealthfalsefullVasectomy: The Responsible Choicehttps://www.spreaker.com/episode/vasectomy-the-responsible-choice--17377156
In this episode of Pregnancy Birth and Beyond, Sean Tonnet will be talking with Dr. David Kerle, Urologist and surgeon with over 30 years experience performing vasectomies. From men's attitudes on contraception to sexual function, join David and Sean as they discuss all the important aspects of male contraception.

A not to be missed show on how men can understand more on an important area of family life.

First aired on 99.9 Bay FM in Byron Bay on 11th March 2019.

Produced and presented by Sean Tonnet
Copyright 2019 PBB Media and Sean Tonnet
www.pbbmedia.org]]>https://api.spreaker.com/episode/17377156Fri, 15 Mar 2019 01:44:00 +0000PBB Media IncorporatedDid you know that Vasectomies are coming back into vogue? After reaching a high of nearly 29,000 in 1997, numbers dropped dramatically throughout the 2000s. However, in the past four years, they have risen again to close to 1990 levels. In this...
In this episode of Pregnancy Birth and Beyond, Sean Tonnet will be talking with Dr. David Kerle, Urologist and surgeon with over 30 years experience performing vasectomies. From men's attitudes on contraception to sexual function, join David and Sean as they discuss all the important aspects of male contraception.

A not to be missed show on how men can understand more on an important area of family life.

First aired on 99.9 Bay FM in Byron Bay on 11th March 2019.

Produced and presented by Sean Tonnet
Copyright 2019 PBB Media and Sean Tonnet
www.pbbmedia.org]]>1671becomingadad,beingadad,contraception,dad,fatherhood,masculinity,men,vasectomyfalsefullShould Birth in Australia be Obstetric-Led?https://www.spreaker.com/episode/should-birth-in-australia-be-obstetric-led--17152456
This episode explores the available models of maternity care to expectant parents, and whether the most widely available models are in fact the safest.

We speak with Professor Stephen Robson, obstetrician and Secretary of the Australian Medical Association about this statement by the AMA and the evidence to support it.
https://ama.com.au/media/maternity-services-must-be-obstetric-led

Also discussed is the current national review into maternity services; https://consultations.health.gov.au/office-of-the-chief-nursing-and-midwifery-officer/national-strategic-approach-to-maternity-services-1/supporting_documents/Strategic%20Directions%20for%20Maternity%20Services%20Consultation%20Paper%20DRAFT.pdf

We also speak with epidemiologist Michal Schiff about the evidence cited by the AMA and which forms of maternity care are recommended by the World Health Organisation and why. (The recommendations are for midwifery-led continuity of care.)

Finally we speak with a mother, Agy, who gave birth in a large teaching hospital in Australia in late 2017 about her experience of GP-shared care with her local hospital and how she in fact lacked continuity of care during the crucial periods of her labour and birth.

YOU CAN HAVE YOUR SAY on maternity services by writing to federal Minister for Health Greg Hunt and find out more here: http://www.pbbmedia.org/maternity-advocacy.html

REFERENCES:
- National Strategic Approach to Maternity Services Consultation round 2 (NSAMS)
https://consultations.health.gov.au/office-of-the-chief-nursing-and-midwifery-officer/national-strategic-approach-to-maternity-services-1/supporting_documents/Strategic%20Directions%20for%20Maternity%20Services%20Consultation%20Paper%20DRAFT.pdf

- WHO research referred to by Prof Robson cited by NSAMS is listed on p31 of this document: https://www.who.int/reproductivehealth/publications/maternal_perinatal_health/anc-positive-pregnancy-experience/en/
- AMA press release: Maternity Services must be Obstetric-Led
https://ama.com.au/media/maternity-services-must-be-obstetric-led
- Cochrane Review: https://www.cochranelibrary.com/cdsr/doi/10.1002/14651858.CD004667.pub5
- "Mater study"
https://obgyn.onlinelibrary.wiley.com/doi/full/10.1111/1471-0528.14903
- "Mercy study"
https://www.ncbi.nlm.nih.gov/pubmed/25832990

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2019
www.pbbmedia.org

Our thanks to Agy, Prof. Stephen Robson and Michal Schiff.

First aired on 99.9 BayFM Byron Bay Australia on 25 February 2019.]]>https://api.spreaker.com/episode/17152456Thu, 07 Mar 2019 20:00:00 +0000PBB Media IncorporatedHappy International Women's Day! This episode explores the available models of maternity care to expectant parents, and whether the most widely available models are in fact the safest. We speak with Professor Stephen Robson, obstetrician and...
This episode explores the available models of maternity care to expectant parents, and whether the most widely available models are in fact the safest.

We speak with Professor Stephen Robson, obstetrician and Secretary of the Australian Medical Association about this statement by the AMA and the evidence to support it.
https://ama.com.au/media/maternity-services-must-be-obstetric-led

Also discussed is the current national review into maternity services; https://consultations.health.gov.au/office-of-the-chief-nursing-and-midwifery-officer/national-strategic-approach-to-maternity-services-1/supporting_documents/Strategic%20Directions%20for%20Maternity%20Services%20Consultation%20Paper%20DRAFT.pdf

We also speak with epidemiologist Michal Schiff about the evidence cited by the AMA and which forms of maternity care are recommended by the World Health Organisation and why. (The recommendations are for midwifery-led continuity of care.)

Finally we speak with a mother, Agy, who gave birth in a large teaching hospital in Australia in late 2017 about her experience of GP-shared care with her local hospital and how she in fact lacked continuity of care during the crucial periods of her labour and birth.

YOU CAN HAVE YOUR SAY on maternity services by writing to federal Minister for Health Greg Hunt and find out more here: http://www.pbbmedia.org/maternity-advocacy.html

REFERENCES:
- National Strategic Approach to Maternity Services Consultation round 2 (NSAMS)
https://consultations.health.gov.au/office-of-the-chief-nursing-and-midwifery-officer/national-strategic-approach-to-maternity-services-1/supporting_documents/Strategic%20Directions%20for%20Maternity%20Services%20Consultation%20Paper%20DRAFT.pdf

- WHO research referred to by Prof Robson cited by NSAMS is listed on p31 of this document: https://www.who.int/reproductivehealth/publications/maternal_perinatal_health/anc-positive-pregnancy-experience/en/
- AMA press release: Maternity Services must be Obstetric-Led
https://ama.com.au/media/maternity-services-must-be-obstetric-led
- Cochrane Review: https://www.cochranelibrary.com/cdsr/doi/10.1002/14651858.CD004667.pub5
- "Mater study"
https://obgyn.onlinelibrary.wiley.com/doi/full/10.1111/1471-0528.14903
- "Mercy study"
https://www.ncbi.nlm.nih.gov/pubmed/25832990

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2019
www.pbbmedia.org

Our thanks to Agy, Prof. Stephen Robson and Michal Schiff.

First aired on 99.9 BayFM Byron Bay...]]>2434auspol,babies,birth,continuityofcare,maternity,maternitycare,midwiferyledcontinuity,mothers,pbbmedia,perinatalcare,pregnancy,pregnancybirthandbeyond,saveaussiemlcoc,womenshealthfalsefullA young mother's experience of accessing Australian maternity carehttps://www.spreaker.com/episode/a-young-mother-s-experience-of-accessing-australian-maternity-care--17181428
In this episode of Pregnancy, Birth and Beyond, we are speaking with Serina Crinis.

You are tuned to Pregnancy, Birth & Beyond. Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes and Spreaker and through your favourite podcast providers.

Do you have a story you would like to share with us on this topic? Email us at hello@pbbmedia.org

Find Serina at www.serinacrinis.com

For more information about our ADD YOUR VOICE campaign head to www.pbbmedia.

Produced and Presented by Annalee Atia
Copyright PBB Media and Annalee Atia 2019]]>https://api.spreaker.com/episode/17181428Thu, 28 Feb 2019 13:20:31 +0000PBB Media IncorporatedAccessing maternity care in Australia can be a complex and confusing experience for many women. Our system is fragmented and offers various care options to various people, with some women having more options than others and many women not having...
In this episode of Pregnancy, Birth and Beyond, we are speaking with Serina Crinis.

You are tuned to Pregnancy, Birth & Beyond. Contemporary Conversations where Stories, Science, Traditions & New Ideas meet. Our show is coming to you from the studios of BayFM in Byron Bay and is broadcasting across Australia on the Community Radio Network, you can find us on iTunes and Spreaker and through your favourite podcast providers.

Do you have a story you would like to share with us on this topic? Email us at hello@pbbmedia.org

Find Serina at www.serinacrinis.com

For more information about our ADD YOUR VOICE campaign head to www.pbbmedia.

Produced and Presented by Annalee Atia
Copyright PBB Media and Annalee Atia 2019]]>1746auspol,childbirth,maternitycare,midwifery,motherhood,parenting,pbbmedia,postpartumsupport,pregnancy,pregnancybirthandbeyond,saveaussiemlcoc,womenshealth,youngmothersfalsefullExtras: Michal Schiff on AMA's cited research re Birth Must be Obstetric Ledhttps://www.spreaker.com/episode/extras-michal-schiff-on-ama-s-cited-research-re-birth-must-be-obstetric-led--17130645
Part of "Should Birth be Obestetric-Led?" by Sally Cusack February 2019.
www.pbbmedia.org]]>https://api.spreaker.com/episode/17130645Sun, 24 Feb 2019 06:16:02 +0000PBB Media IncorporatedSally's interview with Michal about research AMA relies on for this press release: https://ama.com.au/media/maternity-services-must-be-obstetric-led and Part of "Should Birth be Obestetric-Led?" by Sally Cusack February 2019. www.pbbmedia.org
Part of "Should Birth be Obestetric-Led?" by Sally Cusack February 2019.
www.pbbmedia.org]]>1056birth,pregnancyfalsefullYoga for Menstruation and Perimenopause with Ana Davishttps://www.spreaker.com/episode/yoga-for-menstruation-and-perimenopause-with-ana-davis--17103120
Ana Davis author of ‘Moving with the Moon: Yoga, Movement and Meditation for Every Phase of your Menstrual Cycle’ shares her experiences and knowledge in this show.

www.movingwiththemoon.com

Ana also cites "The Optimized Woman" by author Miranda Gray. http://www.mirandagray.co.uk

++++++++++

First aired on 99.9 BayFM Byron Bay Australia on 11 February 2019.

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2019
www.pbbmedia.org]]>https://api.spreaker.com/episode/17103120Thu, 21 Feb 2019 06:50:23 +0000PBB Media IncorporatedWe cover two topics that even in this day and age are still so hidden away - menstruation - and the time of life when menstruation draws to a close, perimenopause. Half of our population goes through this process, but when you find yourself at the...
Ana Davis author of ‘Moving with the Moon: Yoga, Movement and Meditation for Every Phase of your Menstrual Cycle’ shares her experiences and knowledge in this show.

www.movingwiththemoon.com

Ana also cites "The Optimized Woman" by author Miranda Gray. http://www.mirandagray.co.uk

++++++++++

First aired on 99.9 BayFM Byron Bay Australia on 11 February 2019.

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2019
www.pbbmedia.org]]>1670birth,childbirth,menstruation,movingwiththemoon,parenting,pbbmedia,perimenopause,pregnancy,pregnancybirthandbeyond,womanhood,women'shealthfalsefullExtras: Save Aussie Midwifery Led Continuity of Carehttps://www.spreaker.com/episode/extras-save-aussie-midwifery-led-continuity-of-care--17092451https://api.spreaker.com/episode/17092451Wed, 20 Feb 2019 05:01:36 +0000PBB Media IncorporatedSally on the #SaveAussieMLCoC Campaign, broadcast on 99.9 BayFM Byron Bay on 11 February 2019. Features author Ana Davis at the end making her statement in favour of midwifery-led continuity of care.713falsefullWhen birth plans change. Breech birth story.https://www.spreaker.com/episode/when-birth-plans-change-breech-birth-story--17077406

Our guest is Jazzie and Lessie (Jazzie's mum, and now a grandmother). Jazzie's pregnancy might have begun like many other first time parents. Jazzie had what is refereed to as low risk pregnancy. Meaning she had no health considerations that could potentially negativity impact on her labour or baby. However sometimes the unexpected happens.

This episode we hear not only about Jazzie breech vaginal birth in hospital but also about her decision making, the kind of care she received, what helped and what didn't and more here on Pregnancy Birth and Beyond media.

How common is the breech position?
Breech position, which is bottom first, accounts for 3% to 4% of term pregnancies.
Breech positioning is more common in preterm babies with 25% in breech position at 28 weeks,
The majority of breech babies born in western industrialised cultures including Australia are born by elective or planned Cesarean.

If your baby is breech, what choices do you have:
Every situation is different, some breech births are more favorable to a vaginal birth than others.
You get to decide what is best for you and your baby.
Your options are:
planned caesarean section
attempt vaginal birth

There are studies on breech birth, for example Term Breech Trial and the Pre-MODA study which both had some different concluding results. So a breech birth presents with potential risks for the baby, this could be the type of breech, or other identified risk factors for example intrauterine growth restriction, which is a very small baby for its gestational age and parents genetic disposition. And further to the safety of vaginal breech birth is the competency of the care provider. When a healthcare provider is skilled at breech birth it is, according to Pre-MODA study, just as safe to have a vaginal breech birth as it is to have a C/S and you also have to consider the long term health implications and not just the short term. So in a short term, you could view a planned c/s as less risk adverse for the baby as in it is planned, relatively quick and hyper managed . however, the longterm health of the children born via c/s is not fully understood yet, and studies coming out are concluding mode of birth does have an impact on the health of babies and children, meaning vaginal birth overall, population based have greater health benefits for both baby and mother. C/S babies have increased need of stays in NICU, increased difficulty with early breastfeeding, less diversity in the babies microbiome, Plus all the psycho-social aspects of wellbeing to consider.

In preparing for this episode I found a great resource for parents who baby is in breech position after 36 weeks. Go to www.breechbirth.net it is AU and NZ based site.

www.sarawickham.com has a number of articles on breech birth, including on the Term Breech Trial, and also on c/s.

Www.midwifethinking.com and

www.evidencedbasedbirth.com

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin 2019
www.pbbmedia.org]]>https://api.spreaker.com/episode/17077406Mon, 18 Feb 2019 20:23:22 +0000PBB Media IncorporatedThis episode we have a birth story for you. Being a Pregnancy Birth and Beyond show, we don't actually have a lot of birth stories on the show, so this is a real treat. There is a wide range of birth stories from horror stories to empowerment stories...

Our guest is Jazzie and Lessie (Jazzie's mum, and now a grandmother). Jazzie's pregnancy might have begun like many other first time parents. Jazzie had what is refereed to as low risk pregnancy. Meaning she had no health considerations that could potentially negativity impact on her labour or baby. However sometimes the unexpected happens.

This episode we hear not only about Jazzie breech vaginal birth in hospital but also about her decision making, the kind of care she received, what helped and what didn't and more here on Pregnancy Birth and Beyond media.

How common is the breech position?
Breech position, which is bottom first, accounts for 3% to 4% of term pregnancies.
Breech positioning is more common in preterm babies with 25% in breech position at 28 weeks,
The majority of breech babies born in western industrialised cultures including Australia are born by elective or planned Cesarean.

If your baby is breech, what choices do you have:
Every situation is different, some breech births are more favorable to a vaginal birth than others.
You get to decide what is best for you and your baby.
Your options are:
planned caesarean section
attempt vaginal birth

There are studies on breech birth, for example Term Breech Trial and the Pre-MODA study which both had some different concluding results. So a breech birth presents with potential risks for the baby, this could be the type of breech, or other identified risk factors for example intrauterine growth restriction, which is a very small baby for its gestational age and parents genetic disposition. And further to the safety of vaginal breech birth is the competency of the care provider. When a healthcare provider is skilled at breech birth it is, according to Pre-MODA study, just as safe to have a vaginal breech birth as it is to have a C/S and you also have to consider the long term health implications and not just the short term. So in a short term, you could view a planned c/s as less risk adverse for the baby as in it is planned, relatively quick and hyper managed . however, the longterm health of the children born via c/s is not fully understood yet, and studies coming out are concluding mode of birth does have an impact on the health of babies and children, meaning vaginal birth overall, population based have greater health benefits for both baby and mother. C/S babies have increased need of stays in NICU, increased difficulty with early breastfeeding, less diversity in the babies microbiome, Plus all the psycho-social aspects of wellbeing to consider.

In preparing for this episode I found a great resource for parents who baby is in breech position after 36 weeks. Go to www.breechbirth.net it is AU and NZ based site.

www.sarawickham.com has a number of articles on breech birth, including on the Term Breech Trial, and also on c/s.

Www.midwifethinking.com and

www.evidencedbasedbirth.com

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin 2019
www.pbbmedia.org]]>2102birth,breechbirth,childbirth,motherhoodfalsefullStrength in Vulnerability: Masculinity and Emotionshttps://www.spreaker.com/episode/strength-in-vulnerability-masculinity-and-emotions--17029942
Together we will reflect on our experience of working with men and, as men, explore the notion that vulnerability takes courage and bravery. A strength essential for our children in a new world

First aired on 99.9 Bay FM in Byron Bay on 4th February 2019.

Produced and presented by Sean Tonnet
Copyright 2019 PBB Media and Sean Tonnet
www.pbbmedia.org]]>https://api.spreaker.com/episode/17029942Wed, 13 Feb 2019 10:28:50 +0000PBB Media IncorporatedThe Strength in Vulnerability: For too long Men - fathers, sons, and brothers - have learned that it's better to suppress than express. Emotions, especially vulnerable ones, have been tightly wrapped up in our high-vis shirts as ‘too weak, too...
Together we will reflect on our experience of working with men and, as men, explore the notion that vulnerability takes courage and bravery. A strength essential for our children in a new world

First aired on 99.9 Bay FM in Byron Bay on 4th February 2019.

Produced and presented by Sean Tonnet
Copyright 2019 PBB Media and Sean Tonnet
www.pbbmedia.org]]>1671emotions,fathering,healthymasculinity,masculinity,parenting,vulnerabilityfalsefullExtras: We want Midwifery-Led Continuity of Care! The women have their say - Part 1https://www.spreaker.com/episode/extras-we-want-midwifery-led-continuity-of-care-the-women-have-their-say-part-1--17006777More information at: http://www.pbbmedia.org/add-your-voice.html

You can add your voice to this campaign by recording your statement about the need for midwifery-led continuity of care, post it to social media and use the tags #SaveAussieMLCoC and #AusPol.

Copyright PBB Media and Sally Cusack 2019
www.pbbmedia.org]]>https://api.spreaker.com/episode/17006777Mon, 11 Feb 2019 04:02:10 +0000PBB Media IncorporatedRecorded at Mullum Community Gardens on 10 February 2019 by Sally Cusack. More information at: http://www.pbbmedia.org/add-your-voice.html You can add your voice to this campaign by recording your statement about the need for midwifery-led continuity...More information at: http://www.pbbmedia.org/add-your-voice.html

You can add your voice to this campaign by recording your statement about the need for midwifery-led continuity of care, post it to social media and use the tags #SaveAussieMLCoC and #AusPol.

Copyright PBB Media and Sally Cusack 2019
www.pbbmedia.org]]>451auspol,birth,pregnancy,saveaussiemlcocfalsefullExtras: Qualities for Step Parenting with Erica Angelicahttps://www.spreaker.com/episode/extras-qualities-for-step-parenting-with-erica-angelica--16983142http://luminousyouth.com

Broadcast live on 99.9 BayFM Byron Bay on 28 January 2019
Presenter: Sally Cusack]]>https://api.spreaker.com/episode/16983142Fri, 08 Feb 2019 08:24:27 +0000PBB Media IncorporatedLuminous Youth Project http://luminousyouth.com Broadcast live on 99.9 BayFM Byron Bay on 28 January 2019 Presenter: Sally Cusackhttp://luminousyouth.com

Broadcast live on 99.9 BayFM Byron Bay on 28 January 2019
Presenter: Sally Cusack]]>118falsefullThe Perfection in Being Imperfect Parents with Mee Hee Douglashttps://www.spreaker.com/episode/the-perfection-in-being-imperfect-parents-with-mee-hee-douglas--16980071
With one in 5 Australian adults experiencing depression at some point in their lives, and suicide now being the highest cause of death in young people, healing from our personal trauma and averting it from occurring in the generations behind us is arguably the most important challenge for our times. In this episode of Pregnancy Birth and Beyond we will be exploring if healing and averting trauma is really possible and if so, how we go about it.

Our guest Mee Hee Douglas has dedicated much of her adult life to understanding the influence her early experiences has had on her, leading to specialising in psychoanalytic psychotherapy for children, couples and families.

Mee Hee shares with us how our early experiences impact our adult lives as parents, and that is possible to heal. She also explains the primary task of parents to help our children 'digest' their traumatic experiences and integrate them into their experiences. Through Mee Hee we actually learn how being the "good enough mother" is actually exactly how we should be with our children, as they need some experiences of manageable frustration with the world, combined with knowing we are there to support.

Mee Hee Douglas is a psychoanalytic psychotherapist based in Bangalow, NSW. You can find her at www.meeheedouglas.com.

References:
Tavistok Clinic series: "Your child at xxx (1, 2, etc)"
Finding Your Way with Your Baby: The emotional life of parents and babies by Dilys Daws
Dr Donald Winnecot - "the good enough mother"
other info: www.letsgrowkids.org, Dr Allan Schore

First aired live at 99.9 BayFM Byron Bay, Australia 28 January 2019
Copyright PBB Media and Sally Cusack 2019
Presented and produced by Sally Cusack]]>https://api.spreaker.com/episode/16980071Fri, 08 Feb 2019 06:06:39 +0000PBB Media IncorporatedAuthor Pam Leo inspired parents from around the world with her incitation: “Let's raise children who won't have to recover from their childhoods.” With one in 5 Australian adults experiencing depression at some point in their lives, and suicide now...
With one in 5 Australian adults experiencing depression at some point in their lives, and suicide now being the highest cause of death in young people, healing from our personal trauma and averting it from occurring in the generations behind us is arguably the most important challenge for our times. In this episode of Pregnancy Birth and Beyond we will be exploring if healing and averting trauma is really possible and if so, how we go about it.

Our guest Mee Hee Douglas has dedicated much of her adult life to understanding the influence her early experiences has had on her, leading to specialising in psychoanalytic psychotherapy for children, couples and families.

Mee Hee shares with us how our early experiences impact our adult lives as parents, and that is possible to heal. She also explains the primary task of parents to help our children 'digest' their traumatic experiences and integrate them into their experiences. Through Mee Hee we actually learn how being the "good enough mother" is actually exactly how we should be with our children, as they need some experiences of manageable frustration with the world, combined with knowing we are there to support.

Mee Hee Douglas is a psychoanalytic psychotherapist based in Bangalow, NSW. You can find her at www.meeheedouglas.com.

References:
Tavistok Clinic series: "Your child at xxx (1, 2, etc)"
Finding Your Way with Your Baby: The emotional life of parents and babies by Dilys Daws
Dr Donald Winnecot - "the good enough mother"
other info: www.letsgrowkids.org, Dr Allan Schore

First aired live at 99.9 BayFM Byron Bay, Australia 28 January 2019
Copyright PBB Media and Sally Cusack 2019
Presented and produced by Sally Cusack]]>1671goodenoughmother,parenting,psychoanalyticpsychotherapyfalsefullEmbodied Feminine Leadership with Lisa Fitzpatrickhttps://www.spreaker.com/episode/embodied-feminine-leadership-with-lisa-fitzpatrick--16899890
And while this episode focuses the lens on woman, there are some phenomenal men and gender fluid people out there standing and supporting woman and fighting hard for the betterment of us all.

So who is Lisa Fitzpatrick? Lisa is the go-to spiritual business coach for high-achieving, soulful, entrepreneurial leaders and coaches who have a powerful message. She is a specialist in embodied feminine leadership, mindfulness in leadership, women’s physiology for empowerment and sustainable business practices. Lisa believes that when women tap into their feminine wisdom and embody full, mindful presence, the feminine shift restores balance and equality and helps to heal our troubled world.
Lisa is a certified coach, experienced keynote speaker, best-selling author, yoga teacher, workshop facilitator, physiotherapist and mother. She lives in a subtropical paradise near Byron Bay.

Producer and host: Lara Martin
Guest: Lisa Fitzpatrick lisafitzpatrick.com.au
Copy right: PBBmedia, Lara Martin]]>https://api.spreaker.com/episode/16899890Fri, 01 Feb 2019 03:39:49 +0000PBB Media IncorporatedThis episode we feature an talk on Embodied Feminine Leadership with Lisa Fitzpatrick. This is a timely episode, 2018 was a big year for woman claiming their voice, speaking up to injustices that have been cast upon them for decades. We saw the rise...
And while this episode focuses the lens on woman, there are some phenomenal men and gender fluid people out there standing and supporting woman and fighting hard for the betterment of us all.

So who is Lisa Fitzpatrick? Lisa is the go-to spiritual business coach for high-achieving, soulful, entrepreneurial leaders and coaches who have a powerful message. She is a specialist in embodied feminine leadership, mindfulness in leadership, women’s physiology for empowerment and sustainable business practices. Lisa believes that when women tap into their feminine wisdom and embody full, mindful presence, the feminine shift restores balance and equality and helps to heal our troubled world.
Lisa is a certified coach, experienced keynote speaker, best-selling author, yoga teacher, workshop facilitator, physiotherapist and mother. She lives in a subtropical paradise near Byron Bay.

Producer and host: Lara Martin
Guest: Lisa Fitzpatrick lisafitzpatrick.com.au
Copy right: PBBmedia, Lara Martin]]>2216falsefullHealing from Birth with Rachana Shivamhttps://www.spreaker.com/episode/healing-from-birth-with-rachana-shivam--16817900
Rachana first became a mother in the mid ‘70s during the winds of change for birth in Australia. As you will hear from Rachana it was a very charged and hopeful time for those advocating for families in birth.

Unfortunately Rachana still sees a lot of parallels with how birth is managed even 40 years later, but during her lengthy and sustained journey she and her colleagues have paved the way for a lot of what we now take for granted in birth, all of which was thought to be crazy at the time: Waterbirth, self-hypnosis and breathing methods for pain management during labour, preparing for birth by examining our own births through rebirthing, Leboyer birth where the focus is on supporting the mother/baby dyad’s process rather than intervening in it.

Rachana shares her experiences of birth and early years of childbirth advocacy.

Other references:
- Rachana Shivam - www.lotusbirth.net
- Prophylactic method for pain relief, also known as the Lamaze Method.
- Dr Graham Farrant, http://www.primal-page.com/gfobit.htm
- Dr Frederick Leboyer, author of Birth Without Violence
- Arthur Janov “Primal Therapy” “The Feeling Child” http://www.primaltherapy.com
- Association For Prenatal And Perinatal Psychology And Health https://birthpsychology.com/
- Another link of interest: "Don’t Cut Baby’s Cord - We Can Be Much Kinder" https://vimeo.com/21315581

A warning if you have children listening, there is brief mention of the old practice of operating on children without anaesthesia (at approx 13’30”), and experiencing orgasm in birth at approx 22’20”.

Produced and presented by Sally Cusack 2019
Copyright PBB Media and Sally Cusack 2019
www.pbbmedia.org]]>https://api.spreaker.com/episode/16817900Wed, 23 Jan 2019 04:21:43 +0000PBB Media IncorporatedIn this episode we speak with Rachana Shivam, mother, grandmother, pioneering childbirth educator and advocate for families, doula, primal healing practitioner, principal of the International College of Spiritual Midwifery and author of the leading...
Rachana first became a mother in the mid ‘70s during the winds of change for birth in Australia. As you will hear from Rachana it was a very charged and hopeful time for those advocating for families in birth.

Unfortunately Rachana still sees a lot of parallels with how birth is managed even 40 years later, but during her lengthy and sustained journey she and her colleagues have paved the way for a lot of what we now take for granted in birth, all of which was thought to be crazy at the time: Waterbirth, self-hypnosis and breathing methods for pain management during labour, preparing for birth by examining our own births through rebirthing, Leboyer birth where the focus is on supporting the mother/baby dyad’s process rather than intervening in it.

Rachana shares her experiences of birth and early years of childbirth advocacy.

Other references:
- Rachana Shivam - www.lotusbirth.net
- Prophylactic method for pain relief, also known as the Lamaze Method.
- Dr Graham Farrant, http://www.primal-page.com/gfobit.htm
- Dr Frederick Leboyer, author of Birth Without Violence
- Arthur Janov “Primal Therapy” “The Feeling Child” http://www.primaltherapy.com
- Association For Prenatal And Perinatal Psychology And Health https://birthpsychology.com/
- Another link of interest: "Don’t Cut Baby’s Cord - We Can Be Much Kinder" https://vimeo.com/21315581

A warning if you have children listening, there is brief mention of the old practice of operating on children without anaesthesia (at approx 13’30”), and experiencing orgasm in birth at approx 22’20”.

Produced and presented by Sally Cusack 2019
Copyright PBB Media and Sally Cusack 2019
www.pbbmedia.org]]>1671falsefullMy Dad and I: Masculinity & Fatherhood. Part Twohttps://www.spreaker.com/episode/my-dad-and-i-masculinity-fatherhood-part-two--16671985
Note: Apologies for some audio 'hiss' during parts of the podcast.

Resources Mentioned in Podcast:

1. Family Media Plan - www.healthychildren.org/english/media/Pages/default.aspx
2. Brenne Brown on Vulnerability - www.ted.com/talks/brene_brown_on_vulnerability
3. Conversations with your dad - www.manhood.com.au/manhood

First aired on 99.9 Bay FM in Byron Bay on 31st December 2018.

Produced and presented by Sean Tonnet
Copyright 2018 PBB Media and Sean Tonnet
www.pbbmedia.org]]>https://api.spreaker.com/episode/16671985Wed, 09 Jan 2019 20:39:00 +0000PBB Media IncorporatedOn this episode, our presenter and PBB dad, Sean Tonnet, will play part 2 of his special feature interview with his 90-year-old father Lex. In this instalment, Lex discusses an emerging spirituality that helped him mature and grow as a man and...
Note: Apologies for some audio 'hiss' during parts of the podcast.

Resources Mentioned in Podcast:

1. Family Media Plan - www.healthychildren.org/english/media/Pages/default.aspx
2. Brenne Brown on Vulnerability - www.ted.com/talks/brene_brown_on_vulnerability
3. Conversations with your dad - www.manhood.com.au/manhood

First aired on 99.9 Bay FM in Byron Bay on 31st December 2018.

Produced and presented by Sean Tonnet
Copyright 2018 PBB Media and Sean Tonnet
www.pbbmedia.org]]>1671fatherhood,fathering,manhood,masculinity,paretning,tonnetfalsefullCompassionate Motherhood with Dr Marion Rosehttps://www.spreaker.com/episode/compassionate-motherhood-with-dr-marion-rose--16596540
In this episode of Pregnancy, Birth and Beyond, we are speaking with Dr Marion Rose, passionate about supporting mothers and babies, Marion’s unique methods have helped thousands of families in feeling more connected, compassionate, present and loving in their relationships.
Supporting women to reconnect with their true loving nature as a mother
and supporting mothers in helping their child stay connected with their connected, compassionate and cooperative self form the bedrock of her work.
Marion has a 30 year background in developmental psychology and psychospiritual psychotherapy, with a Ph.D. from Cambridge University. She has been a University Research Fellow in infant development and has taught The Therapeutic Relationship to M.A. students.
Through her work, she has been supporting mothers with pregnancy, birth and parenting since 2001, becoming an Aware Parenting Instructor in 2005. Marion has two children a 16 year old daughter and an 11 year old son and is a sister mother to two beautiful twins.

First aired on 99.9BayFM in Byron Bay, Australia on December 17th, 2018.
Produced and presented by Annalee Atia with Guest Dr Marion Rose.

For more information about Marion's work head to www.marionrose.net

PBB Media
Contemporary Conversations where Stories, Science, Traditions and New Ideas meet.
www.pbbmedia.org

Copyright PBB Media, Annalee Atia and Dr Marion Rose 2018]]>https://api.spreaker.com/episode/16596540Tue, 01 Jan 2019 00:11:29 +0000PBB Media IncorporatedA new year's gift to Mothers everywhere. In this episode of Pregnancy, Birth and Beyond, we are speaking with Dr Marion Rose, passionate about supporting mothers and babies, Marion’s unique methods have helped thousands of families in feeling more...
In this episode of Pregnancy, Birth and Beyond, we are speaking with Dr Marion Rose, passionate about supporting mothers and babies, Marion’s unique methods have helped thousands of families in feeling more connected, compassionate, present and loving in their relationships.
Supporting women to reconnect with their true loving nature as a mother
and supporting mothers in helping their child stay connected with their connected, compassionate and cooperative self form the bedrock of her work.
Marion has a 30 year background in developmental psychology and psychospiritual psychotherapy, with a Ph.D. from Cambridge University. She has been a University Research Fellow in infant development and has taught The Therapeutic Relationship to M.A. students.
Through her work, she has been supporting mothers with pregnancy, birth and parenting since 2001, becoming an Aware Parenting Instructor in 2005. Marion has two children a 16 year old daughter and an 11 year old son and is a sister mother to two beautiful twins.

First aired on 99.9BayFM in Byron Bay, Australia on December 17th, 2018.
Produced and presented by Annalee Atia with Guest Dr Marion Rose.

For more information about Marion's work head to www.marionrose.net

PBB Media
Contemporary Conversations where Stories, Science, Traditions and New Ideas meet.
www.pbbmedia.org

Copyright PBB Media, Annalee Atia and Dr Marion Rose 2018]]>1671bondedbabies,compassionatemotherhood,developmentalpsychology,motherhood,mothersandbabies,newyear,parenting,pbbmedie,womanspeakfalsefullSurviving Family Time in the Holiday Seasonhttps://www.spreaker.com/episode/surviving-family-time-in-the-holiday-season--16534779
Sally speaks with Dr John Travis in this show about how looking into our shadows we receive the opportunity to transform ourselves and our relationships.

Dr John Travis's previous interview from 2018: https://www.spreaker.com/user/pregnancybirthandbeyond/dr-john-travis-on-transforming-relations

Some resources mentioned:

A popular one in this area is NVC - Non-violent Communication developed by Marshall Rosenberg.

Byron Katie - turning the judgements you have for your family onto yourself

The Mankind Project helps men deal with their shadows. There a similar program for women,

Susan Campbell author of The 5 Minute Relationship Repair offers tools for eating your shadow.

Lifeline.org.au and Beyondblue.org.au and PANDA.org.au. Lifeline ph: 13 11 14

++++++++++

First aired on 99.9 Bay FM in Byron Bay on 10 December 2018.

Produced and presented by Sally Cusack
Copyright 2018 PBB Media and Sally Cusack
www.pbbmedia.org]]>https://api.spreaker.com/episode/16534779Thu, 20 Dec 2018 23:46:17 +0000PBB Media IncorporatedFor many families, time spent together in the festive season can actually trigger old patterns of behaviour that lead to stress and discomfort. These old patterns are seen by some as manifestations of the “shadows” in our personality, and that if...
Sally speaks with Dr John Travis in this show about how looking into our shadows we receive the opportunity to transform ourselves and our relationships.

Dr John Travis's previous interview from 2018: https://www.spreaker.com/user/pregnancybirthandbeyond/dr-john-travis-on-transforming-relations

Some resources mentioned:

A popular one in this area is NVC - Non-violent Communication developed by Marshall Rosenberg.

Byron Katie - turning the judgements you have for your family onto yourself

The Mankind Project helps men deal with their shadows. There a similar program for women,

Susan Campbell author of The 5 Minute Relationship Repair offers tools for eating your shadow.

Lifeline.org.au and Beyondblue.org.au and PANDA.org.au. Lifeline ph: 13 11 14

++++++++++

First aired on 99.9 Bay FM in Byron Bay on 10 December 2018.

Produced and presented by Sally Cusack
Copyright 2018 PBB Media and Sally Cusack
www.pbbmedia.org]]>1671fatherhood,manhood,ourshadows,parenting,shadowwork,survivingholidayswithfamilyfalsefullA New Zealand Midwife talks Australian Maternity Carehttps://www.spreaker.com/episode/a-new-zealand-midwife-talks-australian-maternity-care--16508315
The systems and policies that make up our maternity healthcare are currently, being reviewed and many of the stakeholders are adding in their advice, experience and opinions on where Maternity should be headed. As consumers, we sit at the heart of the discussion, it is after all, us that foots the bill and us that is affected in the short and long-term from the care we receive or don't receive.

Add your voice to the conversation by making it clear to our healthcare services and the Australian government that you want access to universal, Quality, Midwife-Led, Continuity of Care nearby where you live - https://bit.ly/2GgUCXy

Join us for a lively discussion on where we are at and some of the challenges we have in moving forward.

For more information about PBB Media and our work, head to www.pbbmedia.org

Produced and Presented by Annalee Atia.
Copyright PBB Media and Annalee Atia 2018
www,pbbmedia.org]]>https://api.spreaker.com/episode/16508315Tue, 18 Dec 2018 03:39:53 +0000PBB Media IncorporatedIn this episode of Pregnancy, Birth and Beyond we speak with Angel Temple, a New Zealand trained midwife with postgraduate education in Gender studies. Practising in Australia for the past two years as a remote rural midwife Angel is in a unique...
The systems and policies that make up our maternity healthcare are currently, being reviewed and many of the stakeholders are adding in their advice, experience and opinions on where Maternity should be headed. As consumers, we sit at the heart of the discussion, it is after all, us that foots the bill and us that is affected in the short and long-term from the care we receive or don't receive.

Add your voice to the conversation by making it clear to our healthcare services and the Australian government that you want access to universal, Quality, Midwife-Led, Continuity of Care nearby where you live - https://bit.ly/2GgUCXy

Join us for a lively discussion on where we are at and some of the challenges we have in moving forward.

For more information about PBB Media and our work, head to www.pbbmedia.org

Produced and Presented by Annalee Atia.
Copyright PBB Media and Annalee Atia 2018
www,pbbmedia.org]]>1671auspol,australianmidwives,birth,childbirth,consumerengagement,healthcare,maternityadvocacy,maternitycareaustralia,midwifery,motherhood,mothershealth,parenting,pregnancy,womenshealthfalsefullDad and I: Sean and Lex Tonnethttps://www.spreaker.com/episode/dad-and-i-sean-and-lex-tonnet--16399967
First aired on 99.9 BayFM Byron Bay Australia on Monday 26 November 2018.
Copyright PBB Media and Sean Tonnet 2018
www.pbbmedia.org]]>https://api.spreaker.com/episode/16399967Thu, 06 Dec 2018 10:09:08 +0000PBB Media IncorporatedExploring healthy masculinity and aware fathering has always led this presenter, with curiosity, back to his own dad. Like many men, wanting to understand more about their dad is an important space for understanding their own masculinty and in...
First aired on 99.9 BayFM Byron Bay Australia on Monday 26 November 2018.
Copyright PBB Media and Sean Tonnet 2018
www.pbbmedia.org]]>1671dad,fatherhood,masculinity,mentalhealth,parenting,sonfalsefullFestive Season Inductions of Labour: The risks, your rights and tools to helphttps://www.spreaker.com/episode/festive-season-inductions-of-labour-the-risks-your-rights-and-tools-to-help--16348186
Guests:
Shari Lyon, Belly 2 Birth Hypnobirthing
Professor John Newnham, The Whole Nine Months
Dr Sarah Buckley (recorded at the Midwifery Today Conference in 2014)

References: Why Induction Matters by Dr Rachel Reed

Further help:
12 Questions to ask your Ob from birthsavvy.com.au
Induction Matters with Dr Rachel Reed: https://www.spreaker.com/user/pregnancybirthandbeyond/induction-matters-with-dr-rachel-reed
A Baby on the Way, in particular episode 3: www.pbbmedia.org/ababyontheway.html

Podcast with Dr Sarah Buckley: https://www.spreaker.com/user/pregnancybirthandbeyond/iwd2015-drsarahbuckley-birth-hormones

Using "chance" rather than "risk" can also remove the fear from decision making: https://www.birthsavvy.com.au/stillbirth-risk/

Producer and presenter: Sally Cusack
Copyright 2018 PBB Media and Sally Cusack
www.pbbmedia.org]]>https://api.spreaker.com/episode/16348186Fri, 30 Nov 2018 10:25:04 +0000PBB Media IncorporatedSpecial festive season episode in response to issue raised by Shari Lyon Hypnobirthing educator from Gold Coast, Qld. Guests: Shari Lyon, Belly 2 Birth Hypnobirthing Professor John Newnham, The Whole Nine Months Dr Sarah Buckley (recorded at the...
Guests:
Shari Lyon, Belly 2 Birth Hypnobirthing
Professor John Newnham, The Whole Nine Months
Dr Sarah Buckley (recorded at the Midwifery Today Conference in 2014)

References: Why Induction Matters by Dr Rachel Reed

Further help:
12 Questions to ask your Ob from birthsavvy.com.au
Induction Matters with Dr Rachel Reed: https://www.spreaker.com/user/pregnancybirthandbeyond/induction-matters-with-dr-rachel-reed
A Baby on the Way, in particular episode 3: www.pbbmedia.org/ababyontheway.html

Podcast with Dr Sarah Buckley: https://www.spreaker.com/user/pregnancybirthandbeyond/iwd2015-drsarahbuckley-birth-hormones

Using "chance" rather than "risk" can also remove the fear from decision making: https://www.birthsavvy.com.au/stillbirth-risk/

Producer and presenter: Sally Cusack
Copyright 2018 PBB Media and Sally Cusack
www.pbbmedia.org]]>1095birth,induction,intervention,pregnancy,pretermbirthfalsefullHow Infant Massage and Baby Wearing help your Baby Learnhttps://www.spreaker.com/episode/how-infant-massage-and-baby-wearing-help-your-baby-learn--16345196
References:
INFANT MASSAGE -
* Vimala McClure https://www.iaim.net/vimala-mcclure-the-early-years-part-1-of-7/
* http://babyinmind.org.au
* Esther Perez: eperezcapebyronmedical.com.au

BABY WEARING -
* Adrienne Megan Lester: babysteps2betterhealth.com.au
* babywearing information sources:

Australia:

Babywearing Consultations – NON-SALES ADVICE
https://babysteps2betterhealth.com.au/babywearing.html

The Babywearing Practice (stocking ONLY standardised carriers & wraps)

http://thebabywearingpractice.com.au

Brooke Maree – qualified independent consultant/retail stockist (most appear to be standardised, please check with her if purchasing)

https://brookemaree.com.au

Manduca – only carrier sold in Australian shops that meets international safety standards to Adrienne's knowledge

https://manduca.com.au/pages/about-manduca-carriers-and-slings

UK

New Parent Support

https://www.nct.org.uk/sites/default/files/related_documents/Messager%20Babywearing%20slings%20pull%20out_0.pdf

School of Babywearing

http://www.schoolofbabywearing.com/babywearing/babywearing-guide/

European safety standards:

https://www.en-standard.eu/csn-en-13209-2-child-use-and-care-articles-baby-carriers-safety-requirements-and-test-methods-part-2-soft-carrier-2/

++++++++++

First aired on 99.9 Bay FM in Byron Bay on 19 November 2018.

Produced and presented by Sally Cusack
Copyright 2018 PBB Media and Sally Cusack
www.pbbmedia.org]]>https://api.spreaker.com/episode/16345196Fri, 30 Nov 2018 01:32:51 +0000PBB Media IncorporatedEsther Perez and Adrienne Megan Lester speak with Sally about the benefits of infant massage and baby wearing - for bonding, enhancing communication and optimising infant development. Also discussed is guidelines for finding a safe carrier for your...
References:
INFANT MASSAGE -
* Vimala McClure https://www.iaim.net/vimala-mcclure-the-early-years-part-1-of-7/
* http://babyinmind.org.au
* Esther Perez: eperezcapebyronmedical.com.au

BABY WEARING -
* Adrienne Megan Lester: babysteps2betterhealth.com.au
* babywearing information sources:

Australia:

Babywearing Consultations – NON-SALES ADVICE
https://babysteps2betterhealth.com.au/babywearing.html

The Babywearing Practice (stocking ONLY standardised carriers & wraps)

http://thebabywearingpractice.com.au

Brooke Maree – qualified independent consultant/retail stockist (most appear to be standardised, please check with her if purchasing)

https://brookemaree.com.au

Manduca – only carrier sold in Australian shops that meets international safety standards to Adrienne's knowledge

https://manduca.com.au/pages/about-manduca-carriers-and-slings

UK

New Parent Support

https://www.nct.org.uk/sites/default/files/related_documents/Messager%20Babywearing%20slings%20pull%20out_0.pdf

School of Babywearing

http://www.schoolofbabywearing.com/babywearing/babywearing-guide/

European safety standards:

https://www.en-standard.eu/csn-en-13209-2-child-use-and-care-articles-baby-carriers-safety-requirements-and-test-methods-part-2-soft-carrier-2/

++++++++++

First aired on 99.9 Bay FM in Byron Bay on 19 November 2018.

Produced and presented by Sally Cusack
Copyright 2018 PBB Media and Sally Cusack
www.pbbmedia.org]]>1671babywearing,birth,infantmassage,parenting,pregnancyfalsefullFrom student midwife to graduation, what it's like studying midwifery in Australiahttps://www.spreaker.com/episode/from-student-midwife-to-graduation-what-it-s-like-studying-midwifery-in-australia--16298587Aired live on 99.9 BayFm, Byron Bay, November 12th 2018.
Host and producer Lara Martin
Copyright PBB Media, Lara Martin. 2018]]>https://api.spreaker.com/episode/16298587Sat, 24 Nov 2018 08:55:24 +0000PBB Media IncorporatedThis episode we take you on a journey through studying midwifery to graduation with newly graduated midwife Rosie. We hear first hand what it is like to be a student midwife, your options to becoming a midwife in Australia and much more. Aired live...Aired live on 99.9 BayFm, Byron Bay, November 12th 2018.
Host and producer Lara Martin
Copyright PBB Media, Lara Martin. 2018]]>1646birth,midwife,pregnancy,studentmidwifefalsefullSpeak Up! Postpartum and Antenatal Depression and Anxiety in Dadshttps://www.spreaker.com/episode/speak-up-postpartum-and-antenatal-depression-and-anxiety-in-dads--16233290
Pregnancy and the first year of parenthood is an exciting time that also brings many new challenges and responsibilities. It is now recognised that around 1 in 20 men experience depression during pregnancy (antenatal) and up to 1 in 10 new dads struggle with depression following the birth of their baby (postnatal). Anxiety is just as common, and many men experience anxiety and depression at the same time (sourced from PANDA.org.au). It’s these facts that inspired my guest, Dr Matthew Roberts in his work with men experiencing perinatal and antenatal, anxiety and depression. Though initiatives such as Town hall Dads and My Doctors Handwriting, Matthew is connecting fathers, building awareness and redefining the landscape for new parents.

A warning to listeners that this interview discusses mental health topics that may cause distress to some listeners, If you need support or your worried about someone you love, reach out to:

IF YOU NEED TO TALK TO SOMEONE, CALL:
Lifeline on 13 11 14
PANDA on 1300 726 306
MensLine Australia on 1300 789 978
Suicide Call Back Service on 1300 659 467
Beyond Blue on 1300 22 46 36

++++

List of references (eg book titles/websites mentioned)
1. Town Hall Dads
https://townhalldads.com

2. My Doctors Handwritting
https://mydoctorshandwriting.com

3. PANDA
https://www.panda.org.au

4. The Dad Factor - Richard Fletcher
https://www.booktopia.com.au/the-dad-factor-richard-fletcher/prod9781921462139.html?gclid=Cj0KCQiA8f_eBRDcARIsAEKwRGd7EKm0SJdfUyk6WiirkJ7noWvBcPJMzxoiLwAHlEG_L2lJCWhueacaAumiEALw_wcB

5. Dad Group Incorporated
https://dadsgroup.org

6. Man- Up Documentary
http://manup.org.au

Daniel Stern: https://en.wikipedia.org/wiki/Daniel_Stern_(psychologist)

++++

First aired on 99.9 BayFM on 5 November 2018

Copyright PBB Media and Sean Tonnet 2018]]>https://api.spreaker.com/episode/16233290Thu, 15 Nov 2018 22:48:24 +0000PBB Media IncorporatedRecognising, responding to and repairing postpartum and antenatal depression and anxiety in dads. Pregnancy and the first year of parenthood is an exciting time that also brings many new challenges and responsibilities. It is now recognised that...
Pregnancy and the first year of parenthood is an exciting time that also brings many new challenges and responsibilities. It is now recognised that around 1 in 20 men experience depression during pregnancy (antenatal) and up to 1 in 10 new dads struggle with depression following the birth of their baby (postnatal). Anxiety is just as common, and many men experience anxiety and depression at the same time (sourced from PANDA.org.au). It’s these facts that inspired my guest, Dr Matthew Roberts in his work with men experiencing perinatal and antenatal, anxiety and depression. Though initiatives such as Town hall Dads and My Doctors Handwriting, Matthew is connecting fathers, building awareness and redefining the landscape for new parents.

A warning to listeners that this interview discusses mental health topics that may cause distress to some listeners, If you need support or your worried about someone you love, reach out to:

IF YOU NEED TO TALK TO SOMEONE, CALL:
Lifeline on 13 11 14
PANDA on 1300 726 306
MensLine Australia on 1300 789 978
Suicide Call Back Service on 1300 659 467
Beyond Blue on 1300 22 46 36

++++

List of references (eg book titles/websites mentioned)
1. Town Hall Dads
https://townhalldads.com

2. My Doctors Handwritting
https://mydoctorshandwriting.com

3. PANDA
https://www.panda.org.au

4. The Dad Factor - Richard Fletcher
https://www.booktopia.com.au/the-dad-factor-richard-fletcher/prod9781921462139.html?gclid=Cj0KCQiA8f_eBRDcARIsAEKwRGd7EKm0SJdfUyk6WiirkJ7noWvBcPJMzxoiLwAHlEG_L2lJCWhueacaAumiEALw_wcB

5. Dad Group Incorporated
https://dadsgroup.org

6. Man- Up Documentary
http://manup.org.au

Daniel Stern: https://en.wikipedia.org/wiki/Daniel_Stern_(psychologist)

++++

First aired on 99.9 BayFM on 5 November 2018

Copyright PBB Media and Sean Tonnet 2018]]>1671anxiety,birth,depression,fatherhood,mentalhealth,parenting,pregnancyfalsefullPatreon Episode: Waterbirth for VBAC Part 2 of 2https://www.spreaker.com/episode/patreon-episode-waterbirth-for-vbac-part-2-of-2--16213929
Bethan Townsend speaks with Caroline Jackson about her birth story of VBAC in water, and Annalise again, as well as Dr Kirsten Small, obstetrician/gynaecologist.]]>https://api.spreaker.com/episode/16213929Wed, 14 Nov 2018 03:44:37 +0000PBB Media IncorporatedSecond half of PBB Talks: Waterbirth for VBAC, recorded at Gold Coast Univ. Hospital on 10 November 2018. Bethan Townsend speaks with Caroline Jackson about her birth story of VBAC in water, and Annalise again, as well as Dr Kirsten Small,...
Bethan Townsend speaks with Caroline Jackson about her birth story of VBAC in water, and Annalise again, as well as Dr Kirsten Small, obstetrician/gynaecologist.]]>3195birth,pregnancy,vbac,waterbirthfalsefullPatreon Episode: Waterbirth for VBAC Part 1 of 2https://www.spreaker.com/episode/patreon-episode-waterbirth-for-vbac-part-1-of-2--16213909
Annalise Bradford (at 32 mins in) shares her experience of VBAC in water after 2 c/sections.]]>https://api.spreaker.com/episode/16213909Wed, 14 Nov 2018 03:37:11 +0000PBB Media IncorporatedBethan Townsend presents the evidence regarding VBAC then her research into women's experiences of VBAC in water. Annalise Bradford (at 32 mins in) shares her experience of VBAC in water after 2 c/sections.
Annalise Bradford (at 32 mins in) shares her experience of VBAC in water after 2 c/sections.]]>2653birth,pregnancy,vbac,waterbirthfalsefullIs Vaginal Birth after Caesarean an Option for me?https://www.spreaker.com/episode/is-vaginal-birth-after-caesarean-an-option-for-me--16174494
Sally speaks with midwife and Griffith Univ PhD student Bethan Townsend about Vaginal Birth After Caesarean (VBAC), the risks and recommendations to help achieve it.

Kimberley Lipschus also shares her experience of VBAC pregnancy and birth.

Thank you to Kimberley and Bethan for this episode!

First aired on 99.9 BayFM Byron Bay on Monday 5 November 2018.
Produced and Presented by Sally Cusack
Copyright 2018 Sally Cusack, PBB Media
www.pbbmedia.org

PHOTO CREDIT: Rana Rankin, Breathe Photography, shared with permission. NOTE: This is NOT Kimberley.]]>https://api.spreaker.com/episode/16174494Fri, 09 Nov 2018 04:04:31 +0000PBB Media IncorporatedMore than one third of Australian birthing parents undergo a caesarean section for the birth of their babies, and most of those happen to first time parents. So what are the options for future pregnancies? Is a second caesarean the only way, or are...
Sally speaks with midwife and Griffith Univ PhD student Bethan Townsend about Vaginal Birth After Caesarean (VBAC), the risks and recommendations to help achieve it.

Kimberley Lipschus also shares her experience of VBAC pregnancy and birth.

Thank you to Kimberley and Bethan for this episode!

First aired on 99.9 BayFM Byron Bay on Monday 5 November 2018.
Produced and Presented by Sally Cusack
Copyright 2018 Sally Cusack, PBB Media
www.pbbmedia.org

PHOTO CREDIT: Rana Rankin, Breathe Photography, shared with permission. NOTE: This is NOT Kimberley.]]>1671birth,pbbtalks,pregnancy,vbac,waterbirthforvbacfalsefullFrom midwifery to trauma healing: One woman's journeyhttps://www.spreaker.com/episode/from-midwifery-to-trauma-healing-one-woman-s-journey--16108815
Guest is Angela Fitzgerald. Website https://birthyourtruth.com/

First aired on 99.9 BayFM Byron Bay on 22 October 2018

Copyright PBB Media and Kimberley Lipschus 2018
www.pbbmedia.org
www.kimberleylipschus.com
++++++

If you would like to support our volunteer-run and not for profit project, head over to www.patreon.com/pbbmedia and you can pledge as little as $2 per month.
Or you can review us on iTunes or at Facebook: Pregnancy Birth and Beyond Media

Thank you for your support!]]>https://api.spreaker.com/episode/16108815Thu, 01 Nov 2018 08:31:05 +0000PBB Media IncorporatedAs a midwife, Angela Fitzgerald found she wanted to honour women’s birthing stories more than on the day they give birth. Now working in private practice with women who struggle with their own births, Angela finds the way we birth is not only the way...
Guest is Angela Fitzgerald. Website https://birthyourtruth.com/

First aired on 99.9 BayFM Byron Bay on 22 October 2018

Copyright PBB Media and Kimberley Lipschus 2018
www.pbbmedia.org
www.kimberleylipschus.com
++++++

If you would like to support our volunteer-run and not for profit project, head over to www.patreon.com/pbbmedia and you can pledge as little as $2 per month.
Or you can review us on iTunes or at Facebook: Pregnancy Birth and Beyond Media

Thank you for your support!]]>1660birth,doula,healyourbirth,midwife,midwiferyfalsefullAre you a doula? Your top questions answered with Anna Wattshttps://www.spreaker.com/episode/are-you-a-doula-your-top-questions-answered-with-anna-watts--16037863
Guest is Anna Watts. Website www.celebrationofbirth.com
Doula Conference Retreat: www.doulaconference.com.au

First aired on 99.9 BayFM Byron Bay on 15th of October 2018

Copyright PBB Media and Lara Martin 2018
www.pbbmedia.org
++++++

If you would like to support our volunteer-run and not for profit project, head over to www.patreon.com/pbbmedia and you can pledge as little as $2 per month.
Or you can review us on iTunes or at Facebook: Pregnancy Birth and Beyond Media

Thank you for your support!]]>https://api.spreaker.com/episode/16037863Wed, 24 Oct 2018 03:21:25 +0000PBB Media IncorporatedAre you a doula (birth companion)? Being a doula isn't all roses and babies, sometimes it is tough and burnout can be frequent. This episode of PBB I ask Anna Watts, Celebration of Birth Doula Academy founder and trainer, the top questions asked by...
Guest is Anna Watts. Website www.celebrationofbirth.com
Doula Conference Retreat: www.doulaconference.com.au

First aired on 99.9 BayFM Byron Bay on 15th of October 2018

Copyright PBB Media and Lara Martin 2018
www.pbbmedia.org
++++++

If you would like to support our volunteer-run and not for profit project, head over to www.patreon.com/pbbmedia and you can pledge as little as $2 per month.
Or you can review us on iTunes or at Facebook: Pregnancy Birth and Beyond Media

Thank you for your support!]]>1777birth,doula,naturalbirthinhospitalfalsefullHow Borderline Personality Disorder can look like PNDhttps://www.spreaker.com/episode/how-borderline-personality-disorder-can-look-like-pnd--16019744
Borderline Personality disorder comes with a lot of stigma. Yet Dr Anne Sved-WIlliams began to see themes from many of the new mothers who were coming into her treatment centre for Post Natal Depression and Anxiety and a bell went off. Together with a team from Helen Mayo House in South Australia, they looked closer and discovered many of the mothers showed traits of this mental illness which was being misdiagnosed as Post Natal Depression. After a number of years they developed a program for women that has just run it’s pilot program to outstanding success. Here Kimberley Lipschus finds out more from our guest Dr Anne Sved Williams.

REFERENCES.

For more information on Dr Anne Sved-William’s book, Meltdown Moments, go to:
https://wchfoundation.org.au/meltdownmoments/

Fore more about Helen Mayo House generally:http://www.wch.sa.gov.au/services/az/divisions/mentalhealth/helenmayo/index.html

Although MI-DBT is a research-based group, there is more information to be found here.
http://bpdsa.com.au/wordpress/wp-content/uploads/2016/12/Central-Adelaide-1.pdf

If you feel this conversation has triggered something for you, please contact PBB media directly and we’ll endeavour to find you a therapist near you.

You can also contact Lifeline on 13 11 14 and Beyond Blue on 1300 22 4636.

+++++++++++

First aired on 99.9 BayFM Byron Bay on 8 October 2018

Copyright PBB Media and Kimberley Lipschus 2018
www.pbbmedia.org
www.kimberleylipschus.com

++++++

If you would like to support our volunteer-run and not for profit project, head over to www.patreon.com/pbbmedia and you can pledge as little as $2 per month.
Or you can review us on iTunes or at Facebook: Pregnancy Birth and Beyond Media

Thank you for your support!]]>https://api.spreaker.com/episode/16019744Mon, 22 Oct 2018 07:58:08 +0000PBB Media IncorporatedMistaking Postnatal Depression for Borderline Personality Disorder - It's more common than you might think. Borderline Personality disorder comes with a lot of stigma. Yet Dr Anne Sved-WIlliams began to see themes from many of the new mothers who...
Borderline Personality disorder comes with a lot of stigma. Yet Dr Anne Sved-WIlliams began to see themes from many of the new mothers who were coming into her treatment centre for Post Natal Depression and Anxiety and a bell went off. Together with a team from Helen Mayo House in South Australia, they looked closer and discovered many of the mothers showed traits of this mental illness which was being misdiagnosed as Post Natal Depression. After a number of years they developed a program for women that has just run it’s pilot program to outstanding success. Here Kimberley Lipschus finds out more from our guest Dr Anne Sved Williams.

REFERENCES.

For more information on Dr Anne Sved-William’s book, Meltdown Moments, go to:
https://wchfoundation.org.au/meltdownmoments/

Fore more about Helen Mayo House generally:http://www.wch.sa.gov.au/services/az/divisions/mentalhealth/helenmayo/index.html

Although MI-DBT is a research-based group, there is more information to be found here.
http://bpdsa.com.au/wordpress/wp-content/uploads/2016/12/Central-Adelaide-1.pdf

If you feel this conversation has triggered something for you, please contact PBB media directly and we’ll endeavour to find you a therapist near you.

You can also contact Lifeline on 13 11 14 and Beyond Blue on 1300 22 4636.

+++++++++++

First aired on 99.9 BayFM Byron Bay on 8 October 2018

Copyright PBB Media and Kimberley Lipschus 2018
www.pbbmedia.org
www.kimberleylipschus.com

++++++

If you would like to support our volunteer-run and not for profit project, head over to www.patreon.com/pbbmedia and you can pledge as little as $2 per month.
Or you can review us on iTunes or at Facebook: Pregnancy Birth and Beyond Media

Thank you for your support!]]>1669borderlinepersonality,mentalhealthmonth,newmothersnotcoping,postnataldepressionfalsefullExtras: NSW Health Maternity Survey: Tokenistic? One woman has her sayhttps://www.spreaker.com/episode/extras-nsw-health-maternity-survey-tokenistic-one-woman-has-her-say--15998331
Further reading here: http://www.pbbmedia.org/ne-plus-ultra/tokenistic-nsw-health-maternity-survey-one-woman-has-her-say

Recorded by Sally Cusack on 18 October 2018.
Copyright PBB Media 2018]]>https://api.spreaker.com/episode/15998331Thu, 18 Oct 2018 23:37:54 +0000PBB Media IncorporatedMother of 3 and consumer advocate from Tamworth, NSW, Samantha Wibberley's response to the NSW Health Maternity Care in NSW Survey.: https://www.health.nsw.gov.au/kidsfamilies/MCFhealth/maternity/Pages/mc-review.aspx Further reading here:...
Further reading here: http://www.pbbmedia.org/ne-plus-ultra/tokenistic-nsw-health-maternity-survey-one-woman-has-her-say

Recorded by Sally Cusack on 18 October 2018.
Copyright PBB Media 2018]]>420maternityadvocacy,nswmaternitycaresurveyfalsefullSpeaking up for Human Rights with Eddie Ayers and Gillian Triggshttps://www.spreaker.com/episode/speaking-up-for-human-rights-with-eddie-ayers-and-gillian-triggs--15934809
Followed by an interview with former President of the Human Rights Commission of Australia about our women's rights in birth and their need for greater confidence in this arena.

REFERENCES:
* Gopi Lev in https://www.spreaker.com/user/pregnancybirthandbeyond/our-first-show-on-gender-sexual-diversit, in particular from about 18 mins in.
* http://www.pbbmedia.org/ne-plus-ultra/our-first-show-on-gender-sexual-diversity
++++
* Bri Lee is author of Eggshell Skull
* More on informed consent at:
- Episode 3: "Informed Consent: Your rights in birth" at http://www.pbbmedia.org/ababyontheway.html
- Our free 4 part podcast series "A Close Look at Informed Consent" featuring Dr Bec Jenkinson, available on signup to our newsletter at www.pbbmedia.org

Thanks to the Byron Writers' Festival for the opportunity to speak with Eddie Ayers and Gillian Triggs.

Producer and presenter: Sally Cusack
Copyright 2018 PBB Media and Sally Cusack

First aired on 99.9 BayFM Byron Bay on 1 October 2018.]]>https://api.spreaker.com/episode/15934809Thu, 11 Oct 2018 10:09:11 +0000PBB Media IncorporatedA two part episode starting with an interview with ABC Radio broadcaster Eddie Ayers about what he recommends to parents who think they may have a transgender child (one suggestion is to give the child an instrument and indulge in the healing power of...
Followed by an interview with former President of the Human Rights Commission of Australia about our women's rights in birth and their need for greater confidence in this arena.

REFERENCES:
* Gopi Lev in https://www.spreaker.com/user/pregnancybirthandbeyond/our-first-show-on-gender-sexual-diversit, in particular from about 18 mins in.
* http://www.pbbmedia.org/ne-plus-ultra/our-first-show-on-gender-sexual-diversity
++++
* Bri Lee is author of Eggshell Skull
* More on informed consent at:
- Episode 3: "Informed Consent: Your rights in birth" at http://www.pbbmedia.org/ababyontheway.html
- Our free 4 part podcast series "A Close Look at Informed Consent" featuring Dr Bec Jenkinson, available on signup to our newsletter at www.pbbmedia.org

Thanks to the Byron Writers' Festival for the opportunity to speak with Eddie Ayers and Gillian Triggs.

Producer and presenter: Sally Cusack
Copyright 2018 PBB Media and Sally Cusack

First aired on 99.9 BayFM Byron Bay on 1 October 2018.]]>1670humanrightsinchildbirth,transgenderkids,transgenderparentingfalsefullHealing Through Stories with Susan Perrowhttps://www.spreaker.com/episode/healing-through-stories-with-susan-perrow--15867806
Susan Perrow is an author, story teller, trainer and parent educator. Her first book ‘Healing Stories for Challenging Behaviours’ has been translated into over 10 languages. Her recent interview on PBB radio was an inspirational program full of magic, metaphor and muses exploring the use of ancient myth, traditional folk tales and contemporary life in helping parents to raise children. Through Susan’s passion and the wisdom of her story making listeners will be left in no doubt about the power of story to heal and transform lives. "When i first experienced the power of story telling as 'healing' I felt as though a light had illuminated the dark" (Susan Perrow, 2008).

List of references (eg book titles/websites mentioned)
1. Healing Stories for Challenging Behaviours - Susan Perrow

https://www.amazon.com/Healing-Stories-Challenging-Behaviour-Perrow/dp/1903458781

2. A-Z Collection of Behaviour Tales - Susan Perrow
https://www.bookdepository.com/Z-Collection-Behaviour-Tales-Susan-Perrow/9781907359866

3. Susan Perrow
http://susanperrow.com

4. Jenny Cargill-Strong
https://storytree.com.au

First aired on 99.9 BayFM on Monday 24 September 2018.

Producer and Presenter: Sean Tonnet
Copyright 2018 PBB Media, Sean Tonnet

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.

+++++]]>https://api.spreaker.com/episode/15867806Wed, 03 Oct 2018 09:34:44 +0000PBB Media IncorporatedParenting wisdom of ancient and contemporary therapeutic story telling. Susan Perrow is an author, story teller, trainer and parent educator. Her first book ‘Healing Stories for Challenging Behaviours’ has been translated into over 10 languages....
Susan Perrow is an author, story teller, trainer and parent educator. Her first book ‘Healing Stories for Challenging Behaviours’ has been translated into over 10 languages. Her recent interview on PBB radio was an inspirational program full of magic, metaphor and muses exploring the use of ancient myth, traditional folk tales and contemporary life in helping parents to raise children. Through Susan’s passion and the wisdom of her story making listeners will be left in no doubt about the power of story to heal and transform lives. "When i first experienced the power of story telling as 'healing' I felt as though a light had illuminated the dark" (Susan Perrow, 2008).

List of references (eg book titles/websites mentioned)
1. Healing Stories for Challenging Behaviours - Susan Perrow

https://www.amazon.com/Healing-Stories-Challenging-Behaviour-Perrow/dp/1903458781

2. A-Z Collection of Behaviour Tales - Susan Perrow
https://www.bookdepository.com/Z-Collection-Behaviour-Tales-Susan-Perrow/9781907359866

3. Susan Perrow
http://susanperrow.com

4. Jenny Cargill-Strong
https://storytree.com.au

First aired on 99.9 BayFM on Monday 24 September 2018.

Producer and Presenter: Sean Tonnet
Copyright 2018 PBB Media, Sean Tonnet

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.

+++++]]>1693behaviour,creative,metaphor,parenting,storytellingfalsefullThe Living Breathing Classroom with Mandala Diehlhttps://www.spreaker.com/episode/the-living-breathing-classroom-with-mandala-diehl--15819393
First aired on 99.9 BayFM Byron Bay Australia on 10 September 2018.

Producer and presenter: Kimberley Lipschus - www.kimberleylipschus.com

References: http://federalccc.com.au/ and https://www.byron4kids.com.au/bush-tucker-garden/

One of our interviews with Robin Grille who Mandala mentions during the interview.
https://www.spreaker.com/user/pregnancybirthandbeyond/robin-grille-on-the-link-between-healthy

Presenter and producer: Kimberley Lipschus

Copyright 2018 PBB Media and Kimberley Lipschus
www.pbbmedia.org

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.]]>https://api.spreaker.com/episode/15819393Thu, 27 Sep 2018 09:47:25 +0000PBB Media IncorporatedMandala Diehl, director of Federal Community Childrens Centre believes children thrive with a strong identity. And the key is nature. She runs her children’s centre with this ethos and has created a Living Bush-tucker Classroom which bridges a gap...
First aired on 99.9 BayFM Byron Bay Australia on 10 September 2018.

Producer and presenter: Kimberley Lipschus - www.kimberleylipschus.com

References: http://federalccc.com.au/ and https://www.byron4kids.com.au/bush-tucker-garden/

One of our interviews with Robin Grille who Mandala mentions during the interview.
https://www.spreaker.com/user/pregnancybirthandbeyond/robin-grille-on-the-link-between-healthy

Presenter and producer: Kimberley Lipschus

Copyright 2018 PBB Media and Kimberley Lipschus
www.pbbmedia.org

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.]]>1695bushtucker,children,childrensidentity,happyhealthykids,kidsinnaturefalsefullWorld Gratitude Day and the blessing of Gathering with Dr Lauren Toberhttps://www.spreaker.com/episode/world-gratitude-day-and-the-blessing-of-gathering-with-dr-lauren-tober--15764899
Produced and presented by Annalee Atia
Guest, Dr Lauren Tober

for more information head to:
www.pbbmedia.org
www.laurentober.com
www.capturinggratitude.com

Copyright
PBB Media, Annalee Atia 2018. All rights reserved.]]>https://api.spreaker.com/episode/15764899Thu, 20 Sep 2018 15:45:31 +0000PBB Media IncorporatedIn this episode of Pregnancy, Birth and Beyond, in honour of world Gratitude Day, Friday September 21, 2018, we are discussing Gratitude, Gathering and the power of storing positive experiences in building true resilience, a more positive outlook on...
Produced and presented by Annalee Atia
Guest, Dr Lauren Tober

for more information head to:
www.pbbmedia.org
www.laurentober.com
www.capturinggratitude.com

Copyright
PBB Media, Annalee Atia 2018. All rights reserved.]]>1671childbirth,community,gathering,mentalhealth,motherhood,parenting,positiveoutlook,pregnancy,wellbeing,worldgratitudedayfalsefullCelebrating Inclusion with Misa Alexanderhttps://www.spreaker.com/episode/celebrating-inclusion-with-misa-alexander--15713795
References: http://fergus-delilah.com/

First aired on 99.9 BayFM on Monday 27 August 2018.

Copyright 2018 PBB Media and Kimberley Lipschus
www.pbbmedia.org

Presenter and producer: Kimberley Lipschus

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.

+++++]]>https://api.spreaker.com/episode/15713795Fri, 14 Sep 2018 00:42:04 +0000PBB Media IncorporatedMisa Alexander’s son Hugo is on the autism spectrum. After noticing his behaviour in public setting him apart from other children, she set out to educate kids how to include those who are different- into their play and their lives. She is the...
References: http://fergus-delilah.com/

First aired on 99.9 BayFM on Monday 27 August 2018.

Copyright 2018 PBB Media and Kimberley Lipschus
www.pbbmedia.org

Presenter and producer: Kimberley Lipschus

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.

+++++]]>1662austismspectrum,autism,childrenwithdisabilities,disability,inclusionfalsefullThe Diamonds in the Darkness: When Birth doesn't go to Planhttps://www.spreaker.com/episode/the-diamonds-in-the-darkness-when-birth-doesn-t-go-to-plan--15659557
References: "A Life's Work", Rachel Cusk
More info on "matrescence": http://www.pbbmedia.org/matrescence.html
Support for birth trauma: www.panda.org.au, www.birthtalk.org

Related blogpost: http://www.pbbmedia.org/ne-plus-ultra/surviving-nicu-by-krishna-reville

First aired on 99.9 BayFM on Monday 3 September 2018.

Copyright 2018 PBB Media and Sally Cusack
www.pbbmedia.org

Presenter and producer: Sally Cusack

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.

+++++]]>https://api.spreaker.com/episode/15659557Fri, 07 Sep 2018 00:38:04 +0000PBB Media IncorporatedSally speaks with Krishna Reville, mother of two boys, about her lessons learned from both of her births that were vastly different to the natural, uncomplicated births she had dreamed of. She also speaks about the importance of being aware of all...
References: "A Life's Work", Rachel Cusk
More info on "matrescence": http://www.pbbmedia.org/matrescence.html
Support for birth trauma: www.panda.org.au, www.birthtalk.org

Related blogpost: http://www.pbbmedia.org/ne-plus-ultra/surviving-nicu-by-krishna-reville

First aired on 99.9 BayFM on Monday 3 September 2018.

Copyright 2018 PBB Media and Sally Cusack
www.pbbmedia.org

Presenter and producer: Sally Cusack

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.

+++++]]>1698birth,csection,emergencycsection,hospital,hospitalbirth,kangaroocare,motherhood,nicu,parenting,pregnancy,pretermbirth,survivingnicu,womenshealthfalsefullExtras: Menstruation workshops with Georgie Moonhttps://www.spreaker.com/episode/extras-menstruation-workshops-with-georgie-moon--15630726
Information: passionateplace@hotmail.com]]>https://api.spreaker.com/episode/15630726Mon, 03 Sep 2018 11:24:00 +0000PBB Media IncorporatedRecording of live broadcast on 3 Sept 2018. Information: passionateplace@hotmail.com
Information: passionateplace@hotmail.com]]>304birth,childbirth,menstruaion,motherhood,parenting,period,pregnancy,teenagegirls,teensfalsefullBelonging through Story with Annie Bryanthttps://www.spreaker.com/episode/belonging-through-story-with-annie-bryant--15480126
Producer and presenter: Kimberley Lipschus. (www.kimberleylipschus.com)
Annie Bryant: www.talesandsongs.com

Copyright 2018 PBB Media and Kimberley Lipschus

First aired on BayFM Byron Bay Australia on 9 July 2018.
www.pbbmedia.

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.

+++++]]>https://api.spreaker.com/episode/15480126Thu, 30 Aug 2018 07:41:00 +0000PBB Media IncorporatedAnnie Bryant is a storyteller on a quest. She wants to understand her place in this ancient land, Australia, as a white woman. Her songs and stories are stunning. This is her story. Producer and presenter: Kimberley Lipschus....
Producer and presenter: Kimberley Lipschus. (www.kimberleylipschus.com)
Annie Bryant: www.talesandsongs.com

Copyright 2018 PBB Media and Kimberley Lipschus

First aired on BayFM Byron Bay Australia on 9 July 2018.
www.pbbmedia.

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.

+++++]]>1687childbirth,childhood,motherhood,parenting,pregnancy,storytellingfalsefullTuning into Kids and Teens with Dr Christiane Kehoehttps://www.spreaker.com/episode/tuning-into-kids-and-teens-with-dr-christiane-kehoe--15550601
The importance of emotional competence for children and parents is highlighted in this powerful interview with Dr Christiane Kehoe. Not only is there undeniable evidence (gathered from the existing Tuning into Kids and Teens programs) on the outcomes around children and parents relationships, and emotional wellness, Christiane and the Mindful team are building and delivering a suite of programs that support families and communities internationally and across Australia. Discover the 5 emotional coaching steps essential for every parent and absorb contemporary ideas on how we feel, respond and parent. This interview is not to be missed!

Producer and presenter: Sean Tonnet

Guest:
Dr Christiane Kehoe, University of Melbourne

List of references (eg book titles/websites mentioned)
Mindful
http://www.mindful.org.au

2. Tuning into Kids
http://www.tuningintokids.org.au

3. Resourcing Parents
http://www.resourcingparents.nsw.gov.au

4. Interrelate
http://www.interrelate.org.au

Copyright PBB Media and Sean Tonnet 2018
www.pbbmedia.org

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.

+++++

First aired on 99.9 BayFM Byron Bay on 13 August 2018.]]>https://api.spreaker.com/episode/15550601Thu, 23 Aug 2018 06:28:50 +0000PBB Media IncorporatedTuning into Kids and Teens: The essential guide for parents, to emotional and relationship bonds with children. The importance of emotional competence for children and parents is highlighted in this powerful interview with Dr Christiane Kehoe. Not...
The importance of emotional competence for children and parents is highlighted in this powerful interview with Dr Christiane Kehoe. Not only is there undeniable evidence (gathered from the existing Tuning into Kids and Teens programs) on the outcomes around children and parents relationships, and emotional wellness, Christiane and the Mindful team are building and delivering a suite of programs that support families and communities internationally and across Australia. Discover the 5 emotional coaching steps essential for every parent and absorb contemporary ideas on how we feel, respond and parent. This interview is not to be missed!

Producer and presenter: Sean Tonnet

Guest:
Dr Christiane Kehoe, University of Melbourne

List of references (eg book titles/websites mentioned)
Mindful
http://www.mindful.org.au

2. Tuning into Kids
http://www.tuningintokids.org.au

3. Resourcing Parents
http://www.resourcingparents.nsw.gov.au

4. Interrelate
http://www.interrelate.org.au

Copyright PBB Media and Sean Tonnet 2018
www.pbbmedia.org

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.

+++++

First aired on 99.9 BayFM Byron Bay on 13 August 2018.]]>1695anger,birth,childbirth,discipline,emotions,fatherhood,motherhod,parenting,pregnancy,teenage,wellbeingfalsefullThe Hidden Gifts of Menstruationhttps://www.spreaker.com/episode/the-hidden-gifts-of-menstruation--15503917
For about 4 days in every month across approximately 40 years women menstruate. That’s around 1/7th of every woman’s life through those years. Yet for most women, they cover up the process and 'soldier on' with all their usual commitments, in spite of their body wanting to rest and take time out.

Karin Gisler shares her perspectives about the importance of paying respect to this process, and in doing so, develop an understanding of the inner workings of a woman's body each month. For Karin, her menstrual cycle is an invaluable "health barometer". Karin also sees the importance of fathers and male partners taking the time to learn more about the menstrual cycle and how it impacts relationships. Finally she shares tips for families who are preparing for a daughter who is approaching menarche.

More to explore in Karin's blog post here: http://www.primalwisdom.com.au/blog/the-hidden-gifts-of-menstruation

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.

+++++

First aired on 99.9 BayFM Byron Bay on 13 August 2018.

Presenter and producer: Sally Cusack
Guest: Karin Lucia Gisler - www.primalwisdom.com.au

Copyright PBB Media and Sally Cusack 2018
www.pbbmedia.org]]>https://api.spreaker.com/episode/15503917Thu, 16 Aug 2018 10:20:44 +0000PBB Media IncorporatedKarin Gisler shares her perspectives on menstruation, a process that visits women for about 1/7th of her life during her fertile years. For about 4 days in every month across approximately 40 years women menstruate. That’s around 1/7th of every...
For about 4 days in every month across approximately 40 years women menstruate. That’s around 1/7th of every woman’s life through those years. Yet for most women, they cover up the process and 'soldier on' with all their usual commitments, in spite of their body wanting to rest and take time out.

Karin Gisler shares her perspectives about the importance of paying respect to this process, and in doing so, develop an understanding of the inner workings of a woman's body each month. For Karin, her menstrual cycle is an invaluable "health barometer". Karin also sees the importance of fathers and male partners taking the time to learn more about the menstrual cycle and how it impacts relationships. Finally she shares tips for families who are preparing for a daughter who is approaching menarche.

More to explore in Karin's blog post here: http://www.primalwisdom.com.au/blog/the-hidden-gifts-of-menstruation

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to www.weleda.com.au.

+++++

First aired on 99.9 BayFM Byron Bay on 13 August 2018.

Presenter and producer: Sally Cusack
Guest: Karin Lucia Gisler - www.primalwisdom.com.au

Copyright PBB Media and Sally Cusack 2018
www.pbbmedia.org]]>1699birth,comingofage,menstrualeducationfordads,menstruation,menstruationeducation,mothehood,parenting,pregnancy,womanhood,womenshealthfalsefullPrivately Practising Midwifery in Australia with Astrahttps://www.spreaker.com/episode/privately-practising-midwifery-in-australia-with-astra--15462118
Produced & Presented by Annalee Atia
Guest: Astra Joynt

Get in touch with Astra here: http://www.byronbaymidwife.services

More info at pbbmedia.org
All rights reserved.

First aired on BayFM Byron Bay on 6 August 2018.

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to weleda.com.au.

+++++]]>https://api.spreaker.com/episode/15462118Fri, 10 Aug 2018 09:05:24 +0000PBB Media IncorporatedOn this episode of Pregnancy, Birth and Beyond a conversation with Astra Joynt, a privately praticing midwife in NSW, Australia. We discuss the work that is midwifery and the endevours of midwives in becoming autonomous practitioners in their field....
Produced & Presented by Annalee Atia
Guest: Astra Joynt

Get in touch with Astra here: http://www.byronbaymidwife.services

More info at pbbmedia.org
All rights reserved.

First aired on BayFM Byron Bay on 6 August 2018.

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to weleda.com.au.

+++++]]>1800birth,childbirth,continuityofcare,maternitycare,maternitycareau,midwifery,motherhood,parenting,pregnancy,privatelypracticingmidwifefalsefullPatreon Episode: Gillian Triggs on women's rights in birthhttps://www.spreaker.com/episode/patreon-episode-gillian-triggs-on-women-s-rights-in-birth--15446530
Recorded at the Byron Writers' Festival 5 August 2018.]]>https://api.spreaker.com/episode/15446530Wed, 08 Aug 2018 10:42:24 +0000PBB Media IncorporatedGillian Triggs speaking with Sally about her experiences in pregnancy in the early '80s and perspectives about women today and what she sees as a lack of confidence in challenging the status quo. Recorded at the Byron Writers' Festival 5 August 2018.
Recorded at the Byron Writers' Festival 5 August 2018.]]>737humanrightsinchildbirthfalsefullClearing our emotional entanglements with Family Constellation Therapyhttps://www.spreaker.com/episode/clearing-our-emotional-entanglements-with-family-constellation-therapy--15408728
www.family-constellations.org
www.constellationflow.com
www.mariadolenc.com.au

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to weleda.com.au.

+++++

First aired on 99.9 BayFM in Byron Bay on Monday 30 August 2018.

Copyright 2018 Kimberley Lipschus and PBB Media

Photo by Ferenc Horvath on Unsplash]]>https://api.spreaker.com/episode/15408728Thu, 02 Aug 2018 22:55:57 +0000PBB Media IncorporatedFamily Constellation therapy is world renowned- in Europe and in Brazil in particular. It mitigates healing in a way that often talk therapy often cannot. In this episode Kimberley speaks with Jen Henderson to find out more....
www.family-constellations.org
www.constellationflow.com
www.mariadolenc.com.au

+++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to weleda.com.au.

+++++

First aired on 99.9 BayFM in Byron Bay on Monday 30 August 2018.

Copyright 2018 Kimberley Lipschus and PBB Media

Photo by Ferenc Horvath on Unsplash]]>1688familyconstellationtherapyfalsefullPatreon Episode: A Close Look at Informed Consent - for Clinicians PART 4 of 4https://www.spreaker.com/episode/patreon-episode-a-close-look-at-informed-consent-for-clinicians-part-4-of-4--15395125https://api.spreaker.com/episode/15395125Wed, 01 Aug 2018 07:48:11 +0000PBB Media Incorporated1406falsefullPatreon Episode: A Close Look at Informed Consent - for Clinicians PART 3 of 4https://www.spreaker.com/episode/patreon-episode-a-close-look-at-informed-consent-for-clinicians-part-3-of-4--15395123https://api.spreaker.com/episode/15395123Wed, 01 Aug 2018 07:47:48 +0000PBB Media Incorporated1734falsefullPatreon Episode: A Close Look at Informed Consent - for Clinicians PART 2 of 4https://www.spreaker.com/episode/patreon-episode-a-close-look-at-informed-consent-for-clinicians-part-2-of-4--15395122https://api.spreaker.com/episode/15395122Wed, 01 Aug 2018 07:47:02 +0000PBB Media Incorporated1510falsefullPatreon Episode: A Close Look at Informed Consent - for Clinicians PART 1 of 4https://www.spreaker.com/episode/patreon-episode-a-close-look-at-informed-consent-for-clinicians-part-1-of-4--15395116https://api.spreaker.com/episode/15395116Wed, 01 Aug 2018 07:42:19 +0000PBB Media Incorporated1522falsefullKids and Dogs: Anna's Best Tips for Safetyhttps://www.spreaker.com/episode/kids-and-dogs-anna-s-best-tips-for-safety--15331604
Sally speaks with nationally accredited canine trainer, Anna Tasker. As a mother of two boys, Anna is keen to instill an awareness of social responsibility in the next generation of dog owners. Anna also shares her insights into dog behaviour so we can improve our relationship with this most loyal of human friends.

After listening to this episode, you may have a better understanding of how the dog in this photo will be feeling. (Note the closed mouth, wide eyes, leaning slightly away from the child...).

www.pawpower.com.au

Anna also mentions the Story Dogs programme for kids learning to read: storydogs.org.au

Producer and presenter Sally Cusack
Copyright: PBB Media and Sally Cusack 2018

First aired on 99.9 BayFM Byron Bay on 23 July 2018.

Image by Picsea from Unsplash.com.

Further reading/viewing:
https://ppgaustralia.net.au/DominanceTheoryPositionStatement
https://www.youtube.com/watch?v=uDDZ17DImoo
https://www.youtube.com/watch?v=46ND3suK1y8]]>https://api.spreaker.com/episode/15331604Thu, 26 Jul 2018 03:10:32 +0000PBB Media IncorporatedA dog can be a wonderful addition to a family - a child can hold extremely deep feelings for for their dog that they’ll always remember. And with 4.8 million pet dogs in Australia, there's a lot of opportunities for that to happen. Yet many dogs are...
Sally speaks with nationally accredited canine trainer, Anna Tasker. As a mother of two boys, Anna is keen to instill an awareness of social responsibility in the next generation of dog owners. Anna also shares her insights into dog behaviour so we can improve our relationship with this most loyal of human friends.

After listening to this episode, you may have a better understanding of how the dog in this photo will be feeling. (Note the closed mouth, wide eyes, leaning slightly away from the child...).

www.pawpower.com.au

Anna also mentions the Story Dogs programme for kids learning to read: storydogs.org.au

Producer and presenter Sally Cusack
Copyright: PBB Media and Sally Cusack 2018

First aired on 99.9 BayFM Byron Bay on 23 July 2018.

Image by Picsea from Unsplash.com.

Further reading/viewing:
https://ppgaustralia.net.au/DominanceTheoryPositionStatement
https://www.youtube.com/watch?v=uDDZ17DImoo
https://www.youtube.com/watch?v=46ND3suK1y8]]>1700dogbehaviour,dogsafety,dogsandkids,parentingfalsefullRhea Dempsey on the 3 C's of social attitudes to birthhttps://www.spreaker.com/episode/rhea-dempsey-on-the-3-c-s-of-social-attitudes-to-birth--15293662
Copyright: PBB Media and Sally Cusack 2018
www.pbbmedia.org
www.birthingwisdom.com.au]]>https://api.spreaker.com/episode/15293662Fri, 20 Jul 2018 08:10:31 +0000PBB Media IncorporatedThis is an extract from our live broadcast interview with Rhea Dempsey on BayFM on Monday 16 July 2018. This segment of the interview did not make it to our official podcast at:...
Copyright: PBB Media and Sally Cusack 2018
www.pbbmedia.org
www.birthingwisdom.com.au]]>652rheadempseyfalsefullReaching into Pain and Finding Inner Strength with Rhea Dempseyhttps://www.spreaker.com/episode/reaching-into-pain-and-finding-inner-strength-with-rhea-dempsey--15291917
Rhea is an independent and straight talking voice who speaks plainly to expectant couples about what to expect in terms of the physiological process - she doesn’t pull punches in saying it’s generally a painful experience, but hastens to explain the hormonal systems that have a pain relieving effect. She also spells out the realities of birthing in our health system and how to work with that system to get optimal results from it.

Rhea Dempsey: www.birthingwisdom.com.au

Rhea referenced Dr Sarah Buckley's research: https://sarahbuckley.com/hormonal-physiology-of-childbearing-report/

++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to weleda.com.au.

++++

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2018
www.pbbmedia.org]]>https://api.spreaker.com/episode/15291917Fri, 20 Jul 2018 01:55:34 +0000PBB Media IncorporatedRhea Dempsey is one Australia’s best known childbirth educators and author of "Birth with Confidence, Savvy choices for normal birth". Now writing her second book, she is also a speaker, counselor and birth attendant at more than 1000 births in her...
Rhea is an independent and straight talking voice who speaks plainly to expectant couples about what to expect in terms of the physiological process - she doesn’t pull punches in saying it’s generally a painful experience, but hastens to explain the hormonal systems that have a pain relieving effect. She also spells out the realities of birthing in our health system and how to work with that system to get optimal results from it.

Rhea Dempsey: www.birthingwisdom.com.au

Rhea referenced Dr Sarah Buckley's research: https://sarahbuckley.com/hormonal-physiology-of-childbearing-report/

++++

This episode is proudly sponsored by WELEDA Australia.

FOR A LIMITED TIME Australian audiences are entitled to a 20% discount on any online orders over $29.95 when they quote the promotional code of NATURAL. Head to weleda.com.au.

++++

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2018
www.pbbmedia.org]]>1694birth,birthrisk,labourpainfalsefullSaving the planet by nurturing our kids' creativityhttps://www.spreaker.com/episode/saving-the-planet-by-nurturing-our-kids-creativity--15182117
Jane Hanckel, co-founder: www.inspirededucation.com.au

Presenter: Sally Cusack
First aired on BayFM Byron Bay on 2 July 2018.
Copyright: PBB Media, Sally Cusack 2018

References:
* Bruno Bettelheim "The Good Enough Parent"
* Fewer Toys Study: https://www.ncbi.nlm.nih.gov/pubmed/29190457
* Gonski Report (importance of tailoring education to individuals): https://www.education.gov.au/review-achieve-educational-excellence-australian-schools
* NASA study by George Land and Beth Jarman about the impacts of education on our creativity: https://research-repository.griffith.edu.au/bitstream/handle/10072/7880/33187_1.pdf?sequence

Other references:

* Nancy Carlsson-Paige "Taking Back Childhood"
* Professor James Heckman on importance of support for children and their parents in the early years for lifelong health: https://heckmanequation.org/resource/research-summary-abecedarian-health/
* Nature Play NSW, Qld and other Australian states

Image: Greg Rakozy on Unsplash.com]]>https://api.spreaker.com/episode/15182117Tue, 03 Jul 2018 22:20:43 +0000PBB Media IncorporatedJane Hanckel is a mother, author and co-founder of Inspired Education about how we as parents can foster our children's development to meet the immense challenges of our times. Jane quotes the World Economic Forum's (2016) findings that the...
Jane Hanckel, co-founder: www.inspirededucation.com.au

Presenter: Sally Cusack
First aired on BayFM Byron Bay on 2 July 2018.
Copyright: PBB Media, Sally Cusack 2018

References:
* Bruno Bettelheim "The Good Enough Parent"
* Fewer Toys Study: https://www.ncbi.nlm.nih.gov/pubmed/29190457
* Gonski Report (importance of tailoring education to individuals): https://www.education.gov.au/review-achieve-educational-excellence-australian-schools
* NASA study by George Land and Beth Jarman about the impacts of education on our creativity: https://research-repository.griffith.edu.au/bitstream/handle/10072/7880/33187_1.pdf?sequence

Other references:

* Nancy Carlsson-Paige "Taking Back Childhood"
* Professor James Heckman on importance of support for children and their parents in the early years for lifelong health: https://heckmanequation.org/resource/research-summary-abecedarian-health/
* Nature Play NSW, Qld and other Australian states

Image: Greg Rakozy on Unsplash.com]]>1670childrenspotential,creativity,natureplay,parentingfalsefullPerinatal Support for Mothers with Doula Nathalie Solishttps://www.spreaker.com/episode/perinatal-support-for-mothers-with-doula-nathalie-solis--15118226
Currently contributing to a new childbirth education course with renowned French obstetrician and natural birth pioneer Dr. Michel Odent, Nathalie is committed to providing emotional, educational and practical one-on-one support to birthing families. She is passionate about offering non-judgmental, evidence-based, continuous care so that mothers feel heard, respected and cared for at all times.

Produced and Hosted by: Annalee Atia
Interviewee: Nathalie Solis

Copyright - 2018:
PBB Media
Annalee Atia
Nathalie Solis

Links:
www.thebyrondoula.com
www.pbbmedia.org]]>https://api.spreaker.com/episode/15118226Sun, 24 Jun 2018 04:02:54 +0000PBB Media IncorporatedToday we are discussing the vital support continuity with a known birth worker can afford women during pregnancy, childbirth and especially postnatally. We have beautiful guest Nathalie Solis with us, Nathalie, recently returned from Germany is a...
Currently contributing to a new childbirth education course with renowned French obstetrician and natural birth pioneer Dr. Michel Odent, Nathalie is committed to providing emotional, educational and practical one-on-one support to birthing families. She is passionate about offering non-judgmental, evidence-based, continuous care so that mothers feel heard, respected and cared for at all times.

Produced and Hosted by: Annalee Atia
Interviewee: Nathalie Solis

Copyright - 2018:
PBB Media
Annalee Atia
Nathalie Solis

Links:
www.thebyrondoula.com
www.pbbmedia.org]]>1671babies,childbirth,doula,matrescence,mothers,pbbmedia,perinatalsupport,pregnancy,womenswellbeingfalsefullThe metamorphosis of motherhoodhttps://www.spreaker.com/episode/the-metamorphosis-of-motherhood--15071581
My guest Kari Azuma, leadership development coach and mother, from Santa Barbara, California joins us in a conversation about her transition to motherhood, birth as an opportunity for introspection and personal evolution and finding your passion and power as a mother.

This episode focuses the lens on motherhood, my guest Kari specially works with mothers. Yet, what ever gender you identify as this episode speaks to all parents in the transition that occurs with the birth of a new family member.
Produced and presented by Lara Martin
Copyright 2018 PBB Media and Lara Martin
www.pbbmedia.com]]>https://api.spreaker.com/episode/15071581Mon, 18 Jun 2018 02:50:39 +0000PBB Media IncorporatedWhen you become a parent there is a shift in identity that occurs, pre-birth expectations drop away as reality kicks in. Life that perhaps was once goal orientated or career focus shifts as life with a baby forces a new daily rhythm, a slowing down,...
My guest Kari Azuma, leadership development coach and mother, from Santa Barbara, California joins us in a conversation about her transition to motherhood, birth as an opportunity for introspection and personal evolution and finding your passion and power as a mother.

This episode focuses the lens on motherhood, my guest Kari specially works with mothers. Yet, what ever gender you identify as this episode speaks to all parents in the transition that occurs with the birth of a new family member.
Produced and presented by Lara Martin
Copyright 2018 PBB Media and Lara Martin
www.pbbmedia.com]]>1672birth,motherhood,pregnancyfalsefullThe Overlooked Phase of Matrescence with Dr Oscar Serrallachhttps://www.spreaker.com/episode/the-overlooked-phase-of-matrescence-with-dr-oscar-serrallach--15054173
References:
www.oscarserrallach.com
www.pbbmedia.org/matrescence-support.html
matrescence.com

Our blogpost on this episode with more references:
http://www.pbbmedia.org/ne-plus-ultra/were-you-supported-during-your-matrescence

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2018
www.pbbmedia.org]]>https://api.spreaker.com/episode/15054173Fri, 15 Jun 2018 09:22:35 +0000PBB Media IncorporatedDr Oscar Serralach speaks about the little recognised phase of life called "Matrescence". This period is the stage of becoming a mother and like adolescence the person undergoing it cannot go back to their former life. Also like adolescence, it...
References:
www.oscarserrallach.com
www.pbbmedia.org/matrescence-support.html
matrescence.com

Our blogpost on this episode with more references:
http://www.pbbmedia.org/ne-plus-ultra/were-you-supported-during-your-matrescence

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2018
www.pbbmedia.org]]>1671ittakesavillage,matrescence,oscarserrallach,postnataldepletioncure,postnatalsupportfalsefullNature as Teacher and Healer with Gareth Vanderhopehttps://www.spreaker.com/episode/nature-as-teacher-and-healer-with-gareth-vanderhope--15034134
www.garethvanderhope.com

First aired on 99.9 BayFM Byron Bay Australia on 4 June 2018.

Copyright PBB Media and Sean Tonnet 2018]]>https://api.spreaker.com/episode/15034134Wed, 13 Jun 2018 03:10:42 +0000PBB Media IncorporatedGareth Vanderhope, two times British Academy Award winner in Sound Design, Author, Health Educator and Dad speaks on the importance of nature, reading and sound for children's wellbeing. It has been well researched that children need nature for...
www.garethvanderhope.com

First aired on 99.9 BayFM Byron Bay Australia on 4 June 2018.

Copyright PBB Media and Sean Tonnet 2018]]>1671garethvanderhope,natureasmedicine,natureasteacher,natureconnectionforkids,parentingfalsefullRites of Passage: Becoming a Grandmother with Raine, Kath and Lindahttps://www.spreaker.com/episode/rites-of-passage-becoming-a-grandmother-with-raine-kath-and-linda--14997322
However as Raine Sharpe, grandmother for 20 years says, it also presents an enormous opportunity for personal growth that can be brought into the new relationships she must navigate - with herself, her children, the family circle, and wider society. This in turn brings a grandmother into a fuller, more realised version of herself with wisdom we can all benefit from.

Kath Hellmann and Linda Collerson also share their new experiences of grandmotherhood. Kath is an expectant grandmother, pondering her upcoming transition, and Linda is a brand new grandmother, whose early experiences have not been quite what she anticipated.

Raine Sharpe is writing a book on Becoming a Grandmother. If you would like to participate or would like more information, email: raines@australis.net

Presenter: Sally Cusack

First aired on BayFM Byron Bay on 14 May 2018.

Copyright PBB Media and Sally Cusack 2018]]>https://api.spreaker.com/episode/14997322Fri, 08 Jun 2018 04:52:12 +0000PBB Media IncorporatedBecoming a grandmother is its own rite of passage from motherhood to grandmotherhood, yet this transition is seldom discussed and not always smooth. It can bring up unresolved aspects of a woman's relationship with her adult children, and herself....
However as Raine Sharpe, grandmother for 20 years says, it also presents an enormous opportunity for personal growth that can be brought into the new relationships she must navigate - with herself, her children, the family circle, and wider society. This in turn brings a grandmother into a fuller, more realised version of herself with wisdom we can all benefit from.

Kath Hellmann and Linda Collerson also share their new experiences of grandmotherhood. Kath is an expectant grandmother, pondering her upcoming transition, and Linda is a brand new grandmother, whose early experiences have not been quite what she anticipated.

Raine Sharpe is writing a book on Becoming a Grandmother. If you would like to participate or would like more information, email: raines@australis.net

Presenter: Sally Cusack

First aired on BayFM Byron Bay on 14 May 2018.

Copyright PBB Media and Sally Cusack 2018]]>1671becomingagrandmother,birth,parenting,ritesofpassagefalsefullThe Consumer's role in Planning Maternity Healthcare Serviceshttps://www.spreaker.com/episode/the-consumer-s-role-in-planning-maternity-healthcare-services--14944590
On Friday May 25th 2018, Sally Cusack & I spent the day up at Tweed Heads, attending a Consultation workshop as part of the governments plans to develop a National Strategic Approach to Maternity Services. The consultation was hosted by the Australian Health Ministers Advisory Council (AHMAC). The expected outcome for the NSAMS project is a document to guide national maternity services policy.

Along with about 20 other people we debated and discussed, listened and contributed to the conversation. What should maternity services look like in the future? What are the main frameworks and who are the key stakeholders? What’s missing from the current system and how do we go about attaining a system that delivers better outcomes for mothers, their babies, their families and those that work within these systems?

I have the beautiful Sally Cusack in the studio, join us as we discuss all this and more on this special episode of Pregnancy, Birth & Beyond.

Further reading on overdiagnosis raised by Sally: https://www.smh.com.au/healthcare/overdiagnosis-is-harming-patients-and-action-is-required-says-chief-medical-officer-20181014-p509jx.html

Produced and presented by Annalee Atia
Copyright PBB Media and Annalee Atia 2018.
www.pbbmedia.org]]>https://api.spreaker.com/episode/14944590Fri, 01 Jun 2018 04:43:49 +0000PBB Media IncorporatedAre you a healthcare services consumer? Specifically - have you accessed any form of maternity healthcare services in the last few years? On Friday May 25th 2018, Sally Cusack & I spent the day up at Tweed Heads, attending a Consultation workshop as...
On Friday May 25th 2018, Sally Cusack & I spent the day up at Tweed Heads, attending a Consultation workshop as part of the governments plans to develop a National Strategic Approach to Maternity Services. The consultation was hosted by the Australian Health Ministers Advisory Council (AHMAC). The expected outcome for the NSAMS project is a document to guide national maternity services policy.

Along with about 20 other people we debated and discussed, listened and contributed to the conversation. What should maternity services look like in the future? What are the main frameworks and who are the key stakeholders? What’s missing from the current system and how do we go about attaining a system that delivers better outcomes for mothers, their babies, their families and those that work within these systems?

I have the beautiful Sally Cusack in the studio, join us as we discuss all this and more on this special episode of Pregnancy, Birth & Beyond.

Further reading on overdiagnosis raised by Sally: https://www.smh.com.au/healthcare/overdiagnosis-is-harming-patients-and-action-is-required-says-chief-medical-officer-20181014-p509jx.html

Produced and presented by Annalee Atia
Copyright PBB Media and Annalee Atia 2018.
www.pbbmedia.org]]>2337auspol,australianhealthcare,birth,consumerengagement,continuityofcare,implementinevidanceandresearch,maternity,maternityadvocacy,maternityconsumerrep,maternityhealthcareservices,nnsw-lhd,pbbmedia,policyandgovernance,pregnancy,researchdissemination,womenshealth,womensrightsinchildbirthfalsefullPatreon Episode: A Close Look at Informed Consent: Part 2 of 4https://www.spreaker.com/episode/patreon-episode-a-close-look-at-informed-consent-part-2-of-4--14914879
== Sign up to our newsletter at www.pbbmedia.org for more updates and request to join our private Facebook group to continue the conversation and get support in giving/receiving respectful maternity care by writing to hello@pbbmedia.org. ==

* Queensland Centre for Mothers and Babies: "Having a Baby in Queensland", 2010

Copyright Bec Jenkinson and PBB Media 2018

All 4 episodes:
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-1-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-2-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-3-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-4-]]>https://api.spreaker.com/episode/14914879Tue, 29 May 2018 10:48:27 +0000PBB Media IncorporatedIn this part Bec Jenkinson looks at how often clinicians' meet the legal standard for informed consent. In a Queensland study* of the 3500+ women surveyed, only 48% of women who had had a planned caesarean section said they were fully informed and had...
== Sign up to our newsletter at www.pbbmedia.org for more updates and request to join our private Facebook group to continue the conversation and get support in giving/receiving respectful maternity care by writing to hello@pbbmedia.org. ==

* Queensland Centre for Mothers and Babies: "Having a Baby in Queensland", 2010

Copyright Bec Jenkinson and PBB Media 2018

All 4 episodes:
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-1-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-2-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-3-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-4-]]>1301falsefullPatreon Episode: A Close Look at Informed Consent: Part 1 of 4https://www.spreaker.com/episode/patreon-episode-a-close-look-at-informed-consent-part-1-of-4--14914560
Dr Bec Jenkinson speaking before a live audience at Gold Coast University Hospital, Australia on 21 April 2018 on informed decision making in maternity care. A mother, Cindy, also shares her experience of negotiating within the maternity care system to get the care she wanted.

== Sign up to our newsletter at www.pbbmedia.org for more updates and request to join our private Facebook group to continue the conversation and get support in giving/receiving respectful maternity care by writing to hello@pbbmedia.org. ==

"For consent to be valid, it must be freely given, ie without coercion or inducement... and can't be trumped by hospital policy." Bec Jenkinson

Reference: The White Ribbon Alliance - Respectful Maternity Care: https://www.whiteribbonalliance.org/resources/

Copyright Bec Jenkinson and PBB Media 2018

All 4 episodes:
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-1-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-2-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-3-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-4-]]>https://api.spreaker.com/episode/14914560Tue, 29 May 2018 09:36:44 +0000PBB Media IncorporatedPBB Talks: A Close Look at Informed Consent - for women and clinicians Dr Bec Jenkinson speaking before a live audience at Gold Coast University Hospital, Australia on 21 April 2018 on informed decision making in maternity care. A mother, Cindy, also...
Dr Bec Jenkinson speaking before a live audience at Gold Coast University Hospital, Australia on 21 April 2018 on informed decision making in maternity care. A mother, Cindy, also shares her experience of negotiating within the maternity care system to get the care she wanted.

== Sign up to our newsletter at www.pbbmedia.org for more updates and request to join our private Facebook group to continue the conversation and get support in giving/receiving respectful maternity care by writing to hello@pbbmedia.org. ==

"For consent to be valid, it must be freely given, ie without coercion or inducement... and can't be trumped by hospital policy." Bec Jenkinson

Reference: The White Ribbon Alliance - Respectful Maternity Care: https://www.whiteribbonalliance.org/resources/

Copyright Bec Jenkinson and PBB Media 2018

All 4 episodes:
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-1-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-2-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-3-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-4-]]>1467falsefullPatreon Episode: A Close Look at Informed Consent: Part 3 of 4https://www.spreaker.com/episode/patreon-episode-a-close-look-at-informed-consent-part-3-of-4--14912897
== Sign up to our newsletter at www.pbbmedia.org for more updates and request to join our private Facebook group to continue the conversation and get support in giving/receiving respectful maternity care by writing to hello@pbbmedia.org. ==

Copyright Bec Jenkinson, PBB Media 2018

Recorded before a live audience at Gold Coast Univ Hospital on 21 April 2018.

All 4 episodes:
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-1-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-2-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-3-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-4-]]>https://api.spreaker.com/episode/14912897Tue, 29 May 2018 03:16:38 +0000PBB Media IncorporatedBec addresses here the underlying medico-legal and cultural concerns of clinicians (ie their individual "lines in the sand"), and gives tips for women on how to assess recommendations of care. == Sign up to our newsletter at www.pbbmedia.org for more...
== Sign up to our newsletter at www.pbbmedia.org for more updates and request to join our private Facebook group to continue the conversation and get support in giving/receiving respectful maternity care by writing to hello@pbbmedia.org. ==

Copyright Bec Jenkinson, PBB Media 2018

Recorded before a live audience at Gold Coast Univ Hospital on 21 April 2018.

All 4 episodes:
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-1-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-2-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-3-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-4-]]>1687informedconsent,lineinthesand,pbbmedia,pbbtalksfalsefullPatreon Episode: A Close Look at Informed Consent: Part 4 of 4https://www.spreaker.com/episode/patreon-episode-a-close-look-at-informed-consent-part-4-of-4--14912797
Closing remarks given by Griffith University Professor Jennifer Fenwick and Sally Cusack from PBB Media.

== Sign up to our newsletter at www.pbbmedia.org for more updates and request to join our private Facebook group to continue the conversation and get support in giving/receiving respectful maternity care by writing to hello@pbbmedia.org. ==

References:
* www.patientopinion.org.au - to check for patients' opinions of hospitals around Australia
* http://www.choosingwisely.org.au/resources/consumers/5-questions-to-ask-your-doctor
* Standard 2: Partnering with Consumers - all hospitals must consult with their consumers in the design of their health services and for their individual care: http://www.safetyandquality.gov.au/wp-content/uploads/2012/10/Standard2_Oct_2012_WEB.pdf

Copyright Bec Jenkinson, PBB Media 2018

Recorded before a live audience at Gold Coast Univ Hospital on 21 April 2018.

All 4 episodes:
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-1-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-2-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-3-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-4-]]>https://api.spreaker.com/episode/14912797Tue, 29 May 2018 02:56:51 +0000PBB Media IncorporatedIn this part, Bec Jenkinson hands over to Helen, a mother seeking a VBAC who "wanted to make sure everything was OK for me and my baby... I just wanted to be heard". A story of two very different responses to her wishes from two different hospitals......
Closing remarks given by Griffith University Professor Jennifer Fenwick and Sally Cusack from PBB Media.

== Sign up to our newsletter at www.pbbmedia.org for more updates and request to join our private Facebook group to continue the conversation and get support in giving/receiving respectful maternity care by writing to hello@pbbmedia.org. ==

References:
* www.patientopinion.org.au - to check for patients' opinions of hospitals around Australia
* http://www.choosingwisely.org.au/resources/consumers/5-questions-to-ask-your-doctor
* Standard 2: Partnering with Consumers - all hospitals must consult with their consumers in the design of their health services and for their individual care: http://www.safetyandquality.gov.au/wp-content/uploads/2012/10/Standard2_Oct_2012_WEB.pdf

Copyright Bec Jenkinson, PBB Media 2018

Recorded before a live audience at Gold Coast Univ Hospital on 21 April 2018.

All 4 episodes:
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-1-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-2-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-3-
www.spreaker.com/user/pregnancybirthandbeyond/a-close-look-at-informed-consent-part-4-]]>2416informedconsent,pbbmedia,pbbtalksfalsefullOne in the Hoop with Liz Ellishttps://www.spreaker.com/episode/one-in-the-hoop-with-liz-ellis--14874564
(NB Please be aware that there is some background noise of Liz's young child, however subtle).

First aired on 99.9 BayFM Byron Bay on Monday 21 May 2018.

Copyright PBB Media, Kimberley Lipschus 2018]]>https://api.spreaker.com/episode/14874564Thu, 24 May 2018 10:17:20 +0000PBB Media IncorporatedLiz Ellis is arguably Australia’s most well-loved netball athlete. She played for Australia 122 times and captained the national netball team for four years; she won two world championships and two commonwealth games. But for Liz, having children came...
(NB Please be aware that there is some background noise of Liz's young child, however subtle).

First aired on 99.9 BayFM Byron Bay on Monday 21 May 2018.

Copyright PBB Media, Kimberley Lipschus 2018]]>1667infertility,ivf,lizellis,secondaryinterfertilityfalsefullHormones for fertility and pregnancyhttps://www.spreaker.com/episode/hormones-for-fertility-and-pregnancy--14824752
Hormones - we all have them, and fertility, pregnancy and post natal/partum are key times for learning to manage them for optimum health. Check out some of her wisdom in this episode.

References: http://kimthenaturopath.com/

Presenter: Kimberley Lipschus

Copyright
PBB Media 2018, Kimberley Lipschus

First aired on 99.9 BayFM Byron Bay, Australia on 16 April 2018.

Image credit: Katie Smith on unsplash.com]]>https://api.spreaker.com/episode/14824752Fri, 18 May 2018 07:45:15 +0000PBB Media IncorporatedEat whole foods, fruit and vegetables, get rest and get in touch with your body. Not what you’d expect from a naturopath? Well Kim Piper, aka Kim the Naturopath has a lot to say about well being and about hormones and this is a vital part....
Hormones - we all have them, and fertility, pregnancy and post natal/partum are key times for learning to manage them for optimum health. Check out some of her wisdom in this episode.

References: http://kimthenaturopath.com/

Presenter: Kimberley Lipschus

Copyright
PBB Media 2018, Kimberley Lipschus

First aired on 99.9 BayFM Byron Bay, Australia on 16 April 2018.

Image credit: Katie Smith on unsplash.com]]>1671fertility,fertilityhormones,hormones,pregnancyhormonesfalsefullSame Sex Parenting: Raising awareness of the discriminationhttps://www.spreaker.com/episode/same-sex-parenting-raising-awareness-of-the-discrimination--14694019
Host Sean Tonnet speaks with Monique Rutherford about her lived and professional experience of the issues of same sex parenting.

References:
www.moniquerutherford.com.au

First aired on 99.9 BayFM Byron Bay, Australia on Monday 30 April 2018.

Copyright Sean Tonnet
PBB Media 2018

Other references:
Interrelate
www.interrelate.org.au

Circle of Security
www.circleofsecurityinternational.com/]]>https://api.spreaker.com/episode/14694019Thu, 03 May 2018 07:46:54 +0000PBB Media IncorporatedThe difficult plebiscite process for same sex marriage in 2017 highlighted the enormous discrimination and ignorance faced by same sex couples. These challenges are often accentuated for same sex couples when they decide to start a family. In this...
Host Sean Tonnet speaks with Monique Rutherford about her lived and professional experience of the issues of same sex parenting.

References:
www.moniquerutherford.com.au

First aired on 99.9 BayFM Byron Bay, Australia on Monday 30 April 2018.

Copyright Sean Tonnet
PBB Media 2018

Other references:
Interrelate
www.interrelate.org.au

Circle of Security
www.circleofsecurityinternational.com/]]>1671attachmentparenting,lgtbqi;,parenting,plebiscite,samesexparentingfalsefullMothers in Business, the early years with Meggie & Alonahttps://www.spreaker.com/episode/mothers-in-business-the-early-years-with-meggie-alona--14633699
This episode of Pregnancy, Birth and Beyond podcast was produced, written and presented by Annalee Atia. It first aired Live on 99.9 BayFM (Byron Bay, Australia) on Monday 23rd April, 2018.

Interviewees: Meggie Danielson & Alona Rosenberg

Copyright PBB Media, Annalee Atia 2018]]>https://api.spreaker.com/episode/14633699Thu, 26 Apr 2018 08:20:05 +0000PBB Media IncorporatedMothers in Business - the first years is the topic of our show today, we are excited to have two gorgeous mothers from our local community here in the Northern Rivers of NSW, Meggie Danielson & Alona Rosenberg of WeMove studio in Mullumbimby and many...
This episode of Pregnancy, Birth and Beyond podcast was produced, written and presented by Annalee Atia. It first aired Live on 99.9 BayFM (Byron Bay, Australia) on Monday 23rd April, 2018.

Interviewees: Meggie Danielson & Alona Rosenberg

Copyright PBB Media, Annalee Atia 2018]]>1671falsefullWomen's Circles with Vanessa Woodhttps://www.spreaker.com/episode/women-s-circles-with-vanessa-wood--14518906
There has been a resurgence of women’s agency and the value of women individually and as part of society. We have been watching as this unfolds, unfurls and sometimes becomes undone. We have been watching it in the media, around the world in different countries and in our own lives, with our women friends, women in our family and women around us in the community. We have been watching it unravel with in us, too. It can feel uncomfortable, empowering, inspiring dangerous.. Women have been silent in so many many ways for so many centuries. In fact, Dr Amanda Furman who wrote and presented a groundbreaking 4-part series on the history of women called - The Ascent of Woman delves deeply into the place of women in society over the course of written history. She argues that the status of women is a barometer of a society’s tolerance, fairness and openness and that for the most part over the past 10,000 years women have been oppressed, denied basic freedoms and considered a means to an end.

In this episode we are talking about Women and the value of sitting together in Circle.

We have been watching as the movement of Feminism evolves and matures to become one that recognises women for their own capacities, rather than merely hoping for women to receive the same ‘deal’ that men have.

Sitting in Circle with other women supports us to recognise where we are at, where we have been and where we are headed. It affords us the much needed support and empowerment and sustains us along the journey. It helps set us free from self judgement and fosters in us, compassion for others. For many women the practice of gathering has stayed alive and strong throughout history, and for some, it is a new concept, one they are rediscovering.

Join us is celebrating this beautiful tradition!

More information and to get in touch with Vanessa, visit - www.pbbmedia.org

Copyright
PBB Media
Producer/Host: Annalee Atia
Interviewee: Vanessa Wood
Music bite on this podcast: Habanot Nechama / Lovers]]>https://api.spreaker.com/episode/14518906Thu, 12 Apr 2018 06:22:04 +0000PBB Media IncorporatedOur guest Vanessa Wood is mother to two beautiful boys, she is a practicing Naturopath of 10 years, and a shamanic craftswoman who oversees and participates in several Women’s circles and has been a magnificent flash-mob 80’s dancer with the famed...
There has been a resurgence of women’s agency and the value of women individually and as part of society. We have been watching as this unfolds, unfurls and sometimes becomes undone. We have been watching it in the media, around the world in different countries and in our own lives, with our women friends, women in our family and women around us in the community. We have been watching it unravel with in us, too. It can feel uncomfortable, empowering, inspiring dangerous.. Women have been silent in so many many ways for so many centuries. In fact, Dr Amanda Furman who wrote and presented a groundbreaking 4-part series on the history of women called - The Ascent of Woman delves deeply into the place of women in society over the course of written history. She argues that the status of women is a barometer of a society’s tolerance, fairness and openness and that for the most part over the past 10,000 years women have been oppressed, denied basic freedoms and considered a means to an end.

In this episode we are talking about Women and the value of sitting together in Circle.

We have been watching as the movement of Feminism evolves and matures to become one that recognises women for their own capacities, rather than merely hoping for women to receive the same ‘deal’ that men have.

Sitting in Circle with other women supports us to recognise where we are at, where we have been and where we are headed. It affords us the much needed support and empowerment and sustains us along the journey. It helps set us free from self judgement and fosters in us, compassion for others. For many women the practice of gathering has stayed alive and strong throughout history, and for some, it is a new concept, one they are rediscovering.

Join us is celebrating this beautiful tradition!

More information and to get in touch with Vanessa, visit - www.pbbmedia.org

Copyright
PBB Media
Producer/Host: Annalee Atia
Interviewee: Vanessa Wood
Music bite on this podcast: Habanot Nechama / Lovers]]>1671breastfeeding,motherhood,parenting,pregnancy,sisterhood,womanspeak,womenscircle,womensmentalhealth,womenswellbeing,womneshealthfalsefullDr John Travis on transforming relationships when baby comeshttps://www.spreaker.com/episode/dr-john-travis-on-transforming-relationships-when-baby-comes--14469673
NOTE: Guest mic issues are fixed in 2nd half of this episode.

Interviewers: Sean Tonnet, Sally Cusack

Dr John Travis:
* Connected Couples, Thriving Families: www.connectedandthriving.org
* Alliance for Transforming the Lives of Children, www.aTLC.org
* Meryn Callander, "Why Dads Leave", www.whydadsleave.com
* John Travis, "MPAS In a Nutshell", www.tinyurl.com/MPASNutshell

Resources recommended by Jack:
* Jed Diamond, "The Irritable Male Syndrome" , www.theirritablemale.com
* James Prescott's Somato-Sensory Affectional Deprivational Syndrome (SSAD) (caused by not treating babies like mammals), www.tinyurl.com/jwtPrescott
* School of Life videos by Alain de Botton: https://www.youtube.com/user/schooloflifechannel/videos, "Why you'll marry the wrong person" https://tinyurl.com/whyNYT or https://tinyurl.com/whySMH
* Jean Liedloff, "The Continuum Concept", www.tinyurl.com/Callander
* Elly Taylor, "Becoming Us", www.ellytaylor.com
* Mankind Project www.mkpau.org
* Byron Katie www.byronkatie.com
* Susan Campbell and John Grey "The 5 Minute Relationship Repair" www.tinyurl.com/Campbell5Min
"Honesty Salons" www.susancampbell.com
https://healingcouplesretreats.com/five-minute-relationship-repair/ - Honesty Salon
* Pam Leo, "Connection Parenting" ("Let's raise children who don't have to recover from their childhood") www.connectionparenting.com
* Shadow Work: www.scottjeffrey.com/shadow-work

First aired on 99.9 BayFM Byron Bay Australia on Monday 2 April 2018.

Copyright 2018 PBB Media, Sally Cusack, Sean Tonnet]]>https://api.spreaker.com/episode/14469673Fri, 06 Apr 2018 01:42:25 +0000PBB Media IncorporatedThrough his own experiences as a father, Dr John (Jack) Travis came to see how the normalised disconnection and separation of babies from their parents (eg through forced sleep schedules, isolation in cots) rather than recognising a baby's needs for...
NOTE: Guest mic issues are fixed in 2nd half of this episode.

Interviewers: Sean Tonnet, Sally Cusack

Dr John Travis:
* Connected Couples, Thriving Families: www.connectedandthriving.org
* Alliance for Transforming the Lives of Children, www.aTLC.org
* Meryn Callander, "Why Dads Leave", www.whydadsleave.com
* John Travis, "MPAS In a Nutshell", www.tinyurl.com/MPASNutshell

Resources recommended by Jack:
* Jed Diamond, "The Irritable Male Syndrome" , www.theirritablemale.com
* James Prescott's Somato-Sensory Affectional Deprivational Syndrome (SSAD) (caused by not treating babies like mammals), www.tinyurl.com/jwtPrescott
* School of Life videos by Alain de Botton: https://www.youtube.com/user/schooloflifechannel/videos, "Why you'll marry the wrong person" https://tinyurl.com/whyNYT or https://tinyurl.com/whySMH
* Jean Liedloff, "The Continuum Concept", www.tinyurl.com/Callander
* Elly Taylor, "Becoming Us", www.ellytaylor.com
* Mankind Project www.mkpau.org
* Byron Katie www.byronkatie.com
* Susan Campbell and John Grey "The 5 Minute Relationship Repair" www.tinyurl.com/Campbell5Min
"Honesty Salons" www.susancampbell.com
https://healingcouplesretreats.com/five-minute-relationship-repair/ - Honesty Salon
* Pam Leo, "Connection Parenting" ("Let's raise children who don't have to recover from their childhood") www.connectionparenting.com
* Shadow Work: www.scottjeffrey.com/shadow-work

First aired on 99.9 BayFM Byron Bay Australia on Monday 2 April 2018.

Copyright 2018 PBB Media, Sally Cusack, Sean Tonnet]]>1671connectedandthriving,drjohntravis,fatherhood,malepostpartumabandonmentsynd,mpas,parenthoodfalsefullTim Winton on keeping our boys tender and connectedhttps://www.spreaker.com/episode/tim-winton-on-keeping-our-boys-tender-and-connected--14418755
Interviewed by Luke Addinsall and Sally Cusack.

Copyright 2018
PBB Media, Sally Cusack
Credits:
Guest: Tim Winton, Author of The Shepherd's Hut
Producer: Sally Cusack
Co-interviewer: Luke Addinsall

Other references:
* Dr John Travis, co-founder of the Alliance for the Transforming the Lives of Children
* David Leser, journalist "Men, Women and the Whole Damn Thing" https://www.smh.com.au/lifestyle/the-great-sexual-reckoning-how-did-we-get-here--and-what-happens-now-20180124-h0npcc.html
* Jackson Katz, www.jacksonkatz.com

Luke Addinsall also features in this podcast on male privilege: https://www.spreaker.com/user/pregnancybirthandbeyond/pbb05022018lukeaddinsallmalepriviledge-1

First aired on 99.9 BayFM Byron Bay on Monday 26 March 2018. Interview recorded at BayFM on 20 March 2018.]]>https://api.spreaker.com/episode/14418755Thu, 29 Mar 2018 21:30:21 +0000PBB Media IncorporatedThe power imbalances in today's masculinity overwhelmingly impact women, but they also fail boys and men in so many ways, leading to intractable loneliness and 'wordless rage', as described by author Tim Winton. Tim's latest book The Shepherd's Hut...
Interviewed by Luke Addinsall and Sally Cusack.

Copyright 2018
PBB Media, Sally Cusack
Credits:
Guest: Tim Winton, Author of The Shepherd's Hut
Producer: Sally Cusack
Co-interviewer: Luke Addinsall

Other references:
* Dr John Travis, co-founder of the Alliance for the Transforming the Lives of Children
* David Leser, journalist "Men, Women and the Whole Damn Thing" https://www.smh.com.au/lifestyle/the-great-sexual-reckoning-how-did-we-get-here--and-what-happens-now-20180124-h0npcc.html
* Jackson Katz, www.jacksonkatz.com

Luke Addinsall also features in this podcast on male privilege: https://www.spreaker.com/user/pregnancybirthandbeyond/pbb05022018lukeaddinsallmalepriviledge-1

First aired on 99.9 BayFM Byron Bay on Monday 26 March 2018. Interview recorded at BayFM on 20 March 2018.]]>1671fatherhood,maleprivilege,manhood,parenting,raisingboys,timwinton,toxicmasculinity,wereinthistogetherfalsefullParenting & Personality Disorders: A light in dark cornershttps://www.spreaker.com/episode/parenting-personality-disorders-a-light-in-dark-corners--14356510
The celebrations and challenges of raising children can be a rich, diverse journey for all of us. Even when we are feeling mentally strong, there are moments when life, relationships and parenting is a bumpy road.

For 1 in 10 people, living with a personality disorder and parenting can add a tremendous strain to our family experiences and bonds. An umbrella term for more commonly referred to conditions like borderline, narcissism, obsessive compulsive, avoidant and schizotypal, personality disorder can cause significant distress and impairment for the person and families.

In this episode, I'll be traversing the mindscape of personality disorders, wellness, parenting and relationships with Dr Michelle Townsend; a Research Fellow at the Illawarra Health and Medical Research Institute and Project Air Strategy for Personality Disorders at the University of Wollongong. Shining a light on a rarely recognised area of parenting, this show will help de-myth the stigma around mental health, whilst providing strategies and support for those living with a personality disorder.

24 Hour support for mental illness is available via Lifeline on 13 11 14.

Presenter and producer: Sean Tonnet
Copyright PBB Media 2018, Sean Tonnet

First aired on 99.9 BayFM Byron Bay on Monday 19 March 2018

Link to Project Air and Dr Michelle Townsend: www.projectairstrategy.org]]>https://api.spreaker.com/episode/14356510Thu, 22 Mar 2018 10:04:23 +0000PBB Media IncorporatedDe-stigmatising mental health and supporting stronger families The celebrations and challenges of raising children can be a rich, diverse journey for all of us. Even when we are feeling mentally strong, there are moments when life, relationships...
The celebrations and challenges of raising children can be a rich, diverse journey for all of us. Even when we are feeling mentally strong, there are moments when life, relationships and parenting is a bumpy road.

For 1 in 10 people, living with a personality disorder and parenting can add a tremendous strain to our family experiences and bonds. An umbrella term for more commonly referred to conditions like borderline, narcissism, obsessive compulsive, avoidant and schizotypal, personality disorder can cause significant distress and impairment for the person and families.

In this episode, I'll be traversing the mindscape of personality disorders, wellness, parenting and relationships with Dr Michelle Townsend; a Research Fellow at the Illawarra Health and Medical Research Institute and Project Air Strategy for Personality Disorders at the University of Wollongong. Shining a light on a rarely recognised area of parenting, this show will help de-myth the stigma around mental health, whilst providing strategies and support for those living with a personality disorder.

24 Hour support for mental illness is available via Lifeline on 13 11 14.

Presenter and producer: Sean Tonnet
Copyright PBB Media 2018, Sean Tonnet

First aired on 99.9 BayFM Byron Bay on Monday 19 March 2018

Link to Project Air and Dr Michelle Townsend: www.projectairstrategy.org]]>1671mentalhealth,parentingwithmentalillness,suicidefalsefullVagina Conversations: A midwife's story.https://www.spreaker.com/episode/vagina-conversations-a-midwife-s-story--14292511
Warning some aspects of this episodes contains sensitive content. We are talking about women's bodies and in-particular about women's vaginas.

Topics:
Vagina
Birth trauma
Consent
Vagina examinations
Midwifery

Producer & host: Lara Martin
Guest: Ti Harrison]]>https://api.spreaker.com/episode/14292511Thu, 15 Mar 2018 03:58:28 +0000PBB Media IncorporatedThis episode we feature life on the front lines of midwifery. My guest Ti Harrison has been a midwife for the past 27 years and has worked across all models of care and around the world. Ti recently performed at the Vagina Conversations 2018, Byron...
Warning some aspects of this episodes contains sensitive content. We are talking about women's bodies and in-particular about women's vaginas.

Topics:
Vagina
Birth trauma
Consent
Vagina examinations
Midwifery

Producer & host: Lara Martin
Guest: Ti Harrison]]>1672falsefullYouth Rites of Passage with Dr Arne Rubinsteinhttps://www.spreaker.com/episode/youth-rites-of-passage-with-dr-arne-rubinstein--14273984
Interviewee: Dr Arne Rubinstein, Founder, The Making of Men
and The Rites of Passage Institute
themakingofmen.com/

Copyright 2018
PBB Media, Kimberley Lipschus

www.kimberleylipschus.com

First aired on 99.9 BayFM Byron Bay, Australia on 26 February 2018.]]>https://api.spreaker.com/episode/14273984Tue, 13 Mar 2018 08:16:20 +0000PBB Media IncorporatedMany parents or carers of teens and tweens are painfully aware how quickly their young child who bounded with energy, confidence and enthusiasm can flip. Like a switch has been clicked their child suddenly is unrecognisable. Dr Arne Rubinstein is an...
Interviewee: Dr Arne Rubinstein, Founder, The Making of Men
and The Rites of Passage Institute
themakingofmen.com/

Copyright 2018
PBB Media, Kimberley Lipschus

www.kimberleylipschus.com

First aired on 99.9 BayFM Byron Bay, Australia on 26 February 2018.]]>1671makingofmen,manhood,parenting,parentingteens,ritesofpassage,teenageboysfalsefullEmbedding Creativity into Parenthood with Isobelle Carmodyhttps://www.spreaker.com/episode/embedding-creativity-into-parenthood-with-isobelle-carmody--14231938
Presenter and Producer: Sally Cusack
Copyright 2018 PBB Media, Sally Cusack

First aired on 99.9 BayFM on 5 March 2018.

www.isobellecarmody.net
"The Ice Maze" Music by adelaidethegirl on Soundcloud]]>https://api.spreaker.com/episode/14231938Thu, 08 Mar 2018 09:19:00 +0000PBB Media IncorporatedAuthor Isobelle Carmody shares her experiences of imbuing her journey as a mother with creativity, bringing her daughter Adelaide every step of the way. Isobelle relished the time she had during Adelaide's childhood to re-explore the world through a...
Presenter and Producer: Sally Cusack
Copyright 2018 PBB Media, Sally Cusack

First aired on 99.9 BayFM on 5 March 2018.

www.isobellecarmody.net
"The Ice Maze" Music by adelaidethegirl on Soundcloud]]>1671adelaidethegirl,creativemotherhood,creativity,isobellecarmody,parentingfalsefullAdjusting Expectancy: Early experiences of parenthoodhttps://www.spreaker.com/episode/adjusting-expectancy-early-experiences-of-parenthood--14222283
Copyright 2018 PBB Media, Kimberley Lipschus
kimberleylipschus.com

First aired on 99.9 BayFM in February 2018

Photo by jens johnsson on Unsplash]]>https://api.spreaker.com/episode/14222283Wed, 07 Mar 2018 07:33:20 +0000PBB Media IncorporatedA pregnant person or couple have many expectations about their birth, their baby, and parenthood. They dream into what it will be like to give birth, what they’re baby will be like, and what parenthood will turn into for them. In this episode...
Copyright 2018 PBB Media, Kimberley Lipschus
kimberleylipschus.com

First aired on 99.9 BayFM in February 2018

Photo by jens johnsson on Unsplash]]>1671expectantparents,lifewithnewbaby,newbaby,newparentsfalsefullMy father, Helenhttps://www.spreaker.com/episode/my-father-helen--14172005
More information, go to: http://www.pbbmedia.org/ne-plus-ultra/my-father-helen
and: http://www.pbbmedia.org/ne-plus-ultra/our-first-show-on-gender-sexual-diversity

Photo by paul morris on Unsplash

Copyright 2018 Kimberley Lipschus
PBB Media

Presenter and producer: Kimberley Lipschus
www.kimberleylipschus.com]]>https://api.spreaker.com/episode/14172005Thu, 01 Mar 2018 09:18:17 +0000PBB Media IncorporatedIn this episode we meet Kate Speedy, who embarked on a massive journey of transformation when she discovered her father was to transition to being female. This was 20 years ago when Kate was just 19, and living in a world that held very different...
More information, go to: http://www.pbbmedia.org/ne-plus-ultra/my-father-helen
and: http://www.pbbmedia.org/ne-plus-ultra/our-first-show-on-gender-sexual-diversity

Photo by paul morris on Unsplash

Copyright 2018 Kimberley Lipschus
PBB Media

Presenter and producer: Kimberley Lipschus
www.kimberleylipschus.com]]>1671transgenderparentfalsefullGrace Unleashed: Birthing differently this timehttps://www.spreaker.com/episode/grace-unleashed-birthing-differently-this-time--12700721
You can hear my first interview with Ritchie here: https://www.spreaker.com/user/pregnancybirthandbeyond/ritchie-student-midwife

Aired on 99.9 BayFM Byron Bay Australia on 28 August 2017 and the Community Radio Network on 1 September 2017.

Presenter: Sally Cusack

Thanks to the Lee Family for so generously sharing their experiences.

Further information and references:
Specialised counselling to recover from birth trauma: www.birthtalk.org
http://www.pbbmedia.org/ne-plus-ultra/grace-unleashed
http://onlinelibrary.wiley.com/doi/10.1002/14651858.CD000012.pub4/abstract (Impacts of environment on birth)]]>https://api.spreaker.com/episode/12700721Wed, 28 Feb 2018 01:09:00 +0000PBB Media IncorporatedGrace Lee shares her three very different birth stories in three different countries, from caesarean section to VBAC to water birth in home-like setting. Grace's husband Ritchie is a student midwife, having made a huge career change a couple of years...
You can hear my first interview with Ritchie here: https://www.spreaker.com/user/pregnancybirthandbeyond/ritchie-student-midwife

Aired on 99.9 BayFM Byron Bay Australia on 28 August 2017 and the Community Radio Network on 1 September 2017.

Presenter: Sally Cusack

Thanks to the Lee Family for so generously sharing their experiences.

Further information and references:
Specialised counselling to recover from birth trauma: www.birthtalk.org
http://www.pbbmedia.org/ne-plus-ultra/grace-unleashed
http://onlinelibrary.wiley.com/doi/10.1002/14651858.CD000012.pub4/abstract (Impacts of environment on birth)]]>1671birth,birthencaul,healingfrombirth,heplock,intervention,vbac,waterbirthfalsefullLife like a modern day gypsy family; travel adventurehttps://www.spreaker.com/episode/life-like-a-modern-day-gypsy-family-travel-adventure--14112961
This episode of Pregnancy Birth and Beyond we climb that mountain with our guest Taneal Cadou-blake who has recently returned to her home town of Byron Bay in Australia, after three and a half years of travel and living abroad with her family. Taneal, her husband Lalo and their four youngest children packed up all their belongings, took the plunge and set off abroad on a family adventure.

Topics covered:
Travel with family;
Home school;
Living minimally;
Shoe string budget travel.

Host: Lara Martin and Sally Cusack.]]>https://api.spreaker.com/episode/14112961Thu, 22 Feb 2018 01:40:09 +0000PBB Media Incorporated“Because in the end, you won’t remember the time you spent working in the office or mowing your lawn. Climb that goddamn mountain.”― Jack Kerouac This episode of Pregnancy Birth and Beyond we climb that mountain with our guest Taneal Cadou-blake...
This episode of Pregnancy Birth and Beyond we climb that mountain with our guest Taneal Cadou-blake who has recently returned to her home town of Byron Bay in Australia, after three and a half years of travel and living abroad with her family. Taneal, her husband Lalo and their four youngest children packed up all their belongings, took the plunge and set off abroad on a family adventure.

Topics covered:
Travel with family;
Home school;
Living minimally;
Shoe string budget travel.

Host: Lara Martin and Sally Cusack.]]>1672family,gypsy,kidstravel,travelfalsefullCraniosacral Therapy: Healing with heart for babies, for lifehttps://www.spreaker.com/episode/craniosacral-therapy-healing-with-heart-for-babies-for-life--14056838
We can benefit from CST at any age, as our cranial plates never fuse, but babies and pregnant and birthing parents in particular can benefit in many was such as turning breech babies and babies with colic and reflux.

We also hear from Kimberley Lipschus about her extensive experience with using CST for many issues, such as fertility, pregnancy discomfort and positioning of the foetus for birth, as well as post birth recovery and even ADHD.

NOTE: Anatomical training (such as physiotherapy) is not mandatory for therapists to call themselves Craniosacral therapists. One way to find a craniosacral therapist with anatomical training is to visit the Upledger Institute of Australia. CST differs to the chiropractic technique of Craniopathy.

Copyright 2018
PBB Media, Sally Cusack

Presenter and producer: Sally Cusack
Guests: Chris Teale, http://www.christealephysiotherapy.com/, and
Kimberley Lipschus, kimberleylipschus.com

First aired on 99.9 BayFM Byron Bay on 12 February 2018.
Image credit: http://www.christealephysiotherapy.com/]]>https://api.spreaker.com/episode/14056838Thu, 15 Feb 2018 03:25:21 +0000PBB Media IncorporatedSally speaks with Chris Teale, Craniosacral therapist (and physiotherapist) about the osteopathic therapy known as craniosacral therapy (CST), how it works physically, and how it also takes into account a person's emotional state. CST does not...
We can benefit from CST at any age, as our cranial plates never fuse, but babies and pregnant and birthing parents in particular can benefit in many was such as turning breech babies and babies with colic and reflux.

We also hear from Kimberley Lipschus about her extensive experience with using CST for many issues, such as fertility, pregnancy discomfort and positioning of the foetus for birth, as well as post birth recovery and even ADHD.

NOTE: Anatomical training (such as physiotherapy) is not mandatory for therapists to call themselves Craniosacral therapists. One way to find a craniosacral therapist with anatomical training is to visit the Upledger Institute of Australia. CST differs to the chiropractic technique of Craniopathy.

Copyright 2018
PBB Media, Sally Cusack

Presenter and producer: Sally Cusack
Guests: Chris Teale, http://www.christealephysiotherapy.com/, and
Kimberley Lipschus, kimberleylipschus.com

First aired on 99.9 BayFM Byron Bay on 12 February 2018.
Image credit: http://www.christealephysiotherapy.com/]]>1671craniosacraltherapyforbabies,healingfrombirth,postnatalsupportfalsefullMale Privilege: The Impact on Raising Childrenhttps://www.spreaker.com/episode/male-privilege-the-impact-on-raising-children--14000289
List of references (eg book titles/websites mentioned)
1. Manhood - Steve Biddulph https://itunes.apple.com/au/podcast/the-new-manhood/id1293479152?mt=2
2. Tony Porter https://www.youtube.com/watch?v=td1PbsV6B80
3. Jackson Katz https://www.youtube.com/watch?v=KTvSfeCRxe8

First aired on 99.9 BayFM Byron Bay on Monday 5 February 2018.

Presenter: Sean Tonnet
Copyright PBB Media 2018

Image credit: Liane Metzler on unsplash.com]]>https://api.spreaker.com/episode/14000289Thu, 08 Feb 2018 08:58:57 +0000PBB Media IncorporatedFrom birth, many boys are taught that to be a man you have to be competitive and emotionally tough and that vulnerability is a women's domain. How we socialise our children around privilege and entitlement impacts our society tremendously. Even in...
List of references (eg book titles/websites mentioned)
1. Manhood - Steve Biddulph https://itunes.apple.com/au/podcast/the-new-manhood/id1293479152?mt=2
2. Tony Porter https://www.youtube.com/watch?v=td1PbsV6B80
3. Jackson Katz https://www.youtube.com/watch?v=KTvSfeCRxe8

First aired on 99.9 BayFM Byron Bay on Monday 5 February 2018.

Presenter: Sean Tonnet
Copyright PBB Media 2018

Image credit: Liane Metzler on unsplash.com]]>1671manhood,parentingfalsefullBirth stories: Reading between the lines with Hannah Dahlenhttps://www.spreaker.com/episode/birth-stories-reading-between-the-lines-with-hannah-dahlen--13884255
References:
* Birthtalk.org
* Positivebirthmovement.org

First aired on 99.9 BayFM on 22 January 2018

Presenter: Sally Cusack
Copyright PBB Media 2018
Sally Cusack]]>https://api.spreaker.com/episode/13884255Thu, 25 Jan 2018 10:32:03 +0000PBB Media IncorporatedMany women do not receive appropriate care when in labour, making birth more difficult and painful. They then rarely get the opportunity afterwards to debrief with their carer about the events. This can lead to misunderstandings that they can pass...
References:
* Birthtalk.org
* Positivebirthmovement.org

First aired on 99.9 BayFM on 22 January 2018

Presenter: Sally Cusack
Copyright PBB Media 2018
Sally Cusack]]>1671birth,birthrisk,birthtrauma,healingfrombirthfalsefullEco-parenting with Nature's Childhttps://www.spreaker.com/episode/eco-parenting-with-nature-s-child--13836668
If we all make small changes, big things can happen. This episode our guest Jannine shares with us ways families can make small yet meaningful change for both greater quality of life and for the betterment of our planet.
Raising kids is, lets face it, a huge ecological footprint on the planet, but it doesn't have to be all bad. With your purchasing power and a minimalist approach to parenting life with little ones can be earth friendly. We will be going over simple and practical changes you can start making today.

My guest is Jannine Barron founder of Natures Child, a progressive earth based business for the past 18 years. Jannine is a self described entrepreneur activist and mother of two.

++++++++++

Produced and presented by Lara Martin
Copyright 2017 PBB Media and Lara Martin]]>https://api.spreaker.com/episode/13836668Fri, 19 Jan 2018 00:57:47 +0000PBB Media Incorporated“we are living on this planet as if we had another one to go to” Terri Swearingen If we all make small changes, big things can happen. This episode our guest Jannine shares with us ways families can make small yet meaningful change for both greater...
If we all make small changes, big things can happen. This episode our guest Jannine shares with us ways families can make small yet meaningful change for both greater quality of life and for the betterment of our planet.
Raising kids is, lets face it, a huge ecological footprint on the planet, but it doesn't have to be all bad. With your purchasing power and a minimalist approach to parenting life with little ones can be earth friendly. We will be going over simple and practical changes you can start making today.

My guest is Jannine Barron founder of Natures Child, a progressive earth based business for the past 18 years. Jannine is a self described entrepreneur activist and mother of two.

++++++++++

Produced and presented by Lara Martin
Copyright 2017 PBB Media and Lara Martin]]>1665baby,babyessentials,clothdiaper,clothnappy,ecoparenting,parenting,pregnancyfalsefullReconnecting our kids - and ourselves - with naturehttps://www.spreaker.com/episode/reconnecting-our-kids-and-ourselves-with-nature--7061912
Sally's interview with Rohan Stewart from Brunswick Bush School (www.brunsbushschool.com.au) about the importance of nature connection and the weekly opportunity their school provides for children in the community to develop a closer connection with their natural environment, as well as bush survival skills.

Refs: Jon Young, "The Coyote's Guide to Connecting with Nature"
Richard Louv, "The Last Child in the Woods"

Aired on 99.9 BayFM Byron Bay on Monday 26 October 2015

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015.
www.pbbmedia.org]]>https://api.spreaker.com/episode/7061912Sun, 14 Jan 2018 06:20:00 +0000PBB Media Incorporated“The future will belong to the nature-smart—those individuals, families, businesses, and political leaders who develop a deeper understanding of the transformative power of the natural world and who balance the virtual with the real. The more...
Sally's interview with Rohan Stewart from Brunswick Bush School (www.brunsbushschool.com.au) about the importance of nature connection and the weekly opportunity their school provides for children in the community to develop a closer connection with their natural environment, as well as bush survival skills.

Refs: Jon Young, "The Coyote's Guide to Connecting with Nature"
Richard Louv, "The Last Child in the Woods"

Aired on 99.9 BayFM Byron Bay on Monday 26 October 2015

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015.
www.pbbmedia.org]]>1671natureconnection,parentingfalsefullInterview with Ibu Robin Lim; Healthy Birth Healthy Earthhttps://www.spreaker.com/episode/interview-with-ibu-robin-lim-healthy-birth-healthy-earth--2420923
Produced and Presented by Taneal Blake
Copyright PBB Media and Taneal Blake 2013
www,pbbmedia.org

Reproduced by Lara Martin for BayFM and CRN broadcast in January 2018]]>https://api.spreaker.com/episode/2420923Tue, 02 Jan 2018 00:54:00 +0000PBB Media IncorporatedTune in to hear about Bumi Sehat and Robin Lim's book 'Placenta the Forgotten Chakra'. Aired live on bayfm 99.9 Byron Bay Community radio station in 2013. Produced and Presented by Taneal Blake Copyright PBB Media and Taneal Blake 2013...
Produced and Presented by Taneal Blake
Copyright PBB Media and Taneal Blake 2013
www,pbbmedia.org

Reproduced by Lara Martin for BayFM and CRN broadcast in January 2018]]>1670birth,iburobinlim,pregnancyfalsefullHealing kids' anxieties through playhttps://www.spreaker.com/episode/healing-kids-anxieties-through-play--9551549* how the playful parenting approach helps children work through their anxieties and fears,
* the main challenges for kids and parents today and more.

First broadcast on 99.9 BayFM Byron Bay on 26 September 2016 and the Community Radio Network (Australia) on 29 December 2017.

More info on Dr L Cohen here:
http://playfulparenting.com/

Dr Cohen's major influences include:
Patti Wipfler: http://www.handinhandparenting.org/
and
Michael White: http://dulwichcentre.com.au/michael-white-archive/

Additional interview content available through our Patreon account at: https://www.patreon.com/pbbmedia
"How parents can get the support they need to be the parents they want to be through listening partnerships."

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2017
www.pbbmedia.org]]>https://api.spreaker.com/episode/9551549Sun, 31 Dec 2017 01:40:00 +0000PBB Media IncorporatedSally's interview with Dr Lawrence Cohen, parent, child psychologist and author of titles including "Playful Parenting" and "The Opposite of Worry" on: * how the playful parenting approach helps children work through their anxieties and fears, * the...* how the playful parenting approach helps children work through their anxieties and fears,
* the main challenges for kids and parents today and more.

First broadcast on 99.9 BayFM Byron Bay on 26 September 2016 and the Community Radio Network (Australia) on 29 December 2017.

More info on Dr L Cohen here:
http://playfulparenting.com/

Dr Cohen's major influences include:
Patti Wipfler: http://www.handinhandparenting.org/
and
Michael White: http://dulwichcentre.com.au/michael-white-archive/

Additional interview content available through our Patreon account at: https://www.patreon.com/pbbmedia
"How parents can get the support they need to be the parents they want to be through listening partnerships."

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2017
www.pbbmedia.org]]>1671healing,health,kidsanxiety,oppositeofworry,parenting,playforanxiety,playfulparentingfalsefullMary's birthing Jesus storyhttps://www.spreaker.com/episode/mary-s-birthing-jesus-story--3923709
First aired on 99.9 BayFM Byron Bay Christmas Day 2013.

Photo by NeONBRAND on Unsplash]]>https://api.spreaker.com/episode/3923709Sat, 23 Dec 2017 23:24:00 +0000PBB Media IncorporatedIn honour of Christmas day 2013 on the Pregnancy Birth & Beyond show we featured the visionary story of Mary birthing Jesus. An untold story of Christmas spoken and written by Taneal Blake. BayFM presenter introducing and closing the episode is Ros...
First aired on 99.9 BayFM Byron Bay Christmas Day 2013.

Photo by NeONBRAND on Unsplash]]>1671birth,doula,midwife,parenting,pregnancyfalsefullPatreon Episode: One way parents can get the support they needhttps://www.spreaker.com/episode/patreon-episode-one-way-parents-can-get-the-support-they-need--13647673
Full interview available here with Dr L Cohen on how play helps heal kids' anxieties and build connections with their parents and builds their confidence.
https://www.spreaker.com/user/pregnancybirthandbeyond/dr-lawrence-cohen-on-using-play-to-heal-

Recorded in September 2016.]]>https://api.spreaker.com/episode/13647673Fri, 22 Dec 2017 00:33:54 +0000PBB Media IncorporatedFinal part of Sally's interview with Dr Lawrence Cohen on the foundation of playful parenting - the need for parents' to be supported and heard as well through co-operative listening partnerships with other parents. Full interview available here with...
Full interview available here with Dr L Cohen on how play helps heal kids' anxieties and build connections with their parents and builds their confidence.
https://www.spreaker.com/user/pregnancybirthandbeyond/dr-lawrence-cohen-on-using-play-to-heal-

Recorded in September 2016.]]>311co-counselling,listeningpartnerships,parentsupportfalsefullA Baby on the Way: Ep. 10. The babymoonhttps://www.spreaker.com/episode/a-baby-on-the-way-ep-10-the-babymoon--13629801
Produced and presented by Sally Cusack

Copyright 2017 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>https://api.spreaker.com/episode/13629801Tue, 19 Dec 2017 23:11:49 +0000PBB Media IncorporatedWhile it’s important for parents to plan a safe birth of their baby, they also set themselves up for the best possible start in their new life. They can do this by also planning for a period of cosy cocooning with their new baby. This means a few...
Produced and presented by Sally Cusack

Copyright 2017 PBB Media and Sally Cusack
All rights reserved.

www.pbbmedia.org]]>358babymoon,postnatalsupportfalsefullA Baby on the Way: Ep. 9. Preparing siblings for birthhttps://www.spreaker.com/episode/a-baby-on-the-way-ep-9-preparing-siblings-for-birth--13629185
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/13629185Tue, 19 Dec 2017 22:47:17 +0000PBB Media IncorporatedPregnancy and birth is a period of huge change for the other child or children too, so they need special preparation too. There are some simple tips for helping them feel like a part of the process. We’ll also be covering tips for having your other...
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>346preparingsiblings,siblingsatbirthfalsefullA Baby on the Way: Ep. 8. Getting support after birthhttps://www.spreaker.com/episode/a-baby-on-the-way-ep-8-getting-support-after-birth--13629171Dr Howard Chilton.

Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/13629171Tue, 19 Dec 2017 22:45:42 +0000PBB Media IncorporatedA new baby is completely helpless and will need lots of holding and loving attention to acclimatise to the world around them. This means that their parents need a lot of support to give all this reassurance, and the parents need this time too so the...Dr Howard Chilton.

Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>361postnatalcare,postnatalsupportfalsefullA Baby on the Way: Ep. 7. Feeding - both you and your babyhttps://www.spreaker.com/episode/a-baby-on-the-way-ep-7-feeding-both-you-and-your-baby--13629160
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/13629160Tue, 19 Dec 2017 22:43:24 +0000PBB Media IncorporatedIn the early days and weeks, a mother and baby’s recovery from birth and transitioning to their new life together is assured by plenty of time to rest. This will also give them both the best chance of establishing breastfeeding successfully, or a...
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>352babyfeeding,breastfeeding,postnatalcarefalsefullA Baby on the Way: Ep. 6. Sleep and settlinghttps://www.spreaker.com/episode/a-baby-on-the-way-ep-6-sleep-and-settling--13629139
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/13629139Tue, 19 Dec 2017 22:37:06 +0000PBB Media IncorporatedEessential information for safe sleep for baby and how you can get the most sleep possible in the early months. They key to peaceful sleep for your whole family is understanding that a baby’s sleep patterns are very different to the 8 hour block of...
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>361babysleep,cosleeping,settlingbaby,teachingbabytosleepfalsefullA Baby on the Way: Ep. 5. Buying things for babyhttps://www.spreaker.com/episode/a-baby-on-the-way-ep-5-buying-things-for-baby--13629112
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/13629112Tue, 19 Dec 2017 22:29:52 +0000PBB Media IncorporatedThere is a huge array of baby products on the market but what do you really need in the early months for your baby? You may be surprised to find that it can’t all be found in a baby goods store. Produced and presented by Sally Cusack Copyright 2017...
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>361babygoods,babyproducts,buyingforbabyfalsefullA Baby on the Way: Ep. 4. Preparing mentally for birthhttps://www.spreaker.com/episode/a-baby-on-the-way-ep-4-preparing-mentally-for-birth--13629064
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/13629064Tue, 19 Dec 2017 22:26:22 +0000PBB Media IncorporatedThe key to mental preparation for this period rests on understanding the environment a woman needs to give birth efficiently and therefore most safely, and what she and the baby needs immediately after the birth. When we understand these needs, we...
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>361birthpreparationfalsefullA Baby on the Way: Ep. 3. Informed consent - your rights in birthhttps://www.spreaker.com/episode/a-baby-on-the-way-ep-3-informed-consent-your-rights-in-birth--13629048
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/13629048Tue, 19 Dec 2017 22:14:49 +0000PBB Media IncorporatedThis episode covers informed consent and the legal need for all decisions relating to maternal and foetal care to be in the hands of the mother, not the care provider. We learn that like all other people, pregnant woman has the right to informed...
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>360humanrightsinbirth,informedconsentfalsefullA Baby on the Way: Ep. 2. How the body gives birthhttps://www.spreaker.com/episode/a-baby-on-the-way-ep-2-how-the-body-gives-birth--13629041Dr Sarah Buckley.

Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/13629041Tue, 19 Dec 2017 22:10:10 +0000PBB Media IncorporatedThere are only theories about how the onset of labour is triggered, but it is known that the limbic system in the brain releases a cocktail of hormones in a specific sequence. A small number of women will birth quickly, but for many it is a more...Dr Sarah Buckley.

Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>361birthhormones,physiologicalbirthfalsefullA Baby on the Way: Ep. 1. Choosing your maternity carerhttps://www.spreaker.com/episode/a-baby-on-the-way-ep-1-choosing-your-maternity-carer--13629011
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/13629011Tue, 19 Dec 2017 22:07:15 +0000PBB Media IncorporatedA description of the main models of care available, followed by an assessment of the evidence on which models have the best outcomes. Probably not surprisingly, the best outcomes are from continuity of “woman-centred” care models where mothers can...
Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>361choosingmaternitycare,continuityofcare,midwiferycarefalsefullExtra PBB segments: Midwife Tina Grevehttps://www.spreaker.com/episode/extra-pbb-segments-midwife-tina-greve--13592782

Produced and presented by Sally Cusack
Copyright 2014 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/13592782Fri, 15 Dec 2017 06:37:03 +0000PBB Media IncorporatedTina Greve on the distinction between normal birth and physiological birth, host Sally Cusack interviewed at Midwifery Today Conference, Byron Bay, Australia in November 2014. Produced and presented by Sally Cusack Copyright 2014 PBB Media and Sally...

Produced and presented by Sally Cusack
Copyright 2014 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>275falsefullFostering belonginghttps://www.spreaker.com/episode/fostering-belonging--13590098shamefully low. Yet there are multitudes of ways to foster a young person,
including respite foster care. Respite foster care is on the discussion table in this
fascinating episode.

Produced by Kimberley Lipschus
Presenter: Kimberley Lipschus
Guest: Chelsea

Links:
http://canifoster.com.au/ or
www.pbbmedia.org

Copyright PBB Media 2017]]>https://api.spreaker.com/episode/13590098Fri, 15 Dec 2017 01:10:00 +0000PBB Media IncorporatedAs a society, which upholds love, belonging and family, available foster carers are shamefully low. Yet there are multitudes of ways to foster a young person, including respite foster care. Respite foster care is on the discussion table in this...shamefully low. Yet there are multitudes of ways to foster a young person,
including respite foster care. Respite foster care is on the discussion table in this
fascinating episode.

Produced by Kimberley Lipschus
Presenter: Kimberley Lipschus
Guest: Chelsea

Links:
http://canifoster.com.au/ or
www.pbbmedia.org

Copyright PBB Media 2017]]>1671fostercare,fosterparenting,parenting,respitefostercarefalsefullEmotional Wellbeing in Families: The Early Prevention of Mental Healthhttps://www.spreaker.com/episode/emotional-wellbeing-in-families-the-early-prevention-of-mental-health--13523762
This episode of Pregnancy Birth and Beyond was aired live on BayFm 99.9 on 4th December, 2017

Guest: Garry Thomson
Host: Sean Tonnet]]>https://api.spreaker.com/episode/13523762Wed, 06 Dec 2017 20:24:16 +0000PBB Media IncorporatedBy 2030, depression will be the biggest mental health issue on the planet and currently is costing us billions of dollars a year. In this episode we look at emotional health in families and why families are our greatest asset in early prevention of...
This episode of Pregnancy Birth and Beyond was aired live on BayFm 99.9 on 4th December, 2017

Guest: Garry Thomson
Host: Sean Tonnet]]>1671attachment,emotionalhealth,garrythomson,mentalhealth,parenting,seantonnet,upliftingaustraliafalsefullWhat's self-love got to do birth preparationhttps://www.spreaker.com/episode/what-s-self-love-got-to-do-birth-preparation--13459797
This episode of Pregnancy Birth and beyond was aired live on 99.9 Bay Fm on 27th of November 2017.

Guest: Virginia Bobro
Host: Lara Martin]]>https://api.spreaker.com/episode/13459797Wed, 29 Nov 2017 07:27:59 +0000PBB Media IncorporatedIs radical self-love the missing key in birth preparation? Our guest Virginia Bobro, has been working with pregnant families and new parents for over 22 years and is a mother of three university aged children. This episode we dig deeper into...
This episode of Pregnancy Birth and beyond was aired live on 99.9 Bay Fm on 27th of November 2017.

Guest: Virginia Bobro
Host: Lara Martin]]>1671baby,birth,birthingfromwithin,pregnancy,selflovefalsefullCapturing the moment: The rise and rise of birth photographyhttps://www.spreaker.com/episode/capturing-the-moment-the-rise-and-rise-of-birth-photography--13400572
Sally speaks with birth photographer Alex Warland and four mothers who have used professional photographers at their births: Luna, Rhiannon, Anita and Varesha.

For more info and to see the photos the women mention, go to: http://www.pbbmedia.org/ne-plus-ultra/capturing-the-moment

References:
www.zandrawarland.com.au
"The Art of Birth" film by Shea Caplice

Image from Zandra Warland Photography

First aired on 99.9 BayFM Byron Bay, Australia on 20 November 2017.

Copyright PBB Media 2017
Presenter: Sally Cusack]]>https://api.spreaker.com/episode/13400572Thu, 23 Nov 2017 09:07:47 +0000PBB Media IncorporatedEven though the camera was invented over 130 years ago, only in the last 20-30 years has the camera made its way into the birth room, and most of those images were captured by amateurs. But in the last few years we have seen an explosion of...
Sally speaks with birth photographer Alex Warland and four mothers who have used professional photographers at their births: Luna, Rhiannon, Anita and Varesha.

For more info and to see the photos the women mention, go to: http://www.pbbmedia.org/ne-plus-ultra/capturing-the-moment

References:
www.zandrawarland.com.au
"The Art of Birth" film by Shea Caplice

Image from Zandra Warland Photography

First aired on 99.9 BayFM Byron Bay, Australia on 20 November 2017.

Copyright PBB Media 2017
Presenter: Sally Cusack]]>1672birth,birthphotographyfalsefullPreparing for Childbirth with Anna Wattshttps://www.spreaker.com/episode/preparing-for-childbirth-with-anna-watts--13340491
Founder of Celebration of Birth Doula Academy, Anna Watts, is affectionately known as the 'Wise Woman of Doulas' or 'Mama Doula', she has been guiding women and their partners through the journey of pregnancy and birth for over 28 years. Anna believes in honouring and celebrating birth as a ‘rite of passage’ for mother, father and baby, supporting empowered birthing choices and strengthening the spiritual connection in pregnancy and birth.

The Celebration of Birth Doula Academy teaches from a holistic perspective, including educational, creative, experiential and spiritual. If you are looking for Doula Training that offers personal as well as professional learning and growth, with on-going mentoring and guidance as you launch your doula career please visit the following pages for more information - Sacred Birth Doula Training and Sacred Beginnings Post-natal Training.

Produced by Annalee Atia
Presenter: Annalee Atia
Guest: Anna Watts

Links:
https://celebrationofbirth.com
www.pbbmedia.org

Credits:
Fields of Gold by Sting]]>https://api.spreaker.com/episode/13340491Thu, 16 Nov 2017 04:34:07 +0000PBB Media IncorporatedLooking at the Physical, Mental, Emotional and Spiritual aspects of preparing for childbirth, with Anna Watts. Founder of Celebration of Birth Doula Academy, Anna Watts, is affectionately known as the 'Wise Woman of Doulas' or 'Mama Doula', she has...
Founder of Celebration of Birth Doula Academy, Anna Watts, is affectionately known as the 'Wise Woman of Doulas' or 'Mama Doula', she has been guiding women and their partners through the journey of pregnancy and birth for over 28 years. Anna believes in honouring and celebrating birth as a ‘rite of passage’ for mother, father and baby, supporting empowered birthing choices and strengthening the spiritual connection in pregnancy and birth.

The Celebration of Birth Doula Academy teaches from a holistic perspective, including educational, creative, experiential and spiritual. If you are looking for Doula Training that offers personal as well as professional learning and growth, with on-going mentoring and guidance as you launch your doula career please visit the following pages for more information - Sacred Birth Doula Training and Sacred Beginnings Post-natal Training.

Produced by Annalee Atia
Presenter: Annalee Atia
Guest: Anna Watts

Links:
https://celebrationofbirth.com
www.pbbmedia.org

Credits:
Fields of Gold by Sting]]>1681childbirth,mothers,pregnancy,womenshealth,womenswellbeingfalsefullTaking Birth to a Positive placehttps://www.spreaker.com/episode/taking-birth-to-a-positive-place--13287659
Our guest today is Milli Hill, founder of the Positve Birth Movement, Milli set up the Positive Birth Movement from her living room in 2012, motivated by both her own birth experiences, and her growing frustration whenever she heard the words, "They didn't let me" in a birth story. She has since gone on to become a well recognised voice for women in the birth world, writing extensively in the mainstream press (BestDaily, Telegraph, Guardian) and apearing at various confrences and talks. She has three small children and lives in Somerset.

The positive birth movement is a grass roots movement, spreading positivity about childbirth via a global network of free Positive Birth groups, linked up by social media.
What began in 2012 as one small meeting in the living room of writer and campaigner Milli Hill, is now a global network of over 450 'real life' groups, with a massive social media presence too.

And they just keep on growing. They think this is because they break down the walls that the so-called 'birth wars' try to build between women. They don't hold any one kind of birth up above another. They are just concerned with every woman getting the best possible birth experience, for her, on that day.

About Milli:
Milli Hill is the Founder and Director of the positive birth movement.
Milli set up the Positive Birth Movement in 2013 and has since run it from her laptop whilst her three small children sit on her arms. She is passionate about positive birth as a human right for all women and campaigns and speaks on this issue in the media and at high profile conferences and events. She is a Columnist for Telegraph Women and the author of The Positive Birth Book. Milli lives in Somerset and is happy to be contacted on 077 391 391 15 or via info@positivebirthmovement.org.

Links:
www.pbbmedia.org
http://www.positivebirthmovement.org

Copyright
Producer/Host: Annalee Atia
Interviewee: Milli Hill
Music: Deva Premal and Miten, 'Ida Were Were' (African folk song)]]>https://api.spreaker.com/episode/13287659Fri, 10 Nov 2017 00:16:05 +0000PBB Media IncorporatedFor people listening in today or if you have friends or family with unresolved birth trauma, no matter how long ago, there are birth trauma specific resources such as birthtalk.org, birthing from within, and PANDA.org.au which are dedicate to...
Our guest today is Milli Hill, founder of the Positve Birth Movement, Milli set up the Positive Birth Movement from her living room in 2012, motivated by both her own birth experiences, and her growing frustration whenever she heard the words, "They didn't let me" in a birth story. She has since gone on to become a well recognised voice for women in the birth world, writing extensively in the mainstream press (BestDaily, Telegraph, Guardian) and apearing at various confrences and talks. She has three small children and lives in Somerset.

The positive birth movement is a grass roots movement, spreading positivity about childbirth via a global network of free Positive Birth groups, linked up by social media.
What began in 2012 as one small meeting in the living room of writer and campaigner Milli Hill, is now a global network of over 450 'real life' groups, with a massive social media presence too.

And they just keep on growing. They think this is because they break down the walls that the so-called 'birth wars' try to build between women. They don't hold any one kind of birth up above another. They are just concerned with every woman getting the best possible birth experience, for her, on that day.

About Milli:
Milli Hill is the Founder and Director of the positive birth movement.
Milli set up the Positive Birth Movement in 2013 and has since run it from her laptop whilst her three small children sit on her arms. She is passionate about positive birth as a human right for all women and campaigns and speaks on this issue in the media and at high profile conferences and events. She is a Columnist for Telegraph Women and the author of The Positive Birth Book. Milli lives in Somerset and is happy to be contacted on 077 391 391 15 or via info@positivebirthmovement.org.

Links:
www.pbbmedia.org
http://www.positivebirthmovement.org

Copyright
Producer/Host: Annalee Atia
Interviewee: Milli Hill
Music: Deva Premal and Miten, 'Ida Were Were' (African folk song)]]>1671childbirth,mentalhealth,positivebirth,postnataldepression,womenshealthfalsefullStepping Up: Feeling the fear and doing it anywayhttps://www.spreaker.com/episode/stepping-up-feeling-the-fear-and-doing-it-anyway--13224490
More on Nicqui's work at: https://www.youtube.com/watch?v=fjoSmCLqpwI

WARNING: This episode mentions suicide. If you or someone you know needs help, go to the following resources:
* Mental Health First Aid Australia: www.mhfa.com.au
* Beyond Blue: Ph 1300 22 4636, www.beyondblue.org.au
* Lifeline: Ph 13 11 14

Presenter: Sally Cusack
Copyright Pregnancy Birth and Beyond Media 2017

First aired from 99.9 BayFM Byron Bay, Australia on Monday 30 October 2017.]]>https://api.spreaker.com/episode/13224490Thu, 02 Nov 2017 07:59:17 +0000PBB Media IncorporatedProfile of an activist, volunteer and mother - Nicqui Yazdi. Sally's conversation with Nicqui covers broad terrain from how she came to train as a mental health counsellor, setting up youth support programmes, in particular Byron Schoolies Hub, the...
More on Nicqui's work at: https://www.youtube.com/watch?v=fjoSmCLqpwI

WARNING: This episode mentions suicide. If you or someone you know needs help, go to the following resources:
* Mental Health First Aid Australia: www.mhfa.com.au
* Beyond Blue: Ph 1300 22 4636, www.beyondblue.org.au
* Lifeline: Ph 13 11 14

Presenter: Sally Cusack
Copyright Pregnancy Birth and Beyond Media 2017

First aired from 99.9 BayFM Byron Bay, Australia on Monday 30 October 2017.]]>1671byronschoolieshub,parenting,volunteering,youthsupportfalsefullDad time: Maintaining your health & fitness when you become a parenthttps://www.spreaker.com/episode/dad-time-maintaining-your-health-fitness-when-you-become-a-parent--13125031
In this episode we talk with Horst Tomsan; father, husband and health professional about parenting, exercise, food and well-being.

Horst speaks from the heart in exploring the importance of setting up a family culture that recognises the importance of healthy lifestyles in parenting.

This episodes guests: Horst Tomsan, owner of Knox & Aya Vegan Ice Creams www.knoxandaya.com

Producer and show hosts: Lara Martin and Sean Tonnet

broadcast on the 23rd of Octoer, 2017 from the studio's of 99.9 Bay Fm, from the heart of Byron Bay, Australia.]]>https://api.spreaker.com/episode/13125031Wed, 25 Oct 2017 20:09:13 +0000PBB Media IncorporatedFrom the throes of sleep deprivation to driving our children from one activity to the next, parenthood can wreak havoc on our usual schedule. As such, parenting and exercise are not usually words you see in the same sentence. Our needs will often...
In this episode we talk with Horst Tomsan; father, husband and health professional about parenting, exercise, food and well-being.

Horst speaks from the heart in exploring the importance of setting up a family culture that recognises the importance of healthy lifestyles in parenting.

This episodes guests: Horst Tomsan, owner of Knox & Aya Vegan Ice Creams www.knoxandaya.com

Producer and show hosts: Lara Martin and Sean Tonnet

broadcast on the 23rd of Octoer, 2017 from the studio's of 99.9 Bay Fm, from the heart of Byron Bay, Australia.]]>1671dadsandfamilies,fatherhood,health.wellness,newparents,parentingfalsefullSurviving fertility challengeshttps://www.spreaker.com/episode/surviving-fertility-challenges--13080950
First aired on 99.9 BayFM Byron Bay Australia on 16 October 2017

SHARON’S ARTICLE LINKS
http://www.covingtontherapy.com/resources/articles/

SHARON
http://www.covingtontherapy.com

Ending music credit: Calm of Night, Neil Cross
Photo credit: Photo by Farica Yang on Unsplash]]>https://api.spreaker.com/episode/13080950Thu, 19 Oct 2017 22:32:09 +0000PBB Media IncorporatedFertility challenges can take many forms. Women may have experienced miscarriages, inability to fall pregnant, chemical pregnancies, or more. This has a huge impact on not only women but those who are close to them. In this episode of PBB we delve...
First aired on 99.9 BayFM Byron Bay Australia on 16 October 2017

SHARON’S ARTICLE LINKS
http://www.covingtontherapy.com/resources/articles/

SHARON
http://www.covingtontherapy.com

Ending music credit: Calm of Night, Neil Cross
Photo credit: Photo by Farica Yang on Unsplash]]>1671fertility,fertilitychallenges,infertilitychallenges,survivingivffalsefullFood Sustainabillity starts at the kitchen table with Eva Perronihttps://www.spreaker.com/episode/food-sustainabillity-starts-at-the-kitchen-table-with-eva-perroni--13053728
Our geust is Eva Perroni, Eva is a freelance researcher-writer who uses food as a window to explore social, environmental, cultural and spiritual matters. She holds an MA in Development Studies from the University of Melbourne and has written for prominent thought-leaders in the food justice and sustainable farming sectors. She absolutely loves to cook and finds nothing more pleasurable than sharing good food and wine with others. Mother and PBB team member Meggie Danielson also features in pasrts of the interview.

www.pbbmedia.org

https://foodtank.com/news/author/eva-perroni/

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, Eva Peroni, PBB Media]]>https://api.spreaker.com/episode/13053728Tue, 17 Oct 2017 05:32:24 +0000PBB Media IncorporatedIn this episode we will be looking at the links between our family kitchen and food sustainability. How and where our food comes from, the impact we are having on the food chain and how coming back to our roots, to a deepoer connection with food, can...
Our geust is Eva Perroni, Eva is a freelance researcher-writer who uses food as a window to explore social, environmental, cultural and spiritual matters. She holds an MA in Development Studies from the University of Melbourne and has written for prominent thought-leaders in the food justice and sustainable farming sectors. She absolutely loves to cook and finds nothing more pleasurable than sharing good food and wine with others. Mother and PBB team member Meggie Danielson also features in pasrts of the interview.

www.pbbmedia.org

https://foodtank.com/news/author/eva-perroni/

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, Eva Peroni, PBB Media]]>4031familyfood,food,foodsustainability,parenting,sustainabilityfalsefullBreastfeeding 101https://www.spreaker.com/episode/breastfeeding-101--13006094
Also featured in this episode:
- Breastfeeding in public
- Breastfeeding into early childhood
- WHO recommendations on breastfeeding
- The marketing of artificial milk substitutes (formula)
- Australian Breastfeeding Association

Our guest is Samaya Askill mother of 3, who had breastfeed for 12 years and was a breastfeeding counsellor for 8 years.

Hosts: Lara Martin and Kimberly Lipschus.
aired live on 9th of Oct 17.

Resources for this episode:

www.breastfeeding.asn.au

https://www.aihw.gov.au/reports/mothers-babies/2010-australian-national-infant-feeding-survey/contents/table-of-contents

http://www.who.int/nutrition/topics/infantfeeding_recommendation/en/]]>https://api.spreaker.com/episode/13006094Tue, 10 Oct 2017 22:06:43 +0000PBB Media IncorporatedBreastfeeding, a biological norm, while natural is a learnt skill for both mother and baby. Breastfeeding is for many an intrinsic part of the parenting journey, yet it can be full of tears and also full of joy. With all the conflicting advice and...
Also featured in this episode:
- Breastfeeding in public
- Breastfeeding into early childhood
- WHO recommendations on breastfeeding
- The marketing of artificial milk substitutes (formula)
- Australian Breastfeeding Association

Our guest is Samaya Askill mother of 3, who had breastfeed for 12 years and was a breastfeeding counsellor for 8 years.

Hosts: Lara Martin and Kimberly Lipschus.
aired live on 9th of Oct 17.

Resources for this episode:

www.breastfeeding.asn.au

https://www.aihw.gov.au/reports/mothers-babies/2010-australian-national-infant-feeding-survey/contents/table-of-contents

http://www.who.int/nutrition/topics/infantfeeding_recommendation/en/]]>1671baby,breastfeeding,breastmilk,parenting,pregnancyfalsefullExtras: Keto cooking and Oz/Israeli Family Travelshttps://www.spreaker.com/episode/extras-keto-cooking-and-oz-israeli-family-travels--12924169
Featuring:
* Ray and Josephine Cusack with two grain free recipes, and
* Dolit Gliksman and children, Yoav, Tal and Yael about Israeli food, their couch surfing adventures as a family in Europe in 2016 and Israeli music selected by Dolit.]]>https://api.spreaker.com/episode/12924169Sat, 30 Sep 2017 09:04:04 +0000PBB Media IncorporatedSally filling in for The Belly Show on 99.9 BayFM in Byron Bay on 11 September 2017. Featuring: * Ray and Josephine Cusack with two grain free recipes, and * Dolit Gliksman and children, Yoav, Tal and Yael about Israeli food, their couch surfing...
Featuring:
* Ray and Josephine Cusack with two grain free recipes, and
* Dolit Gliksman and children, Yoav, Tal and Yael about Israeli food, their couch surfing adventures as a family in Europe in 2016 and Israeli music selected by Dolit.]]>3356couchsurfing,familytravel,israelifood,ketocookingfalsefullHelp me keep close to my babyhttps://www.spreaker.com/episode/help-me-keep-close-to-my-baby--12913911
We hear from Dr Robyn Thompson, midwife and breastfeeding researcher, on why it is so important for handling of a new baby by others is best kept to a minimum if all is well - even hospital staff. New parents need lots of quiet time to adjust to their lives as parents, to recover from birth and to support the baby's own process of learning to breastfeed.

We also hear from a mother of two children who knew instinctively the importance of minimising lots of outside contact during the early weeks and as a consequence, her babies were very calm. However, not everyone understood her intentions, but she held her ground on this. She calls for extended family and friends to respect new parents' choices to keep life quiet and simple in the early weeks.

If new parents aren't explicit in their wish for this, it is worth asking if that is what they would like and how you can support them.

This information is to support expectant parents and help prevent issues arising postnatally. Birth and breastfeeding takes its own path and can have unexpected turns. There are specialised services for parents to discuss their births, no matter how long ago, including: www.birthtalk.org, consiousbirth.com, birthingfromwithin.com

Credits:
- Dr Robyn Thompson, www.breastfeedingconsultant.com
- special thanks to Petria, mother, for sharing her personal stories

References:
Dr Robyn Thompson - http://www.breastfeedingconsultant.com/single-post/2017/09/02/The-First-Breastfeed
The Birth Pause: thebirthpause.com
Dr Nils Bergman: http://thebirthpause.com/tag/skin-to-skin
Sarah Blaffer Hrdy, Mother Nature (1999) Babies Celebrated: “ For species such as primates, the mother IS the environment.”
Microbirth Movie: microbirth.com

Producer: Sally Cusack
copyright www.pbbmedia.org
2017

First broadcast on 99.9 BayFM, Byron Bay, Australia on 25 September 2017.]]>https://api.spreaker.com/episode/12913911Thu, 28 Sep 2017 23:31:15 +0000PBB Media IncorporatedThe first minutes, hours and days with a newborn baby are crucial for setting up the best possible adjustment to life outside the womb, learning to breastfeed and recovery for mother and baby. This is best achieved through supporting new parents to...
We hear from Dr Robyn Thompson, midwife and breastfeeding researcher, on why it is so important for handling of a new baby by others is best kept to a minimum if all is well - even hospital staff. New parents need lots of quiet time to adjust to their lives as parents, to recover from birth and to support the baby's own process of learning to breastfeed.

We also hear from a mother of two children who knew instinctively the importance of minimising lots of outside contact during the early weeks and as a consequence, her babies were very calm. However, not everyone understood her intentions, but she held her ground on this. She calls for extended family and friends to respect new parents' choices to keep life quiet and simple in the early weeks.

If new parents aren't explicit in their wish for this, it is worth asking if that is what they would like and how you can support them.

This information is to support expectant parents and help prevent issues arising postnatally. Birth and breastfeeding takes its own path and can have unexpected turns. There are specialised services for parents to discuss their births, no matter how long ago, including: www.birthtalk.org, consiousbirth.com, birthingfromwithin.com

Credits:
- Dr Robyn Thompson, www.breastfeedingconsultant.com
- special thanks to Petria, mother, for sharing her personal stories

References:
Dr Robyn Thompson - http://www.breastfeedingconsultant.com/single-post/2017/09/02/The-First-Breastfeed
The Birth Pause: thebirthpause.com
Dr Nils Bergman: http://thebirthpause.com/tag/skin-to-skin
Sarah Blaffer Hrdy, Mother Nature (1999) Babies Celebrated: “ For species such as primates, the mother IS the environment.”
Microbirth Movie: microbirth.com

Producer: Sally Cusack
copyright www.pbbmedia.org
2017

First broadcast on 99.9 BayFM, Byron Bay, Australia on 25 September 2017.]]>1671breastfeeding,noyoucan'tholdthebabyyet,postnatalsupportfalsefull"No one told me what it would be like" preparing for postpartumhttps://www.spreaker.com/episode/no-one-told-me-what-it-would-be-like-preparing-for-postpartum--12776709
This episode we talk with Natasha Marchand and Bianca Sprague, founders of Bebo Mia on what to expect and how to prepare, antenatally, for the postpartum journey ahead.

If you would like support for yourself or your partner during this time, visit us at PBBmedia.org for the blog post that will go with this episode with links to support services.

Bianca and Natasha have created a postpartum plan work book to allow parents to be to go through all the things we have talked in this episode and more. This is a freebie gift so parents to be can feel as prepared as you can be for the incredible amazing roller coaster ride of the baby moon time, Download at beboMia.com/postpartumplan

This episodes guests: Natasha Marchand and Bianca Sprague founders of bebomia www.bebomia.com

Producer and show hosts: Lara Martin and Kimberly Lipschus

broadcast on the 11th of September, 2017 from the studio's of 99.9 Bay Fm, from the heart of Byron Bay, Australia.]]>https://api.spreaker.com/episode/12776709Tue, 12 Sep 2017 00:06:19 +0000PBB Media IncorporatedWhen a baby is born, a new family unit is also birthed. There is a lot to learn, and to adjust to. While life goes on around you, for a new parent or parents, their world with a newborn shrinks. It becomes their entire universe. This episode we...
This episode we talk with Natasha Marchand and Bianca Sprague, founders of Bebo Mia on what to expect and how to prepare, antenatally, for the postpartum journey ahead.

If you would like support for yourself or your partner during this time, visit us at PBBmedia.org for the blog post that will go with this episode with links to support services.

Bianca and Natasha have created a postpartum plan work book to allow parents to be to go through all the things we have talked in this episode and more. This is a freebie gift so parents to be can feel as prepared as you can be for the incredible amazing roller coaster ride of the baby moon time, Download at beboMia.com/postpartumplan

This episodes guests: Natasha Marchand and Bianca Sprague founders of bebomia www.bebomia.com

Producer and show hosts: Lara Martin and Kimberly Lipschus

broadcast on the 11th of September, 2017 from the studio's of 99.9 Bay Fm, from the heart of Byron Bay, Australia.]]>1671baby,babymoon,birth,postnatal,postpartumfalsefullThe Changing Landscape of Medicine - Part2. Produced and Presented by Annalee Atia.https://www.spreaker.com/episode/the-changing-landscape-of-medicine-part2-produced-and-presented-by-annalee-atia--12769634
That being said; there are a few factors that hinder our wonderful health care system. Around the world Healthcare is going through major transformations and new models of Medicine are emerging. Tune-in to find out how medicine emerging is changing the landscape of healthcare and how we fare here in Australia.

Produced and Presented by Annalee Atia.

Go to our website for citations, links and the full article www.pbbmedia.org]]>https://api.spreaker.com/episode/12769634Mon, 11 Sep 2017 04:33:52 +0000PBB Media IncorporatedOur Australian Healthcare system is considered to be one of the best in the world, it came shy just after the U.K. Second best. Countries that provide their citizens with universal healthcare not surprisingly, sit at the top of the list. The USA with...
That being said; there are a few factors that hinder our wonderful health care system. Around the world Healthcare is going through major transformations and new models of Medicine are emerging. Tune-in to find out how medicine emerging is changing the landscape of healthcare and how we fare here in Australia.

Produced and Presented by Annalee Atia.

Go to our website for citations, links and the full article www.pbbmedia.org]]>1671australianhealthcare,communityandsustainableliving,functionalforum,functionalmedicine,healthcare,integrativemedicine,medicine,pbbmediafalsefullExtras: Drama for kids - connection, confidence, imaginationhttps://www.spreaker.com/episode/extras-drama-for-kids-connection-confidence-imagination--12667593
Broadcast on 99.9 BayFM Byron Bay, Australia 28 August 2017.]]>https://api.spreaker.com/episode/12667593Mon, 28 Aug 2017 06:29:54 +0000PBB Media IncorporatedSally's interview with Shona Anderson of Nebula Drama on the many benefits the dramatic arts brings to kids. Broadcast on 99.9 BayFM Byron Bay, Australia 28 August 2017.
Broadcast on 99.9 BayFM Byron Bay, Australia 28 August 2017.]]>370dramaforkidsfalsefullraising kids who care about the earthhttps://www.spreaker.com/episode/raising-kids-who-care-about-the-earth--12615903Annie's son Jonahki also join to accompany Annie for a live song.
We also have some great ways you can incorporate environmental sustainability into your family life.

Environmental Sustainability and sustainable growth is development that meets current demands without compromising the ability of future generations to meet their own needs and enjoy the earth. This definition of sustainability comes from the Brundtland Report in 1987, setting the standard for sustainable development.

Produced and hosted by
Lara Martin and Gaby Tudor
Guest: Annie Bryant www.talesandsongs.com
visit us at www.PBBmedia.org]]>https://api.spreaker.com/episode/12615903Mon, 21 Aug 2017 07:38:27 +0000PBB Media IncorporatedThis episode of Pregnancy Birth and Beyond we are talking about raising kids who care for the earth, sustainability and farm life. Our guest is Annie Bryant, storyteller and musician. Annie lives on a hubby scale farm on the far south coast of...Annie's son Jonahki also join to accompany Annie for a live song.
We also have some great ways you can incorporate environmental sustainability into your family life.

Environmental Sustainability and sustainable growth is development that meets current demands without compromising the ability of future generations to meet their own needs and enjoy the earth. This definition of sustainability comes from the Brundtland Report in 1987, setting the standard for sustainable development.

Produced and hosted by
Lara Martin and Gaby Tudor
Guest: Annie Bryant www.talesandsongs.com
visit us at www.PBBmedia.org]]>1671farmlife,farmstories,kidsmusic,kids.songs,parentingfalsefullBlended families, change and Fatherhoodhttps://www.spreaker.com/episode/blended-families-change-and-fatherhood--12599193
But what of the times when you are not defined by work or purpose, rather just by being. Erik speaks of the impact of the labels we ourselves use and the value society puts on them, the difficulties many men face in becoming fathers and being in relationship and what happens when relationships break down.. what happens when you break down?

Moving from being a couple with a child, to then being single then to being in relationship again with a partner who also has children and meanwhile your first ex is getting together with another and having babies.. Blended families can be complex at best, intriguing and sometimes downright fun.

We discuss all this and more in this episode of Pregnancy, Birth and Beyond.

Links:
http://www.puravidawellness.com.au
www.annaleeatia.com
www.pbbmedia.org

Credits (music snippets):
Salif Kaita, Yamore
George Harrison, Sat Singing

Copyright:
PBB Media 2017
Annalee Atia]]>https://api.spreaker.com/episode/12599193Fri, 18 Aug 2017 03:29:50 +0000PBB Media IncorporatedWere talking about blended families, parenting and fatherhood in this episode of Pregnancy, Birth and Beyond. Our guest Erik Adams is a father, long-time practitioner and supporter of the healing and wellness movement and local to the northern rivers...
But what of the times when you are not defined by work or purpose, rather just by being. Erik speaks of the impact of the labels we ourselves use and the value society puts on them, the difficulties many men face in becoming fathers and being in relationship and what happens when relationships break down.. what happens when you break down?

Moving from being a couple with a child, to then being single then to being in relationship again with a partner who also has children and meanwhile your first ex is getting together with another and having babies.. Blended families can be complex at best, intriguing and sometimes downright fun.

We discuss all this and more in this episode of Pregnancy, Birth and Beyond.

Links:
http://www.puravidawellness.com.au
www.annaleeatia.com
www.pbbmedia.org

Credits (music snippets):
Salif Kaita, Yamore
George Harrison, Sat Singing

Copyright:
PBB Media 2017
Annalee Atia]]>1671becomingdad,blendedfamilies,fatherhood,menswellbeing,parentingfalsefullThe missing link in birth preparationhttps://www.spreaker.com/episode/the-missing-link-in-birth-preparation--12550067
Surely there’s some preparation couples can do, rather than adjusting their relationship on the run after baby arrives.

In this episode we meet Tondi Gilfillan and Sean Tonnet, relationship counsellors from Interrelate Family Centres, and discuss the importance of preparing our relationship during pregnancy for the enormous challenges. We explore how to build 'relationship scaffolding' and understand 'your dance as a couple'. A key tip is to discuss expectations you have about your new lives together, for example who will care for the baby and how.

Further reading:
"Becoming Us" by Elly Taylor
www.interrelate.org.au

* https://www.babble.com/relationships/breaking-up-after-baby/

Closing music: "Natural Selections" by Sampology

Aired on 99.9 BayFM Byron Bay Australia on 7 August 2017.

Produced and presented by Sally Cusack
Copyright PBB Media Sally Cusack 2017]]>https://api.spreaker.com/episode/12550067Fri, 11 Aug 2017 00:39:43 +0000PBB Media IncorporatedAccording to the Relationship Research Institute in Seattle, approx two thirds of couples find their relationship has suffered within three years of the birth of a child. Within five years of the birth of a first child, 13 percent of married couples...
Surely there’s some preparation couples can do, rather than adjusting their relationship on the run after baby arrives.

In this episode we meet Tondi Gilfillan and Sean Tonnet, relationship counsellors from Interrelate Family Centres, and discuss the importance of preparing our relationship during pregnancy for the enormous challenges. We explore how to build 'relationship scaffolding' and understand 'your dance as a couple'. A key tip is to discuss expectations you have about your new lives together, for example who will care for the baby and how.

Further reading:
"Becoming Us" by Elly Taylor
www.interrelate.org.au

* https://www.babble.com/relationships/breaking-up-after-baby/

Closing music: "Natural Selections" by Sampology

Aired on 99.9 BayFM Byron Bay Australia on 7 August 2017.

Produced and presented by Sally Cusack
Copyright PBB Media Sally Cusack 2017]]>1671birth,parenting,pregnancyfalsefullOur wired-up, connected-in life. What's the fuss about?https://www.spreaker.com/episode/our-wired-up-connected-in-life-what-s-the-fuss-about--12485724
But is it safe? Our babies and children are being exposed in a way we never were. Will we live to regret our love affair with mobile technology?

In this episode Sally shares her experience with EMR exposure and how to protect herself. She speaks with naturopath and author Sherrill Sellman about how EMR impacts the body and how we can protect ourselves.

The main take-home lessons for me?
* Use your mobile phone on speaker mode, or use plug-in ear phones. Do not hold it to your head or carry it on your body, especially pregnant bodies.
* Turn your mobile phone onto "Airplane" mode when in the care and if you give it to your child to play with.
* Turn your wifi off at night.
* Get rid of your cordless phone. These things emit incredibly high levels of EMFs.
* Cover your smart meters with covers you can buy, or make your own (see Youtube for examples :)
* Don't use your laptop on your lap. Type from a separate keyboard/mouse rather than directly onto your laptop when you can.

Broadcast on 99.9 BayFM Byron Bay on Monday 31 July 2017.

Sherrill Sellman: www.whatwomenmustknow.com
Sherrill's podcasts: http://prn.fm/category/archives/what-women-must-know/

Other resources mentioned:
* EMF Researchers: Professor Emeritus Martin Pall, Dr Erica Mallory Blythe, Dr Devra Davis.
* Free information on EMR/EMFs: www.emraware.com
* ABC TV Catalyst episode of "Wi-fried": http://www.abc.net.au/mediawatch/transcripts/s4411611.htm
* https://www.bellybelly.com.au/baby/can-wifi-affect-your-baby-during-pregnancy-or-after/
* https://www.bellybelly.com.au/pregnancy/ultrasounds-pregnancy-risks-benefits/
* WHO's listing of EMFs as Class 2B possible carcinogen: http://monographs.iarc.fr/ENG/Classification/
* Example skeptic site: http://www.emfandhealth.com/
* Building biologists offer services for assessing the EMR in your home, such as www.healthylivingspaces.com.au (I can't vouch for this service as I haven't used it.)
* One of the technologies available to assist the body's reaction to EMR is Magnetic Resonance Effect Technology (MRET). (I can't vouch for this either.)

Happy researching! Let us know what you find at our Facebook page or hello@pbbmedia.org.

Produced and presented by: Sally Cusack 2017
Copyright Sally Cusack and PBB Media 2017]]>https://api.spreaker.com/episode/12485724Wed, 02 Aug 2017 05:45:45 +0000PBB Media IncorporatedSince the invention of the mobile phone nearly 30 years ago, we have seen an explosion of wireless technologies come into our lives. Now, almost everyone has a mobile phones, children included, WiFi throughout our homes, smart meters, and now with 5G...
But is it safe? Our babies and children are being exposed in a way we never were. Will we live to regret our love affair with mobile technology?

In this episode Sally shares her experience with EMR exposure and how to protect herself. She speaks with naturopath and author Sherrill Sellman about how EMR impacts the body and how we can protect ourselves.

The main take-home lessons for me?
* Use your mobile phone on speaker mode, or use plug-in ear phones. Do not hold it to your head or carry it on your body, especially pregnant bodies.
* Turn your mobile phone onto "Airplane" mode when in the care and if you give it to your child to play with.
* Turn your wifi off at night.
* Get rid of your cordless phone. These things emit incredibly high levels of EMFs.
* Cover your smart meters with covers you can buy, or make your own (see Youtube for examples :)
* Don't use your laptop on your lap. Type from a separate keyboard/mouse rather than directly onto your laptop when you can.

Broadcast on 99.9 BayFM Byron Bay on Monday 31 July 2017.

Sherrill Sellman: www.whatwomenmustknow.com
Sherrill's podcasts: http://prn.fm/category/archives/what-women-must-know/

Other resources mentioned:
* EMF Researchers: Professor Emeritus Martin Pall, Dr Erica Mallory Blythe, Dr Devra Davis.
* Free information on EMR/EMFs: www.emraware.com
* ABC TV Catalyst episode of "Wi-fried": http://www.abc.net.au/mediawatch/transcripts/s4411611.htm
* https://www.bellybelly.com.au/baby/can-wifi-affect-your-baby-during-pregnancy-or-after/
* https://www.bellybelly.com.au/pregnancy/ultrasounds-pregnancy-risks-benefits/
* WHO's listing of EMFs as Class 2B possible carcinogen: http://monographs.iarc.fr/ENG/Classification/
* Example skeptic site: http://www.emfandhealth.com/
* Building biologists offer services for assessing the EMR in your home, such as www.healthylivingspaces.com.au (I can't vouch for this service as I haven't used it.)
* One of the technologies available to assist the body's reaction to EMR is Magnetic Resonance Effect Technology (MRET). (I can't vouch for this either.)

Happy researching! Let us know what you find at our Facebook page or hello@pbbmedia.org.

Produced and presented by: Sally Cusack 2017
Copyright Sally Cusack and PBB Media 2017]]>1676emfs,emr,health,sherrillsellman,wifirisksfalsefullViolence & scary themes in children's storieshttps://www.spreaker.com/episode/violence-scary-themes-in-children-s-stories--12436000In this episode we interview three guests, psychologist & author Robin Grille, children story teller and singer song writer Annie Bryant and luminous youth founder Erica Nettle Chick.

Connect with this episodes guests go to:
Robin Grille - www.hearttoheartparenting.org
Annie Bryant - www.talesandsongs.com
Erica Nettle Chick - www.luminousyouth.com

Produced by Lara Martin for Pregnancy birth and Beyond Media

To check out our suggested children's reading list go to pbbmedia.org]]>https://api.spreaker.com/episode/12436000Wed, 26 Jul 2017 02:28:47 +0000PBB Media IncorporatedThis episode of Pregnancy Birth and Beyond we delve into the world of children's stories and more specifically about violence and scary themes in books. Is there any value to violence in stories for children, is scare fest for the sake of...In this episode we interview three guests, psychologist & author Robin Grille, children story teller and singer song writer Annie Bryant and luminous youth founder Erica Nettle Chick.

Connect with this episodes guests go to:
Robin Grille - www.hearttoheartparenting.org
Annie Bryant - www.talesandsongs.com
Erica Nettle Chick - www.luminousyouth.com

Produced by Lara Martin for Pregnancy birth and Beyond Media

To check out our suggested children's reading list go to pbbmedia.org]]>1672childrens-stories,parenting,readingfalsefullNew baby? Call in the village.https://www.spreaker.com/episode/new-baby-call-in-the-village--12391750sleeping, feeding and thinking they have to be super mum.

But it really does take a village to raise a child, especially a new baby. New mothers are making the biggest transition of their lives and they deserve lots of support. Don't shy from asking for help. You are not meant to do it on your own.

And you won't struggle as much with your baby being unsettled, not having enough milk or not getting enough sleep.

And remember: "You are doing a wonderful job. You know what to do. Your baby wants you to be his mother." - Jayne Alder.

www.jaynealder.com

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2017.
www.pbbmedia.org]]>https://api.spreaker.com/episode/12391750Thu, 20 Jul 2017 02:19:35 +0000PBB Media IncorporatedJayne Alder, midwife, mother and grandmother, speaks about the three main issues new mother struggle with: sleeping, feeding and thinking they have to be super mum. But it really does take a village to raise a child, especially a new baby. New...sleeping, feeding and thinking they have to be super mum.

But it really does take a village to raise a child, especially a new baby. New mothers are making the biggest transition of their lives and they deserve lots of support. Don't shy from asking for help. You are not meant to do it on your own.

And you won't struggle as much with your baby being unsettled, not having enough milk or not getting enough sleep.

And remember: "You are doing a wonderful job. You know what to do. Your baby wants you to be his mother." - Jayne Alder.

www.jaynealder.com

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2017.
www.pbbmedia.org]]>1671fourthtrimester,lifewithanewborn,postnataldepletion,postnatalsurvivalfalsefull"As Long as the Baby is Healthy" - Part 2https://www.spreaker.com/episode/as-long-as-the-baby-is-healthy-part-2--12350304
Sally has identified 6 underlying beliefs to the statement "As long as the baby is healthy". The first three underlying beliefs were covered in Part 1:
http://www.spreaker.com/user/pregnancybirthandbeyond/as-long-as-the-baby-is-healthy-part-1

In this episode, part 2, Sally covers the following underlying beliefs:

* “Birth is dangerous and needs to be managed medically. Positive births are due to luck.”
* “Labour and birth are simply painful, pointless torture."
* “My experience is irrelevant and people who seek a positive experience are selfish and exposing the baby to risk.”

SPEAKERS
Dr Kirsten Small, obstetrician and PhD candidate
Professor Alec Welsh, University of NSW and obstetrician at Royal Hospital for Women, Sydney
Dr Sarah Buckley, GP, author and researcher on physiological birth

FURTHER READING
* Dignity in Birth Survey: Safe Motherhood for All
http://www.safemotherhoodforall.org.au/news/only-58-of-australian-women-have-the-birth-they-want/

* Film: "Microbirth": importance of labour and birth
http://microbirth.com/

INFORMATION AND SUPPORT:
* PANDA National Helpline (Perinatal Anxiety Depression Awareness)
Mon to Fri, 10am - 5pm AEST
1300 726 306
* Birth Talk: Resources for healing from birth
www.birthtalk.org/
* Conscious Birth: Birth Story Healing, no matter how long ago
www.consciousbirth.com/birth-story-healing/
* Birth choices advice and advocacy: Maternity Choices Australia
www.maternitychoices.org.au and Facebook

REFERENCES
* https://theconversation.com/factcheck-is-suicide-one-of-the-leading-causes-of-maternal-death-in-australia-65336
* http://www.bellybelly.com.au/birth/why-is-the-fear-of-birth-rising/
* https://en.wikipedia.org/wiki/List_of_countries_by_infant_mortality_rate
* http://www.iii.org/fact-statistic/mortality-risk
* https://www.safetyandquality.gov.au/wp-content/uploads/2012/10/Standard2_Oct_2012_WEB.pdf
* “The Global Numbers and Costs of Additionally Needed and Unnecessary Caesarean Sections Performed per Year: Overuse as a Barrier to Universal Coverage” World Health Organisation 2010
* https://bmcpregnancychildbirth.biomedcentral.com/articles/10.1186/s12884-017-1343-3 (meaning of labour pain)
cochrane.org/CD004667/PREG_midwife-led-continuity-models-care-compared-other-models-care-women-during-pregnancy-birth-and-early
* Homer, CSE, MJA 205 (8) j 17 October 2016 "Models of maternity care: evidence for
midwifery continuity of care"
* http://www.peptonicmedical.se/about-peptonic/kerstin-uvnas-moberg/ (oxytocin research and impacts of pain medication on oxytocin production)
* http://www.bellybelly.com.au/birth/why-is-the-fear-of-birth-rising/
* https://www.ncbi.nlm.nih.gov/pubmed/22734617 (fear of childbirth and duration of labour)
* http://bmjopen.bmj.com/content/bmjopen/3/11/e004047.full.pdf (links between fear of birth and depression)
* https://www.ncbi.nlm.nih.gov/pubmed/18771508 (maternal response to own baby cry affected by c/s delivery
* https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2819576/ (postpartum depression impacts on infants)
* https://theconversation.com/birth-intervention-and-harm-more-likely-in-private-hospitals-26801
* http://onlinelibrary.wiley.com/doi/10.1002/14651858.CD000012.pub4/abstract (Impacts of environment on birth)
* http://www.sciencedirect.com/science/article/pii/S0030399210000654 (impact of colour and design of environment)
* Prof. Maralyn Foureur research into environment: https://www.uts.edu.au/staff/maralyn.foureur
http://www.midwiferyjournal.com/article/S0266-6138(14)00198-3/pdf

++++++++++

Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack]]>https://api.spreaker.com/episode/12350304Fri, 14 Jul 2017 04:55:49 +0000PBB Media IncorporatedWe all want a healthy baby, there's no question of that, but Sally believes there are underlying beliefs to the common phrase "As long as the baby is healthy" that deserve closer examination. Are we giving up elements of birth that are more important...
Sally has identified 6 underlying beliefs to the statement "As long as the baby is healthy". The first three underlying beliefs were covered in Part 1:
http://www.spreaker.com/user/pregnancybirthandbeyond/as-long-as-the-baby-is-healthy-part-1

In this episode, part 2, Sally covers the following underlying beliefs:

* “Birth is dangerous and needs to be managed medically. Positive births are due to luck.”
* “Labour and birth are simply painful, pointless torture."
* “My experience is irrelevant and people who seek a positive experience are selfish and exposing the baby to risk.”

SPEAKERS
Dr Kirsten Small, obstetrician and PhD candidate
Professor Alec Welsh, University of NSW and obstetrician at Royal Hospital for Women, Sydney
Dr Sarah Buckley, GP, author and researcher on physiological birth

FURTHER READING
* Dignity in Birth Survey: Safe Motherhood for All
http://www.safemotherhoodforall.org.au/news/only-58-of-australian-women-have-the-birth-they-want/

* Film: "Microbirth": importance of labour and birth
http://microbirth.com/

INFORMATION AND SUPPORT:
* PANDA National Helpline (Perinatal Anxiety Depression Awareness)
Mon to Fri, 10am - 5pm AEST
1300 726 306
* Birth Talk: Resources for healing from birth
www.birthtalk.org/
* Conscious Birth: Birth Story Healing, no matter how long ago
www.consciousbirth.com/birth-story-healing/
* Birth choices advice and advocacy: Maternity Choices Australia
www.maternitychoices.org.au and Facebook

REFERENCES
* https://theconversation.com/factcheck-is-suicide-one-of-the-leading-causes-of-maternal-death-in-australia-65336
* http://www.bellybelly.com.au/birth/why-is-the-fear-of-birth-rising/
* https://en.wikipedia.org/wiki/List_of_countries_by_infant_mortality_rate
* http://www.iii.org/fact-statistic/mortality-risk
* https://www.safetyandquality.gov.au/wp-content/uploads/2012/10/Standard2_Oct_2012_WEB.pdf
* “The Global Numbers and Costs of Additionally Needed and Unnecessary Caesarean Sections Performed per Year: Overuse as a Barrier to Universal Coverage” World Health Organisation 2010
* https://bmcpregnancychildbirth.biomedcentral.com/articles/10.1186/s12884-017-1343-3 (meaning of labour pain)
cochrane.org/CD004667/PREG_midwife-led-continuity-models-care-compared-other-models-care-women-during-pregnancy-birth-and-early
* Homer, CSE, MJA 205 (8) j 17 October 2016...]]>1670aslongasthebabyishealthy,birth,birthrisk,humanrightsinchildbirth,pregnancyfalsefullThe emotional side of fertility issueshttps://www.spreaker.com/episode/the-emotional-side-of-fertility-issues--12273523
One in six couples in Australia and NZ experience infertility. The infertility lies equally with both men and women 40% each, 10% in both partners and the other 10% is unknown. Age does play a role in fertility issues, couples in their 20's have a 25% chance of falling pregnant whereas one in three women over the age of 35 experience infertility issues and once she reaches 40, women have only a 5% chance of falling pregnant with regular sexual activity.

This episode of Pregnancy Birth and Beyond we shine a light on the often silent yet emmotionally painful topic of infertility, from the personal account of my guest to her professional insights working with women and families experiencing the grief of not falling pregnant when wanting a baby.

My guest for this episode is Kimberly Lipschus who is a women's wellbeing and fertility psychotherapist.

Producer Lara Martin
Guest Kimberly Lipschus www.kimberleylipschus.com]]>https://api.spreaker.com/episode/12273523Mon, 03 Jul 2017 14:29:07 +0000PBB Media IncorporatedWhen you want something, that for many is fundamental to their human existence, a biological drive, to carry a baby and nurture a baby... to raise a family, it can be emotionally devastating for a couple or individual when despite all the attempts,...
One in six couples in Australia and NZ experience infertility. The infertility lies equally with both men and women 40% each, 10% in both partners and the other 10% is unknown. Age does play a role in fertility issues, couples in their 20's have a 25% chance of falling pregnant whereas one in three women over the age of 35 experience infertility issues and once she reaches 40, women have only a 5% chance of falling pregnant with regular sexual activity.

This episode of Pregnancy Birth and Beyond we shine a light on the often silent yet emmotionally painful topic of infertility, from the personal account of my guest to her professional insights working with women and families experiencing the grief of not falling pregnant when wanting a baby.

My guest for this episode is Kimberly Lipschus who is a women's wellbeing and fertility psychotherapist.

Producer Lara Martin
Guest Kimberly Lipschus www.kimberleylipschus.com]]>1374infertility,miscarriage,pregnancyfalsefullThe good enough parent; rapture & repairhttps://www.spreaker.com/episode/the-good-enough-parent-rapture-repair--12213669
This episode of Pregnancy Birth and Beyond we explore how early experiences during the pre and perinatal period impact on how a person develops.

Our guest for this episode is Dr Holly Goldberg. Holly is a specialist in pre and peri Natal psychology and has been working with childbearing families for the past 20 years. Holly resides in California in the USA with her family.

Host: Lara Martin
Guest: Dr. Holly Goldberg www.floweressenceapothecary.com]]>https://api.spreaker.com/episode/12213669Mon, 26 Jun 2017 07:53:15 +0000PBB Media IncorporatedAre you a good enough parent? With all the demands and expectations of raising babies and children in the modern world, from programs offering promises for creating 'super babies' as early as starting in the womb, the pressure to be the perfect parent...
This episode of Pregnancy Birth and Beyond we explore how early experiences during the pre and perinatal period impact on how a person develops.

Our guest for this episode is Dr Holly Goldberg. Holly is a specialist in pre and peri Natal psychology and has been working with childbearing families for the past 20 years. Holly resides in California in the USA with her family.

Host: Lara Martin
Guest: Dr. Holly Goldberg www.floweressenceapothecary.com]]>1671birth,birthimprint,goodenoughmother,pregnancy,winnicottfalsefullIs your Home making you Sick?https://www.spreaker.com/episode/is-your-home-making-you-sick--12182679
Reine DuBois, naturopath from The Health Lodge, Byron Bay, speaks with Sally about biotoxins, what stimulates them being made by the body, the impacts of them, and how to heal from them. Your suspected tick-borne illness could in fact be inflammation caused by biotoxins produced by your body in response to mould. Water damaged homes have a lot to answer for, and the mould that lives in them must be removed in order for the biotoxins in your body to disappear.

Reine cites the work of Drs Ritchie Shoemaker of survivemold.com and Christabelle Yeoh.

www.thehealthlodge.com.au

Music: "Call on the Rain" by Elijah Ray

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2018
www.pbbmedia.org]]>https://api.spreaker.com/episode/12182679Thu, 22 Jun 2017 11:18:32 +0000PBB Media IncorporatedBiotoxins can be produced by the body in response to all sorts of allergens, such as dust and mould. Reine DuBois, naturopath from The Health Lodge, Byron Bay, speaks with Sally about biotoxins, what stimulates them being made by the body, the...
Reine DuBois, naturopath from The Health Lodge, Byron Bay, speaks with Sally about biotoxins, what stimulates them being made by the body, the impacts of them, and how to heal from them. Your suspected tick-borne illness could in fact be inflammation caused by biotoxins produced by your body in response to mould. Water damaged homes have a lot to answer for, and the mould that lives in them must be removed in order for the biotoxins in your body to disappear.

Reine cites the work of Drs Ritchie Shoemaker of survivemold.com and Christabelle Yeoh.

www.thehealthlodge.com.au

Music: "Call on the Rain" by Elijah Ray

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2018
www.pbbmedia.org]]>1671biotoxins,healing,mould,toxichomefalsefullthe Changing Landscape of Medicinehttps://www.spreaker.com/episode/the-changing-landscape-of-medicine--12131180
Produced and Presented by Annalee Atia 2017
Copyright PBB Media Annalee Atia 2017

Welcome to this Special Feature episode of pregnancy birth and beyond; The Changing landscape of Medicine around the world and how Australian physicians and consumers are inspired to ask better questions about our healthcare system. I have been facinated by and folowing Funcitonal Medicine for the past four years since i first heard about it and recently had the opportunity to meet with one of its biggest internatioanl advocates, James Maskell. This fascination has opened the door to a wider discussion about healthcare. Medicine and science are evolving at a breakneck speed and yet chronic disease is on the rise, global antimicrobial resistance threatens to destroy some of scinece’s most notable achievements and the cost of healthcare in an ailing and aging society may very well be digging us all into a early grave.

The two part article features several passionate trailblazing figures in the move towards changing the way healthcare is delivered, both globally and locally. The first part looks at some of the overarching issues within the current medical system and the new emerging model of care seeking to correct and create significant primary healthcare reform around the world. In the second part we take a cloer look at Functional Medicine and what we can all do to create better outcomes for ourselves as cnsumers and practitioners. We hear from James, an international speaker, founder of Functional Forum and The Evolution of Medicine and author of a compelling book with the same title. We also tap into the wisdom of Dr Penny Caldicott, President of the Australasian Integrative Medicine Association and founder and director of Invitation to Health. Championing Integrative Medicine, Penny walks among those leading a new era in Australian healthcare. Reine duBois, Clinical Director of the Health Lodge in Byron Bay also features discussing her passion, experience and how she makes it work in her practice. I also speak to Sally Cusack who is NSW Branch President of Maternity Choices Australia and has significant experience navigating the Australian healthcare system and understanding the unique needs of healthcare consumers. There will be a few sound bites form the AIMA conference in Sydney; Functional Medicine and the Micropractice.

Interviewees in this article:

Dr Penny Caldicott, BMed, FRACGP
-Director of AIMA & founding member of Invitation to Health

Reine duBois
-Clinical Director at the Health Lodge

James Maskell
-Founder of Functional Forum
-Evolution of Medicine
-Author of the Evolution of Medicine

Sally Cusack
-NSW President Maternity Choices Australia, Australia’s peak maternity consumer representing body

More information at www.pbbmedia.org]]>https://api.spreaker.com/episode/12131180Fri, 16 Jun 2017 09:11:10 +0000PBB Media IncorporatedMoving from a disease management based model of care and toward a patient-centred model of care Functional Medicine is able to treat disease at its root cause, rather than merely managing symptoms. Integrative Medicine is practiced by many...
Produced and Presented by Annalee Atia 2017
Copyright PBB Media Annalee Atia 2017

Welcome to this Special Feature episode of pregnancy birth and beyond; The Changing landscape of Medicine around the world and how Australian physicians and consumers are inspired to ask better questions about our healthcare system. I have been facinated by and folowing Funcitonal Medicine for the past four years since i first heard about it and recently had the opportunity to meet with one of its biggest internatioanl advocates, James Maskell. This fascination has opened the door to a wider discussion about healthcare. Medicine and science are evolving at a breakneck speed and yet chronic disease is on the rise, global antimicrobial resistance threatens to destroy some of scinece’s most notable achievements and the cost of healthcare in an ailing and aging society may very well be digging us all into a early grave.

The two part article features several passionate trailblazing figures in the move towards changing the way healthcare is delivered, both globally and locally. The first part looks at some of the overarching issues within the current medical system and the new emerging model of care seeking to correct and create significant primary healthcare reform around the world. In the second part we take a cloer look at Functional Medicine and what we can all do to create better outcomes for ourselves as cnsumers and practitioners. We hear from James, an international speaker, founder of Functional Forum and The Evolution of Medicine and author of a compelling book with the same title. We also tap into the wisdom of Dr Penny Caldicott, President of the Australasian Integrative Medicine Association and founder and director of Invitation to Health. Championing Integrative Medicine, Penny walks among those leading a new era in Australian healthcare. Reine duBois, Clinical Director of the Health Lodge in Byron Bay also features discussing her passion, experience and how she makes it work in her practice. I also speak to Sally Cusack who is NSW Branch President of Maternity Choices Australia and has significant experience navigating the Australian healthcare system and understanding the unique needs of healthcare consumers. There will be a few sound bites form the AIMA conference in Sydney; Functional Medicine and the Micropractice.

Interviewees in this article:

Dr Penny Caldicott, BMed, FRACGP
-Director of AIMA & founding member of Invitation to Health

Reine duBois
-Clinical Director at the Health Lodge

James Maskell
-Founder of Functional Forum
-Evolution of Medicine
-Author of the Evolution of Medicine

Sally Cusack
-NSW President Maternity Choices Australia, Australia’s peak maternity consumer representing body

More information at www.pbbmedia.org]]>1671chronicdisease,functionalmedicine,functionalmedicineaustralia,healthcare,medicinefalsefullAdolescence: The Challenges and the Opportunitieshttps://www.spreaker.com/episode/adolescence-the-challenges-and-the-opportunities--12069021
Instead, Robin Grille poses the idea that we can use this period to enquire deeply into what triggers our responses to our adolescents. It is possible that our negative reactions are linked to our 'unfinished business' from our younger years. Perhaps by revisiting this period, our kids help finally grow us up.

Music: "Natural Selections" by Sampology

Presented by Sally Cusack, first aired on 99.9 BayFM Byron Bay on 5 June 2017.]]>https://api.spreaker.com/episode/12069021Fri, 09 Jun 2017 03:36:24 +0000PBB Media IncorporatedRobin Grille speaks on the era of adolescence, the unique challenges for not only our adolescents in their transformation, but also for us as their parents and guides. Our adolescents can press our buttons, bring out stress and fear in us, but this...
Instead, Robin Grille poses the idea that we can use this period to enquire deeply into what triggers our responses to our adolescents. It is possible that our negative reactions are linked to our 'unfinished business' from our younger years. Perhaps by revisiting this period, our kids help finally grow us up.

Music: "Natural Selections" by Sampology

Presented by Sally Cusack, first aired on 99.9 BayFM Byron Bay on 5 June 2017.]]>1671adolescence,luminousyouth,parentingforapeacefulworld,robingrillefalsefullThe sharing of positive birth stories with Pam Englandhttps://www.spreaker.com/episode/the-sharing-of-positive-birth-stories-with-pam-england--11995653
This episode features sharing our birth stories, and in-particular listening to positive birth stories as a form of birth preparation. My guest for this episode is Pam England, Pam lives in Albuquerque New Mexico USA, author of Birthing From Within, Labyrinth of Birth and her latest released book Ancient Maps for Modern Birth. Pam also is the founder of Birth Story Medicine a unique approach to emotional healing after or witnessing a difficult child birth experience. Pam was a certified nurse midwife for 18 years, practicing both within hospital and home settings, she also has a masters in counselling.

Pam England - www.sevengatesmedia.com & www.birthingfromwithin.com

Produced and presented by Lara Martin
Copyright 2018 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/11995653Wed, 31 May 2017 03:48:59 +0000PBB Media IncorporatedDoes sharing birth stories actually benefit those preparing for their birthing time? I ask Pam England, "isn't it a good thing to share positive birth stories?" You maybe surprised to hear what Pam says. This episode features sharing our birth...
This episode features sharing our birth stories, and in-particular listening to positive birth stories as a form of birth preparation. My guest for this episode is Pam England, Pam lives in Albuquerque New Mexico USA, author of Birthing From Within, Labyrinth of Birth and her latest released book Ancient Maps for Modern Birth. Pam also is the founder of Birth Story Medicine a unique approach to emotional healing after or witnessing a difficult child birth experience. Pam was a certified nurse midwife for 18 years, practicing both within hospital and home settings, she also has a masters in counselling.

Pam England - www.sevengatesmedia.com & www.birthingfromwithin.com

Produced and presented by Lara Martin
Copyright 2018 PBB Media and Lara Martin
www.pbbmedia.org]]>1668birth,birthhealing,parenting,positvebirth,pregnancyfalsefullOur first show on Gender & Sexual Diversity!https://www.spreaker.com/episode/our-first-show-on-gender-sexual-diversity--11972435
Gopi Lev is a queer femme based in the Northern Rivers.
Passionate about intersectional feminism, art and the pursuit of justice and equity for all, she is PBB Media’s consultant on sexual and gender diversity and assists in making the space and content more inclusive for all.

We are talking Gender & Sexual diversity on the show today. In a Time Magazine issue titled He or She, how a new generation is redefining the meaning of gender, we get a glimpse into the fluid and evolving world of gender and sexual self and societal definition. Infinite identities is the title of the ‘accruing’ article in this issue. It is a fascinating read. Around the same time, National Geographic put our their gender issue - GENDER revolution with a full (to date) Glossary of terms, the various studies available on gender and a quick guide to helping families discuss gender.

The spectrum upon which sexuality & gender are defined is fascinating and comprehensive. More importantly, understanding it, is the doorway for more compassion and less judgement and our newest generation is leading the way.

For links & resources and info about our speaker today, head to our website www.pbbmedia.org

Credits
Host: Annalee Atia, www.annaleeatia.com
Guest: Gopi Lev
Music: The song snippets played on today’s shows are from two artists - 'Habanot Nechama' from their songs So Far and Flowers and, Amir Paiss with the track Handgun Menagen Oti

Copyright: PBB Media, Annalee Atia, Gopi Lev 2017]]>https://api.spreaker.com/episode/11972435Sun, 28 May 2017 02:19:41 +0000PBB Media IncorporatedGender 101 with Gopi Lev Gopi Lev is a queer femme based in the Northern Rivers. Passionate about intersectional feminism, art and the pursuit of justice and equity for all, she is PBB Media’s consultant on sexual and gender diversity and assists in...
Gopi Lev is a queer femme based in the Northern Rivers.
Passionate about intersectional feminism, art and the pursuit of justice and equity for all, she is PBB Media’s consultant on sexual and gender diversity and assists in making the space and content more inclusive for all.

We are talking Gender & Sexual diversity on the show today. In a Time Magazine issue titled He or She, how a new generation is redefining the meaning of gender, we get a glimpse into the fluid and evolving world of gender and sexual self and societal definition. Infinite identities is the title of the ‘accruing’ article in this issue. It is a fascinating read. Around the same time, National Geographic put our their gender issue - GENDER revolution with a full (to date) Glossary of terms, the various studies available on gender and a quick guide to helping families discuss gender.

The spectrum upon which sexuality & gender are defined is fascinating and comprehensive. More importantly, understanding it, is the doorway for more compassion and less judgement and our newest generation is leading the way.

For links & resources and info about our speaker today, head to our website www.pbbmedia.org

Credits
Host: Annalee Atia, www.annaleeatia.com
Guest: Gopi Lev
Music: The song snippets played on today’s shows are from two artists - 'Habanot Nechama' from their songs So Far and Flowers and, Amir Paiss with the track Handgun Menagen Oti

Copyright: PBB Media, Annalee Atia, Gopi Lev 2017]]>1671gender,gender101,genderdiversity,sexualdiversity,womeninmediafalsefullMothers Moving Mountains and Saving our Birth Serviceshttps://www.spreaker.com/episode/mothers-moving-mountains-and-saving-our-birth-services--11904666
In towns and suburbs around Australia, we're seeing our birth services being saved by women. We have world class policies and research for providing the highest standard of maternity care, but health services are slow to implement them.

Birth services are being closed in regional and rural areas, or not delivering continuity of care, the safest form of care.

So, when faced with the removal of these birth choices, these women step from their lives as mothers of young children, right out into the arena of activism, often for the first time in their lives.

Drafting letters, forming community groups, organising rallies, painting placards, attending meetings with health service officials, and more, is asked of them to bring about change. It's never easy, but without their efforts, change for the better would simply never happen.

The women we hear from in this episode are:
- Rachel Bryant behind the campaign that saved the Murwillumbah Birth Centre
- Samantha Wibberley, part of the group who is working to save the midwifery group practice (MGP, ie continuity of care programme) at Tamworth Hospital
- Helena Mooney, leading the community action to ensure woman-centred care like MGP is available on the Northern Beaches of Sydney

National health and quality standard, Standard 2: Partnering with Consumers now obliges all health services to engage with their communities in the planning, implementation and review of their service.

We also hear from Melissa Fox, CEO of Health Consumers Queensland on consumer engagement, why it's important and what can be achieved with it.

Consumer groups like Maternity Choices Australia are available to support anyone wanting to see better birth choices in their region.

With sincere thanks to all our contributors in this episode.

References:
Standard 2: Partnering with Consumers:
https://www.safetyandquality.gov.au/wp-content/uploads/2012/10/Standard2_Oct_2012_WEB.pdf

41% of maternity services closed from 1992-2011: Kildea, S, et al https://www.ncbi.nlm.nih.gov/pubmed/25845486

Websites:
www.maternitychoices.org.au
www.hcq.org.au

Facebook groups:
Friends of Murwillumbah Birth Centre
Friends of Tamworth Maternity Services
Friends of NB Maternity Services

Aired on 99.9 BayFm on Monday 15 May 2017.
Presented by Sally Cusack]]>https://api.spreaker.com/episode/11904666Fri, 19 May 2017 08:14:24 +0000PBB Media IncorporatedAt the 2009 Peace Conference in Canada, the Dalai Lama said ‘The world will be saved by the Western Woman’. In towns and suburbs around Australia, we're seeing our birth services being saved by women. We have world class policies and research for...
In towns and suburbs around Australia, we're seeing our birth services being saved by women. We have world class policies and research for providing the highest standard of maternity care, but health services are slow to implement them.

Birth services are being closed in regional and rural areas, or not delivering continuity of care, the safest form of care.

So, when faced with the removal of these birth choices, these women step from their lives as mothers of young children, right out into the arena of activism, often for the first time in their lives.

Drafting letters, forming community groups, organising rallies, painting placards, attending meetings with health service officials, and more, is asked of them to bring about change. It's never easy, but without their efforts, change for the better would simply never happen.

The women we hear from in this episode are:
- Rachel Bryant behind the campaign that saved the Murwillumbah Birth Centre
- Samantha Wibberley, part of the group who is working to save the midwifery group practice (MGP, ie continuity of care programme) at Tamworth Hospital
- Helena Mooney, leading the community action to ensure woman-centred care like MGP is available on the Northern Beaches of Sydney

National health and quality standard, Standard 2: Partnering with Consumers now obliges all health services to engage with their communities in the planning, implementation and review of their service.

We also hear from Melissa Fox, CEO of Health Consumers Queensland on consumer engagement, why it's important and what can be achieved with it.

Consumer groups like Maternity Choices Australia are available to support anyone wanting to see better birth choices in their region.

With sincere thanks to all our contributors in this episode.

References:
Standard 2: Partnering with Consumers:
https://www.safetyandquality.gov.au/wp-content/uploads/2012/10/Standard2_Oct_2012_WEB.pdf

41% of maternity services closed from 1992-2011: Kildea, S, et al https://www.ncbi.nlm.nih.gov/pubmed/25845486

Websites:
www.maternitychoices.org.au
www.hcq.org.au

Facebook groups:
Friends of Murwillumbah Birth Centre
Friends of Tamworth Maternity Services
Friends of NB Maternity Services

Aired on 99.9 BayFm on Monday 15 May 2017.
Presented by Sally Cusack]]>1671birth,hospital,maternityadvocacy,motherhood,partneringwithconsumers,standard2falsefullWhen a baby dies; being with death and griefhttps://www.spreaker.com/episode/when-a-baby-dies-being-with-death-and-grief--11768687 We will be hearing about ways you can support friends and family members who are experiencing the loss of their baby, the healing journey or becoming whole again, how to be with the grief and loss of other's or your own. We also feature the the stories of three different parents sharing their experience of neonatal loss.

My guest for this episode features Denise Love, founder of Life Options and women’s health Cambodia, where Denise spends much of the year working with birthing mothers and Traditional Birth attendants to bring about safer healthier mothers and babies. Denise also provides doula, death doula and other birth related trainings across Australia. We also have three short stories from parents who have walked the long hard unyielding road of neonatal death.

Aired live April 2017, from the heart of Byron Bay 99.9 Fm community radio.

Host: Lara Martin
Special thanks to
Denise Love - www.deniselove.net
Stephanie.
Susanne and
David Monteith - Grace in Action, I pause spoken word. https://www.youtube.com/watch?v=dFD7mqqkPRE&t=21s

If you are experiencing distress from the loss of a miscarriage, stillbirth or newborn death Sands has a 24/ 7 bereavement support line.
www.sands.org.au/local-group-support

music - Timshel by Mumford and Sons, Angel by Sarah Mclachlan.]]>https://api.spreaker.com/episode/11768687Tue, 02 May 2017 20:38:56 +0000PBB Media IncorporatedWhen you are pregnant, for most parents to be it is a time of great joy, anticipation, hopes and dreams of having a baby, and raising a family. However, in Australia about 1 in a 120 babies will be born still or die within the first month of life. It... We will be hearing about ways you can support friends and family members who are experiencing the loss of their baby, the healing journey or becoming whole again, how to be with the grief and loss of other's or your own. We also feature the the stories of three different parents sharing their experience of neonatal loss.

My guest for this episode features Denise Love, founder of Life Options and women’s health Cambodia, where Denise spends much of the year working with birthing mothers and Traditional Birth attendants to bring about safer healthier mothers and babies. Denise also provides doula, death doula and other birth related trainings across Australia. We also have three short stories from parents who have walked the long hard unyielding road of neonatal death.

Aired live April 2017, from the heart of Byron Bay 99.9 Fm community radio.

Host: Lara Martin
Special thanks to
Denise Love - www.deniselove.net
Stephanie.
Susanne and
David Monteith - Grace in Action, I pause spoken word. https://www.youtube.com/watch?v=dFD7mqqkPRE&t=21s

If you are experiencing distress from the loss of a miscarriage, stillbirth or newborn death Sands has a 24/ 7 bereavement support line.
www.sands.org.au/local-group-support

music - Timshel by Mumford and Sons, Angel by Sarah Mclachlan.]]>1639birth,death,greif,miscarriage,stillbirthfalsefullPaul Crebar on Parenting for our Planethttps://www.spreaker.com/episode/paul-crebar-on-parenting-for-our-planet--11720893
Paul quotes Dr Marion Rose: "Responding promptly to their physical needs and treating their bodies with love and respect means that they learn to respond promptly to their physical needs and treat their body with love and respect, and that loving respect then gets generalised so that they also treat other people’s bodies and the physical world with love and respect too."

And discusses the work of Robin Grille, author of "Parenting for a Peaceful World" and "Heart to Heart Parenting".

Paul would like to see a society that supports parents to spend the time needed with their children to raise them to secure and happy individuals, ready to support others, and the planet.

Other references:
* John Abbott from the 21st learning initiative: http://www.21learn.org
* The Dunedin Study: http://dunedinstudy.otago.ac.nz/
View documentary at: http://www.sbs.com.au/topics/science/humans/article/2016/05/24/exceptional-scientific-study-thats-been-going-over-40-years
* John Campbell: "Follow your bliss and the universe will open doors for you where there were only doors."
* Renewfest.org.au
* Luminousyouth.com

Aired on 99.9 BayFM on Monday 24 April 2017. Presented by Sally Cusack.]]>https://api.spreaker.com/episode/11720893Wed, 26 Apr 2017 07:23:27 +0000PBB Media IncorporatedPaul Crebar, Production Manager from Renewfest.org.au (6-7 May 2017), among many other things, speaks about the potential for parenting as an investment in our future, rather than purely work. Paul quotes Dr Marion Rose: "Responding promptly to...
Paul quotes Dr Marion Rose: "Responding promptly to their physical needs and treating their bodies with love and respect means that they learn to respond promptly to their physical needs and treat their body with love and respect, and that loving respect then gets generalised so that they also treat other people’s bodies and the physical world with love and respect too."

And discusses the work of Robin Grille, author of "Parenting for a Peaceful World" and "Heart to Heart Parenting".

Paul would like to see a society that supports parents to spend the time needed with their children to raise them to secure and happy individuals, ready to support others, and the planet.

Other references:
* John Abbott from the 21st learning initiative: http://www.21learn.org
* The Dunedin Study: http://dunedinstudy.otago.ac.nz/
View documentary at: http://www.sbs.com.au/topics/science/humans/article/2016/05/24/exceptional-scientific-study-thats-been-going-over-40-years
* John Campbell: "Follow your bliss and the universe will open doors for you where there were only doors."
* Renewfest.org.au
* Luminousyouth.com

Aired on 99.9 BayFM on Monday 24 April 2017. Presented by Sally Cusack.]]>1671connectedparenting,consciousparenting,ecoparenting,parenting,parentingforapeacefulworldfalsefullMidwife - with womanhttps://www.spreaker.com/episode/midwife-with-woman--11660335In Australia a baby is born every 2 minutes.
Midwives, are in ways the unsung hero's of maternity healthcare. They often work long hours, caring for women and babies during a critical and vulnerable time in a woman’s and families life.
Featured is are extracts from:
Professor Iain Graham, Dean and head of health at Southern Cross University.
Suzanne Weir, who is a midwife of over 20 years in various models of care shares 'reflections of a midwife in home birth practice'.
Bronwyn Moir independent home birth midwife
and Amana who works in a busy hospital on shift as a midwife.

Aired live on 99.9 Bay Fm and broadcasts across Australia on the Community Radio Network.
Your hosts for this episode: Lara Martin and co presenter Sunae Reilly.

Song credit:
Maryen Cairns - Home Birth
Fran Colin - Hospital Song

article referenced: http://thespinoff.co.nz/parenting/03-04-2017/midwives-in-their-own-words-we-are-only-human/

Show producer: Lara Martin and Sunae Ri]]>https://api.spreaker.com/episode/11660335Tue, 18 Apr 2017 22:43:00 +0000PBB Media IncorporatedThis episode features 'Midwife; being with woman'. In Australia a baby is born every 2 minutes. Midwives, are in ways the unsung hero's of maternity healthcare. They often work long hours, caring for women and babies during a critical and...In Australia a baby is born every 2 minutes.
Midwives, are in ways the unsung hero's of maternity healthcare. They often work long hours, caring for women and babies during a critical and vulnerable time in a woman’s and families life.
Featured is are extracts from:
Professor Iain Graham, Dean and head of health at Southern Cross University.
Suzanne Weir, who is a midwife of over 20 years in various models of care shares 'reflections of a midwife in home birth practice'.
Bronwyn Moir independent home birth midwife
and Amana who works in a busy hospital on shift as a midwife.

Aired live on 99.9 Bay Fm and broadcasts across Australia on the Community Radio Network.
Your hosts for this episode: Lara Martin and co presenter Sunae Reilly.

Song credit:
Maryen Cairns - Home Birth
Fran Colin - Hospital Song

article referenced: http://thespinoff.co.nz/parenting/03-04-2017/midwives-in-their-own-words-we-are-only-human/

Show producer: Lara Martin and Sunae Ri]]>1672birth,doula,midwife,pregnancy,studentmidwifefalsefullPam England on Birth as a Hero's Journeyhttps://www.spreaker.com/episode/pam-england-on-birth-as-a-hero-s-journey--11594587Aired live on 99.9 BayFm April 2017.
Host: Lara Martin
Guest: Pam England www.sevengatesmedia.com www.birthingfromwithin.com]]>https://api.spreaker.com/episode/11594587Mon, 10 Apr 2017 06:26:14 +0000PBB Media IncorporatedThis episode features an interview with Pam England, author, midwife, artist and founder of Birthing From Within. Her first book Birthing From Within An Extra Ordinary Guide to Childbirth Preparation released in 1998 has sold over a 1 million copies....Aired live on 99.9 BayFm April 2017.
Host: Lara Martin
Guest: Pam England www.sevengatesmedia.com www.birthingfromwithin.com]]>1670birth,mothering,pamengland,postpartum,pregnancyfalsefullMindfulness for Peaceful Parentinghttps://www.spreaker.com/episode/mindfulness-for-peaceful-parenting--11566473
Christine Berry: www.alifesublime.com.au
Christine references this video by Dan Siegel about the brains of teenagers:
https://www.youtube.com/watch?v=TLULtUPyhog

Presented by Sally Cusack.
Aired on 99.9 BayFM on Monday 3 April 2017 Byron Bay Australia.]]>https://api.spreaker.com/episode/11566473Thu, 06 Apr 2017 10:10:03 +0000PBB Media IncorporatedChristine Berry, mum to three boys, speaks of her experience in bringing mindfulness into her life as a single parent and to support her during the teen parenting years. Christine Berry: www.alifesublime.com.au Christine references this video by Dan...
Christine Berry: www.alifesublime.com.au
Christine references this video by Dan Siegel about the brains of teenagers:
https://www.youtube.com/watch?v=TLULtUPyhog

Presented by Sally Cusack.
Aired on 99.9 BayFM on Monday 3 April 2017 Byron Bay Australia.]]>1670mindfulnessforbusymums,parentingteens,singleparenting,singleparentingmindfulnessfalsefullMaking our maternity care the best it can behttps://www.spreaker.com/episode/making-our-maternity-care-the-best-it-can-be--11458693
Instead they must make do with fragmented care with a string of unknown clinicians, even though continuity of care has been proven to give the best outcomes to mothers and babies. The benefits are many, but the biggest one is that your baby is more likely to survive pregnancy, birth and the postnatal period if you have continuity of woman-centred care.

Since 2010 Australian has had a national plan to improve maternity services, but delivery of our health services is so inefficient it has been largely ignored all that time.

The good news is that national Standard 2: Partnering with Consumers requires all health services to partner with women and families in designing and delivering health services.

Yay! We have a role to play and a job to do. Find out about this story peppered with passionate characters, and what you can do in this podcast.

With thanks to interviewees:
Professor Caroline Homer, President of the Australian College of Midwives
Bruce Teakle, maternity services consumer advocate
Leah Hardiman, President, Maternity Choices Australia
Sheryl Sidery, independent midwife
Tiff, continuity of care mother

Other acknowledgements:
* My son saying "Daddy caught the baby!" at his sister's birth in 2008. Heart-felt thanks from our family to midwife Jacqui Wood who held our hands along the journey.
* Homebirth rally sound effects from "Melbourne Homebirth Rally 4th August 2009"
https://www.youtube.com/watch?v=OhfSJlWbMaU
* "I love being a midwife" sung by midwifery students at BRAC University, Bangladesh at
https://www.youtube.com/watch?v=F319Z8ujBDU

References:
* http://www.health.gov.au/internet/main/publishing.nsf/content/maternityservicesplan
* www.maternitychoices.org.au
* And the new draft framework is just out this week! Check it out and have your say here:
https://www.getinvolved.qld.gov.au/gi/consultation/3805/view.html
You can also contact us or Maternity Choices Australia to help understand it!! :)
* Standard 2: Partnering with Consumers
https://www.safetyandquality.gov.au/wp-content/uploads/2012/10/Standard2_Oct_2012_WEB.pdf
* Barnett, B "The Personal is Political..." http://www.maternitychoices.org.au/national-maternity-services-plan.html
* 30% of women tokophobic: (http://bmcpregnancychildbirth.biomedcentral.com/articles/10.1186/1471-2393-14-275)
* Aust Senate-maternity service delivery not sustainable: Aust Senate, 1999 Rocking the Cradle: Federal Senate Inquiry into Childbirth Procedures. AGPS, Canberra
* 1 in 7 women with PNDA: www.panda.org.au
* 41% of maternity units closed 1994-2011: Kildea, S, et al, "Babies born before arrival to hospital and maternity unit closures in Queensland and Australia" accessed from http://www.womenandbirth.org/article/S1871-5192(15)00039-6/fulltext
* Est. of 8% of women receiving cont. of care: Dawson K, et al. Implementing caseload midwifery: Exploring the views of maternity managers in Australia – A national cross-sectional survey. Women Birth (2015), http://dx.doi.org/10.1016/j.wombi.2015.10.010
* Cochrane review "Midwife-led continuity models of care compared with other models of care for women during pregnancy, birth and early parenting" http://www.cochrane.org/CD004667/PREG_midwife-led-continuity-models-care-compared-other-models-care-women-during-pregnancy-birth-and-early

Copyright 2017 PBB Media, Sally Cusack
www.pbbmedia.org

Producer and presenter: Sally Cusack]]>https://api.spreaker.com/episode/11458693Thu, 23 Mar 2017 02:53:49 +0000PBB Media IncorporatedThe evidence is in, the policies exist yet 92% of Australian women do not have the best form of maternity care - continuity of woman-centred care near where they live. Instead they must make do with fragmented care with a string of unknown...
Instead they must make do with fragmented care with a string of unknown clinicians, even though continuity of care has been proven to give the best outcomes to mothers and babies. The benefits are many, but the biggest one is that your baby is more likely to survive pregnancy, birth and the postnatal period if you have continuity of woman-centred care.

Since 2010 Australian has had a national plan to improve maternity services, but delivery of our health services is so inefficient it has been largely ignored all that time.

The good news is that national Standard 2: Partnering with Consumers requires all health services to partner with women and families in designing and delivering health services.

Yay! We have a role to play and a job to do. Find out about this story peppered with passionate characters, and what you can do in this podcast.

With thanks to interviewees:
Professor Caroline Homer, President of the Australian College of Midwives
Bruce Teakle, maternity services consumer advocate
Leah Hardiman, President, Maternity Choices Australia
Sheryl Sidery, independent midwife
Tiff, continuity of care mother

Other acknowledgements:
* My son saying "Daddy caught the baby!" at his sister's birth in 2008. Heart-felt thanks from our family to midwife Jacqui Wood who held our hands along the journey.
* Homebirth rally sound effects from "Melbourne Homebirth Rally 4th August 2009"
https://www.youtube.com/watch?v=OhfSJlWbMaU
* "I love being a midwife" sung by midwifery students at BRAC University, Bangladesh at
https://www.youtube.com/watch?v=F319Z8ujBDU

References:
* http://www.health.gov.au/internet/main/publishing.nsf/content/maternityservicesplan
* www.maternitychoices.org.au
* And the new draft framework is just out this week! Check it out and have your say here:
https://www.getinvolved.qld.gov.au/gi/consultation/3805/view.html
You can also contact us or Maternity Choices Australia to help understand it!! :)
* Standard 2: Partnering with Consumers
https://www.safetyandquality.gov.au/wp-content/uploads/2012/10/Standard2_Oct_2012_WEB.pdf
* Barnett, B "The Personal is Political..." http://www.maternitychoices.org.au/national-maternity-services-plan.html
* 30% of women tokophobic: (http://bmcpregnancychildbirth.biomedcentral.com/articles/10.1186/1471-2393-14-275)
* Aust Senate-maternity service delivery not sustainable: Aust Senate, 1999 Rocking the Cradle: Federal Senate Inquiry into Childbirth Procedures. AGPS, Canberra
* 1 in 7 women with PNDA: www.panda.org.au
* 41% of maternity units closed 1994-2011: Kildea, S, et al, "Babies born before arrival to hospital and maternity unit closures in Queensland and Australia" accessed from 2410continuityofcare,hospital,maternityadvocacy,midwifery,nationalmaternityservicesplan,nmspfalsefull"As Long as the Baby is Healthy" Part 1https://www.spreaker.com/episode/as-long-as-the-baby-is-healthy-part-1--11300980
Sally has identified 6 underlying beliefs to the statement "As long as the baby is healthy", but there are bound to be more. These are:

1. “I am not qualified. Someone else needs to manage my birth.”
2. “My rights and my health and safety are subordinate to my baby’s. I must comply with my carer’s treatment.”
3. “The hospital/my maternity carer wants the same outcome as me.”
4. “Birth is dangerous and needs to be managed medically. Positive births are due to luck.”
5. “Labour and birth are simply painful, pointless torture. My partner has only a limited ability to support the process.”
6. “My experience is irrelevant and women who seek a positive experience are selfish and exposing the baby to risk.”

CLARIFICATION: At 1'16" insert "normal risk" to read "Over 90% of 'normal risk' Australian women go into labour with no pre-existing conditions"

In Part 1 of this 2 part series, Sally covers underlying beliefs 1-3, which focus on women's rights in childbirth and informed consent.

In Part 2 Sally covers beliefs 4-6, which relate to the physical aspects of the birth process: http://www.spreaker.com/user/pregnancybirthandbeyond/as-long-as-the-baby-is-healthy-part-2

Speakers:
Bashi Hazard, Human Rights Lawyer, www.humanrightsinchildbirth.org
Bec Jenkinson, Univ. Queensland PhD candidate and maternity services consumer advocate

References:
* https://ama.com.au/position-statement/maternal-decision-making-2013
* Intervention rates: http://www.aihw.gov.au/WorkArea/DownloadAsset.aspx?id=60129547757
* Australia's Mothers and Babies Report 2014: http://www.aihw.gov.au/WorkArea/DownloadAsset.aspx?id=60129557657
* Rebecca Schiller, “Why Human Rights in Childbirth Matter”, Pinter and Martin, 2016 (https://www.capersbookstore.com.au/product/whyhumanrightsinchildbirthmatter/)
* https://theconversation.com/episiotomy-during-childbirth-not-just-a-little-snip-36062
* Ann Catchlove "Yes I can, No I won't", Birth Matters 14/2 Autumn 2010
* "Rates of obstetric intervention... among low risk women in public and private hospitals" http://bmjopen.bmj.com/content/4/5/e004551
* http://www.panda.org.au/news/412-research-reveals-the-alarming-economic-cost-of-postnatal-depression-
* "Birth control: to what extent do women report being informed and involved in decisions about pregnancy and birth procedures? "https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3923734/

Further reading of interest:
* Kruske, S, Young, K, Jenkinson, B, Catchlove, A "Maternity care providers' perceptions of women's autonomy and the law" BMC, Pregnancy and Childbirth 2013, 13:84
* www.birthbythenumbers.org

Information and Support Services:
* PANDA National Helpline
Mon to Fri, 10am - 5pm AEST
1300 726 306
* www.maternitychoices.org.au
* Safe Motherhood for All
* www.humanrightsinchildbirth.org
* www.birthrights.org.uk
* www.panda.org.au

Credits: Interviews with Bashi Hazard and Bec Jenkinson (part) recorded at International Normal Labour and Birth Conference, Sydney, 2016. Thank you to Prof. Hannah Dahlen for this opportunity.

Produced and Presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2017
www,pbbmedia.org]]>https://api.spreaker.com/episode/11300980Fri, 03 Mar 2017 06:10:50 +0000PBB Media IncorporatedWe all want a healthy baby, there's no question of that, but Sally believes there are underlying beliefs to the common phrase "As long as the baby is healthy" that deserve closer examination. Are we giving up elements of birth that are more important...
Sally has identified 6 underlying beliefs to the statement "As long as the baby is healthy", but there are bound to be more. These are:

1. “I am not qualified. Someone else needs to manage my birth.”
2. “My rights and my health and safety are subordinate to my baby’s. I must comply with my carer’s treatment.”
3. “The hospital/my maternity carer wants the same outcome as me.”
4. “Birth is dangerous and needs to be managed medically. Positive births are due to luck.”
5. “Labour and birth are simply painful, pointless torture. My partner has only a limited ability to support the process.”
6. “My experience is irrelevant and women who seek a positive experience are selfish and exposing the baby to risk.”

CLARIFICATION: At 1'16" insert "normal risk" to read "Over 90% of 'normal risk' Australian women go into labour with no pre-existing conditions"

In Part 1 of this 2 part series, Sally covers underlying beliefs 1-3, which focus on women's rights in childbirth and informed consent.

In Part 2 Sally covers beliefs 4-6, which relate to the physical aspects of the birth process: http://www.spreaker.com/user/pregnancybirthandbeyond/as-long-as-the-baby-is-healthy-part-2

Speakers:
Bashi Hazard, Human Rights Lawyer, www.humanrightsinchildbirth.org
Bec Jenkinson, Univ. Queensland PhD candidate and maternity services consumer advocate

References:
* https://ama.com.au/position-statement/maternal-decision-making-2013
* Intervention rates: http://www.aihw.gov.au/WorkArea/DownloadAsset.aspx?id=60129547757
* Australia's Mothers and Babies Report 2014: http://www.aihw.gov.au/WorkArea/DownloadAsset.aspx?id=60129557657
* Rebecca Schiller, “Why Human Rights in Childbirth Matter”, Pinter and Martin, 2016 (https://www.capersbookstore.com.au/product/whyhumanrightsinchildbirthmatter/)
* https://theconversation.com/episiotomy-during-childbirth-not-just-a-little-snip-36062
* Ann Catchlove "Yes I can, No I won't", Birth Matters 14/2 Autumn 2010
* "Rates of obstetric intervention... among low risk women in public and private hospitals" http://bmjopen.bmj.com/content/4/5/e004551
* http://www.panda.org.au/news/412-research-reveals-the-alarming-economic-cost-of-postnatal-depression-
* "Birth control: to what extent do women report being informed and involved in decisions about pregnancy and birth procedures? "https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3923734/

Further reading of interest:
* Kruske, S, Young, K, Jenkinson, B, Catchlove, A "Maternity care providers' perceptions of women's autonomy and the law" BMC, Pregnancy and Childbirth 2013, 13:84
* 1671aslongasthebabyishealthy,birth,birthrisk,humanrightsinchildbirth,iamnotqualified,informedconsent,pregnancyfalsefullThe funny and scary world of raising teen daughtershttps://www.spreaker.com/episode/the-funny-and-scary-world-of-raising-teen-daughters--10975604From body image and self esteem, to dating and 'the sex talk' to teen girls finding their own scene of self and more right here on Pregnancy Birth and Beyond Radio.
Make sure you catch the last 10minutes of the show in which Tamar Ben-Hur performs her piece from the Vagina Conversations titled 'In Relationship' not to be missed with the opening line "my vagina had a near death experience"

Special thank you to our guests for this episode
Gabrielle Goldklang www.girlwisdom.net
Tamar Ben-Hur www.tamarbenhur.com

Produced and presented by Lara Martin
Copyright 2017 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/10975604Mon, 20 Feb 2017 23:36:57 +0000PBB Media IncorporatedRaising teen girls can be a little hairy at times, and a little bit scary too... but not to fear, this episode we'll be giving you the low down on parenting teen girls. From body image and self esteem, to dating and 'the sex talk' to teen girls...From body image and self esteem, to dating and 'the sex talk' to teen girls finding their own scene of self and more right here on Pregnancy Birth and Beyond Radio.
Make sure you catch the last 10minutes of the show in which Tamar Ben-Hur performs her piece from the Vagina Conversations titled 'In Relationship' not to be missed with the opening line "my vagina had a near death experience"

Special thank you to our guests for this episode
Gabrielle Goldklang www.girlwisdom.net
Tamar Ben-Hur www.tamarbenhur.com

Produced and presented by Lara Martin
Copyright 2017 PBB Media and Lara Martin
www.pbbmedia.org]]>2218family,parenting,parentingpodcast,teengirls,teens,thesextalkfalsefullExtras: Healing from Food Allergies and Sensitivities: One Mother's Pathhttps://www.spreaker.com/episode/extras-healing-from-food-allergies-and-sensitivities-one-mother-s-path--10895971
Sally's interview with a local mum about her 10 year journey of dealing with her daughter's extreme sensitivities to many common foods and environmental factors. Over the last three years they have been following the GAPS protocol (Gut and Psychology Syndrome) and have achieved impressive results.

This mother's main wish for the beginning of her journey: That she had been told the direct link between what we eat and our state of health.

One clarification at 21": We are 10% human cells, 90% bacterial (and other co-operative yeasts, etc) cells. More info at www.microbirth.com

References:
www.gaps.me

Aired on 99.9 BayFM Byron Bay 13 February 2017.]]>https://api.spreaker.com/episode/10895971Sat, 18 Feb 2017 02:38:08 +0000PBB Media IncorporatedFrom The Belly Show, which airs on BayFM each Monday 12-2pm. Sally's interview with a local mum about her 10 year journey of dealing with her daughter's extreme sensitivities to many common foods and environmental factors. Over the last three years...
Sally's interview with a local mum about her 10 year journey of dealing with her daughter's extreme sensitivities to many common foods and environmental factors. Over the last three years they have been following the GAPS protocol (Gut and Psychology Syndrome) and have achieved impressive results.

This mother's main wish for the beginning of her journey: That she had been told the direct link between what we eat and our state of health.

One clarification at 21": We are 10% human cells, 90% bacterial (and other co-operative yeasts, etc) cells. More info at www.microbirth.com

References:
www.gaps.me

Aired on 99.9 BayFM Byron Bay 13 February 2017.]]>2428anaphylaxis,bonebroth,foodallergies,gapsdiet,guthealthfalsefullBreastfeeding after breast cancerhttps://www.spreaker.com/episode/breastfeeding-after-breast-cancer--10781940
This episode – Healing through breastfeeding:
Two mother's from across the globe share their unique story's from overwhelming circumstances to reclaiming back their body and breasts.
From Breast Cancer to Breastfeeding.
This episode also features the highly acclaimed author, lactation consultant and mother of 3 Meg Nagle known more famously as the Milk Meg who shares with us the in's and out's of breastfeeding that all mothers, fathers can benefit from knowing.
Special thank you to this episodes guests:
Meg Nagle www.themilkmeg.com
Dr Holly Goldberg. www.floweressenceapothecary.com
and mother Karlee.

Reference:
www.bcna.org.au/understanding-breast-cancer/breast-cancer-in-young-women/
www.bayfm.org
photo credit: Kate Murray Photography.

Produced and presented by Lara Martin
Copyright 2017 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/10781940Tue, 14 Feb 2017 11:58:37 +0000PBB Media IncorporatedBreasts we all have them. But what if your breast(s) were trying to kill you and then you went on to nourish your baby. This episode – Healing through breastfeeding: Two mother's from across the globe share their unique story's from overwhelming...
This episode – Healing through breastfeeding:
Two mother's from across the globe share their unique story's from overwhelming circumstances to reclaiming back their body and breasts.
From Breast Cancer to Breastfeeding.
This episode also features the highly acclaimed author, lactation consultant and mother of 3 Meg Nagle known more famously as the Milk Meg who shares with us the in's and out's of breastfeeding that all mothers, fathers can benefit from knowing.
Special thank you to this episodes guests:
Meg Nagle www.themilkmeg.com
Dr Holly Goldberg. www.floweressenceapothecary.com
and mother Karlee.

Reference:
www.bcna.org.au/understanding-breast-cancer/breast-cancer-in-young-women/
www.bayfm.org
photo credit: Kate Murray Photography.

Produced and presented by Lara Martin
Copyright 2017 PBB Media and Lara Martin
www.pbbmedia.org]]>1671breastcancersurvivor,breastfeeding,parentingfalsefullThe family as ashram: raising teens, step parenting and supporting ourselveshttps://www.spreaker.com/episode/the-family-as-ashram-raising-teens-step-parenting-and-supporting-ourselves--10650629
www.lissieturner.com
http://www.theyogashack.com.au/
http://yogatherapyaustralia.com/dr-n-chandrasekaran-mbbs-dr-nc/

Aired on 99.9BayFM Byron Bay on 6 February 2017.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2017.
www.pbbmedia.org]]>https://api.spreaker.com/episode/10650629Thu, 09 Feb 2017 03:03:54 +0000PBB Media IncorporatedSally's interview with mother, yoga teacher and speaker Lissie Turner on the opportunities for personal growth that parenting presents us, particularly when raising teens and step parenting. www.lissieturner.com http://www.theyogashack.com.au/...
www.lissieturner.com
http://www.theyogashack.com.au/
http://yogatherapyaustralia.com/dr-n-chandrasekaran-mbbs-dr-nc/

Aired on 99.9BayFM Byron Bay on 6 February 2017.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2017.
www.pbbmedia.org]]>1955parenting,parentingasspiritualjourney,parentingteens,stepparentingfalsefullEmbodied Feminine Leadership Experience P1https://www.spreaker.com/episode/embodied-feminine-leadership-experience-p1--10568688- What is feminine leadership and how do we embody this.

Written by Lisa Fitzpatrick www.lisafitzpatrick.com.au

Produced by Lara Martin for Pregnancy Birth & Beyond Radio]]>https://api.spreaker.com/episode/10568688Sun, 05 Feb 2017 22:58:48 +0000PBB Media IncorporatedLisa Fitzpatrick on the Embodied Feminine Leadership Experience series part one. - What is feminine leadership and how do we embody this. Written by Lisa Fitzpatrick www.lisafitzpatrick.com.au Produced by Lara Martin for Pregnancy Birth & Beyond Radio- What is feminine leadership and how do we embody this.

Written by Lisa Fitzpatrick www.lisafitzpatrick.com.au

Produced by Lara Martin for Pregnancy Birth & Beyond Radio]]>302feminine,leadership,women-of-powerfalsefull“I sang at the top of my lungs, and found the safest birth care for me and my baby”https://www.spreaker.com/episode/i-sang-at-the-top-of-my-lungs-and-found-the-safest-birth-care-for-me-and-my-baby--10446179
Thank you to Candice and Tiffany for sharing your stories.

Speakers:
* Mothers, Candice and Tiffany,
* the late Dr Marsden Wagner, Perinatologist and World Health Organisation’s Director of Women's and Children's Health for 15 years
* Dr Alec Welsh is a Professor of Maternal-Fetal Medicine, at the Royal Hospital for Women in Sydney
* Sally Tracy, Professor of Midwifery at the University of Sydney and the Royal Hospital for Women

References:
* “Models of maternity care: evidence for midwifery continuity of care”, Homer, CSE MJA 205 (8) j 17 October 2016
* The late Dr Marsden Wagner speaking with Diana Paul about normal birth https://www.youtube.com/watch?v=Cm8ErQxTFyo
* Australian Institute of Health and Welfare. Australia’s mothers and babies 2013
* “The Global Numbers and Costs of Additionally Needed and Unnecessary Caesarean Sections Performed per Year: Overuse as a Barrier to Universal Coverage” World Health Organisation 2010
* ACOG Jan. 2017 recommendations re. cont. of care: http://www.medpagetoday.com/OBGYN/Pregnancy/62745
* “Caseload midwifery compared to standard or private obstetric care for first time mothers in a public teaching hospital in Australia: a cross sectional study of cost and birth outcomes”, Tracy et al, Biomed Central Pregnancy and Birth
* Cochrane review: (Hodnett, et al, "Continuous support for women during childbirth” https://www.ncbi.nlm.nih.gov/pubmed/23857334)
* Health services globally are headed towards bankruptcy by 2030: STEFAN ELBE, Professor of International Relations, University of Sussex and Director of Centre for Global Health Policy
* Maternity Choices Australia: www.maternitychoices.org.au

Aired on 99.9 BayFM Byron Bay on 30 January 2017.

Photo credit: Byron Community Birthing Service Midwives by Humans of Byron Bay

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2017.
www.pbbmedia.org]]>https://api.spreaker.com/episode/10446179Tue, 31 Jan 2017 06:25:42 +0000PBB Media IncorporatedOver 80% of women can expect to give birth normally, given the right support - continuity of care that is founded on the understanding that birth is usually a normal process. Midwifery group practices in local hospitals are one way to give that...
Thank you to Candice and Tiffany for sharing your stories.

Speakers:
* Mothers, Candice and Tiffany,
* the late Dr Marsden Wagner, Perinatologist and World Health Organisation’s Director of Women's and Children's Health for 15 years
* Dr Alec Welsh is a Professor of Maternal-Fetal Medicine, at the Royal Hospital for Women in Sydney
* Sally Tracy, Professor of Midwifery at the University of Sydney and the Royal Hospital for Women

References:
* “Models of maternity care: evidence for midwifery continuity of care”, Homer, CSE MJA 205 (8) j 17 October 2016
* The late Dr Marsden Wagner speaking with Diana Paul about normal birth https://www.youtube.com/watch?v=Cm8ErQxTFyo
* Australian Institute of Health and Welfare. Australia’s mothers and babies 2013
* “The Global Numbers and Costs of Additionally Needed and Unnecessary Caesarean Sections Performed per Year: Overuse as a Barrier to Universal Coverage” World Health Organisation 2010
* ACOG Jan. 2017 recommendations re. cont. of care: http://www.medpagetoday.com/OBGYN/Pregnancy/62745
* “Caseload midwifery compared to standard or private obstetric care for first time mothers in a public teaching hospital in Australia: a cross sectional study of cost and birth outcomes”, Tracy et al, Biomed Central Pregnancy and Birth
* Cochrane review: (Hodnett, et al, "Continuous support for women during childbirth” https://www.ncbi.nlm.nih.gov/pubmed/23857334)
* Health services globally are headed towards bankruptcy by 2030: STEFAN ELBE, Professor of International Relations, University of Sussex and Director of Centre for Global Health Policy
* Maternity Choices Australia: www.maternitychoices.org.au

Aired on 99.9 BayFM Byron Bay on 30 January 2017.

Photo credit: Byron Community Birthing Service Midwives by Humans of Byron Bay

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2017.
www.pbbmedia.org]]>1801birthcentre,byroncommunitybirthingservice,homebirth,midwiferygrouppractice,midwifery-ledcontinuityofcarefalsefull"Will I be able to have a VBAC"https://www.spreaker.com/episode/will-i-be-able-to-have-a-vbac--10381084
This episode of Pregnancy Birth and Beyond is an interview with parents Nikki and Tariq Shaheed on the births of their three children, in particular their VBAC, Vaginal Birth After Caesarean.
For the birth of their first baby, Nikki and Tariq had planned and prepared for a natural birth at their local hospital. Things didn't go as they had hoped for. Take a listen to hear their story and insights from unplanned caesarean birth to VBAC and home birth VBAC #2.

Nikki Shaheed is a doula, Birthing From Within mentor and provides Birthing From Within Birth Story Healing and a mother of three.

Key words:
VBAC
Birth story healing

Episode references:
bfwsa.com, Nikki Shaheed's website.
BirthingFromWithin.com
Midwifethinking.com
Raisingchildren.net.au
Sarahbuckley.com
Dr Michel Oden't 'The Caesarean'

Produced and presented by Lara Martin
Copyright 2017 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/10381084Wed, 25 Jan 2017 03:54:52 +0000PBB Media Incorporated"I think I had the sense, at the time, that my body didn't work and I wanted to feel like it did work. At the time, I didn't realise all the ways my body was working for me" Nikki Shaheed reflecting back on her birth experiences. This episode of...
This episode of Pregnancy Birth and Beyond is an interview with parents Nikki and Tariq Shaheed on the births of their three children, in particular their VBAC, Vaginal Birth After Caesarean.
For the birth of their first baby, Nikki and Tariq had planned and prepared for a natural birth at their local hospital. Things didn't go as they had hoped for. Take a listen to hear their story and insights from unplanned caesarean birth to VBAC and home birth VBAC #2.

Nikki Shaheed is a doula, Birthing From Within mentor and provides Birthing From Within Birth Story Healing and a mother of three.

Key words:
VBAC
Birth story healing

Episode references:
bfwsa.com, Nikki Shaheed's website.
BirthingFromWithin.com
Midwifethinking.com
Raisingchildren.net.au
Sarahbuckley.com
Dr Michel Oden't 'The Caesarean'

Produced and presented by Lara Martin
Copyright 2017 PBB Media and Lara Martin
www.pbbmedia.org]]>1681birth,birthhealing,parenting,pregnancy,vbacfalsefullBecoming Your Sensual Self - Annalee chats to Dr Saida Desilets & Guestshttps://www.spreaker.com/episode/becoming-your-sensual-self-annalee-chats-to-dr-saida-desilets-guests--10261659
I am excited to share this next interview with you.. its hard to explain with words (and it will become clear during the interview why that is), but a woman like Saida cannot be defined by words, or pictures or an online video. A person like Saida can only be experienced. Part Doctor part Animal, Saida’s brain & body work in unison, swiftly piercing through any doubt or resistance you may be experiencing in the moment. Connecting You, with Now.

Wow! Sounds outrageous? It is. Women like K.C. Baker, Dr Christiane Northrope & Regena Tomashauer (Mama Gena) and many more all hold Dr Desilets in high regard in the world of Women's Health & Wellbeing. Tune-in to find out why!

Links:
www.saidadesilets.com
www.pbbmedia.org
https://www.facebook.com/JadeGoddessByronBay/]]>https://api.spreaker.com/episode/10261659Sun, 08 Jan 2017 03:21:35 +0000PBB Media IncorporatedYou’re with Annalee Atia and my delicious interview with Dr Saida Desilets, which I was honored to record during her weekend workshop in the Byron Hills in 2016, is coming up. I am excited to share this next interview with you.. its hard to explain...
I am excited to share this next interview with you.. its hard to explain with words (and it will become clear during the interview why that is), but a woman like Saida cannot be defined by words, or pictures or an online video. A person like Saida can only be experienced. Part Doctor part Animal, Saida’s brain & body work in unison, swiftly piercing through any doubt or resistance you may be experiencing in the moment. Connecting You, with Now.

Wow! Sounds outrageous? It is. Women like K.C. Baker, Dr Christiane Northrope & Regena Tomashauer (Mama Gena) and many more all hold Dr Desilets in high regard in the world of Women's Health & Wellbeing. Tune-in to find out why!

Links:
www.saidadesilets.com
www.pbbmedia.org
https://www.facebook.com/JadeGoddessByronBay/]]>1699emergenceofthesensualwoman,motherhood,pelvichealthcare,saidadesilets,womanssexualempowerment,womenshealthfalsefullBenefits of Midwife-Led Continuity of Carehttps://www.spreaker.com/episode/benefits-of-midwife-led-continuity-of-care--10194223
References:
Wiysonge CS. Midwife-led versus other models of care for childbearing women: RHL commentary (last revised: 1 September 2009). The WHO Reproductive Health Library; Geneva: World Health Organization

Dr Sarah Buckley: http://sarahbuckley.com/pain-in-labour-your-hormones-are-your-helpers
http://sarahbuckley.com/blog/hormonal-physiology-of-childbearing-report

Private midwives' listings: www.midwivesaustralia.com.au

Birth choices and maternity services advocacy: www.maternitychoices.org.au

Australian College of Midwives
https://www.midwives.org.au/know-your-midwife-benefits

Aired on 99.9 BayFM Byron Bay Australia on 26 December 2016.
Host: Sally Cusack]]>https://api.spreaker.com/episode/10194223Wed, 28 Dec 2016 05:00:21 +0000PBB Media IncorporatedInterview with expectant mums Hayley and Emma about their birthing choices and information about the benefits of continuity of midwifery led care for pregnancy and birth. References: Wiysonge CS. Midwife-led versus other models of care for...
References:
Wiysonge CS. Midwife-led versus other models of care for childbearing women: RHL commentary (last revised: 1 September 2009). The WHO Reproductive Health Library; Geneva: World Health Organization

Dr Sarah Buckley: http://sarahbuckley.com/pain-in-labour-your-hormones-are-your-helpers
http://sarahbuckley.com/blog/hormonal-physiology-of-childbearing-report

Private midwives' listings: www.midwivesaustralia.com.au

Birth choices and maternity services advocacy: www.maternitychoices.org.au

Australian College of Midwives
https://www.midwives.org.au/know-your-midwife-benefits

Aired on 99.9 BayFM Byron Bay Australia on 26 December 2016.
Host: Sally Cusack]]>1873birthchoices,continuityofmidwiferyledcarefalsefullExtras: Dr Howard Chilton on the Needs of Newborn Babies: CRN Releasehttps://www.spreaker.com/episode/extras-dr-howard-chilton-on-the-needs-of-newborn-babies-crn-release--10152055
Essential listening for all families welcoming a new baby.

www.babydoc.com.au
Books: "Baby on Board" and "Your Cherished Baby"

Aired on BayFM Byron Bay 19 December 2016 and nationally on the Community Radio Network, Australia on 23 December 2016

Full version of the interview here: https://www.spreaker.com/user/pregnancybirthandbeyond/dr-howard-chilton-on-the-needs-of-newbor]]>https://api.spreaker.com/episode/10152055Wed, 21 Dec 2016 05:45:23 +0000PBB Media IncorporatedSally's shorter interview with Dr Howard Chilton, Neonatal Paediatrician and author of "Baby on Board" and "Your Cherished Baby" about the needs of newborn babies, social expectations of how they 'should' sleep, attuning to your baby, how babies teach...
Essential listening for all families welcoming a new baby.

www.babydoc.com.au
Books: "Baby on Board" and "Your Cherished Baby"

Aired on BayFM Byron Bay 19 December 2016 and nationally on the Community Radio Network, Australia on 23 December 2016

Full version of the interview here: https://www.spreaker.com/user/pregnancybirthandbeyond/dr-howard-chilton-on-the-needs-of-newbor]]>1671attachmentparenting,breastfeeding,newbornsfalsefullDr Howard Chilton on the Needs of Newborn Babieshttps://www.spreaker.com/episode/dr-howard-chilton-on-the-needs-of-newborn-babies--10144646
Essential listening for all families welcoming a new baby.

www.babydoc.com.au
Books: "Baby on Board" and "Your Cherished Baby"

Ref: Professor Kerstin Uvnas Moberg - oxytocin research
http://www.peptonicmedical.se/about-peptonic/kerstin-uvnas-moberg/

Aired on BayFM Byron Bay 19 December 2016.
Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016

Shorter version for the national broadcast on the Community Radio Network here: https://www.spreaker.com/user/pregnancybirthandbeyond/dr-howard-chilton-on-the-needs-of-newbor_1]]>https://api.spreaker.com/episode/10144646Tue, 20 Dec 2016 07:07:05 +0000PBB Media IncorporatedSally's full interview with Dr Howard Chilton, Neonatal Paediatrician and author of "Baby on Board" and "Your Cherished Baby" about the needs of newborn babies, social expectations of how they 'should' sleep, attuning to your baby, how babies teach us...
Essential listening for all families welcoming a new baby.

www.babydoc.com.au
Books: "Baby on Board" and "Your Cherished Baby"

Ref: Professor Kerstin Uvnas Moberg - oxytocin research
http://www.peptonicmedical.se/about-peptonic/kerstin-uvnas-moberg/

Aired on BayFM Byron Bay 19 December 2016.
Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016

Shorter version for the national broadcast on the Community Radio Network here: https://www.spreaker.com/user/pregnancybirthandbeyond/dr-howard-chilton-on-the-needs-of-newbor_1]]>2340babysleep,postnatal,postnatalsupport,settlingbabiesfalsefullFrom Couple to Parenthood; In the Blink of a Baby's Eyehttps://www.spreaker.com/episode/from-couple-to-parenthood-in-the-blink-of-a-baby-s-eye--10109699Getting to Know the new ‘us’

Our guest for this episode of the Pregnancy Birth and Beyond Radio is Kimberly Lipschus, founder of Fertile Minds.

ABOUT KIMBERLEY IN A NUTSHELL
KimberleyLipschus is a Women’s Wellbeing & Fertility Psychotherapist. Kimberly specialises in reproductive and maternal mental health, fertility challenges, pregnancy loss, still birth, assisted reproduction, pregnancy-to-birth support, birth trauma, post natal challenges as well as adjustments to life with a new baby. She works with women, men, couples and new families.

In much of her work Kimberley pays particular attention to relationship transitions during these times, because if one person struggles, so does the family unit. And this ripples out to the whole of the community.

She is writing a book on fertility due out in 2017.
To connect with Kimberly go to fertileminds.com.au

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2016.
PBBmedia.org]]>https://api.spreaker.com/episode/10109699Thu, 15 Dec 2016 04:25:05 +0000PBB Media IncorporatedFrom Couple to Parent (in the Blink of a Baby’s Eye) Getting to Know the new ‘us’ Our guest for this episode of the Pregnancy Birth and Beyond Radio is Kimberly Lipschus, founder of Fertile Minds. ABOUT KIMBERLEY IN A NUTSHELL...Getting to Know the new ‘us’

Our guest for this episode of the Pregnancy Birth and Beyond Radio is Kimberly Lipschus, founder of Fertile Minds.

ABOUT KIMBERLEY IN A NUTSHELL
KimberleyLipschus is a Women’s Wellbeing & Fertility Psychotherapist. Kimberly specialises in reproductive and maternal mental health, fertility challenges, pregnancy loss, still birth, assisted reproduction, pregnancy-to-birth support, birth trauma, post natal challenges as well as adjustments to life with a new baby. She works with women, men, couples and new families.

In much of her work Kimberley pays particular attention to relationship transitions during these times, because if one person struggles, so does the family unit. And this ripples out to the whole of the community.

She is writing a book on fertility due out in 2017.
To connect with Kimberly go to fertileminds.com.au

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2016.
PBBmedia.org]]>1660family,parenthood,parenting,pregnancy,relationshipfalsefullErica Nettle-Chik on plants, parenting and Luminous Youthhttps://www.spreaker.com/episode/erica-nettle-chik-on-plants-parenting-and-luminous-youth--10039647www.luminousyouth.com

References:
Susun Weed, "Wise Woman's Herbal for the Childbearing Year", www.susunweed.com
Podcast with Susun: http://www.spreaker.com/user/pregnancybirthandbeyond/susun-weed-on-herbal-wisdom-and-the-wise

Podcast with husband, Paul, about her postnatal period: http://www.spreaker.com/user/pregnancybirthandbeyond/paul-crebar-on-becoming-a-father

"Ringing Cedars" series of books

"Hold Onto Your Kids" Dr Gabor Mate, Gordon Neufeld

www.mamabake.com: Group, big batch baking for mothers

One final tip we forgot to mention on air for powerful post-birth healing - consuming the placenta...

Produced and Presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2016
www,pbbmedia.org]]>https://api.spreaker.com/episode/10039647Mon, 05 Dec 2016 10:37:38 +0000PBB Media IncorporatedSally's interview with Erica Nettle-Chik, mother of 4 and founder of the "Luminous Youth Village". www.luminousyouth.com References: Susun Weed, "Wise Woman's Herbal for the Childbearing Year", www.susunweed.com Podcast with Susun:...www.luminousyouth.com

References:
Susun Weed, "Wise Woman's Herbal for the Childbearing Year", www.susunweed.com
Podcast with Susun: http://www.spreaker.com/user/pregnancybirthandbeyond/susun-weed-on-herbal-wisdom-and-the-wise

Podcast with husband, Paul, about her postnatal period: http://www.spreaker.com/user/pregnancybirthandbeyond/paul-crebar-on-becoming-a-father

"Ringing Cedars" series of books

"Hold Onto Your Kids" Dr Gabor Mate, Gordon Neufeld

www.mamabake.com: Group, big batch baking for mothers

One final tip we forgot to mention on air for powerful post-birth healing - consuming the placenta...

Produced and Presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2016
www,pbbmedia.org]]>1671healingfrombirth,musicoftheplants,parenting,parentingasspiritualpractice,postnatalhealing,postnatalsupportfalsefullSpoken word; women & mothers with Fleassy Malayhttps://www.spreaker.com/episode/spoken-word-women-mothers-with-fleassy-malay--10024666"Fleassy Malay is an Internationally renowned, evocative and powerful spoken word artist from the UK. Now based in Melbourne, Australia, she runs one of Melbourne’s most successful Spoken Word events, Mother Tongue."
Episode host: Lara Martin
w. fleassymalay.com
w. pbbmedia.org]]>https://api.spreaker.com/episode/10024666Fri, 02 Dec 2016 22:49:42 +0000PBB Media IncorporatedThis episode of Pregnancy Birth & Beyond we have guest Fleassy Malay in the studio talking women and mothers claiming their voice through the art of spoken word. We also get hear a live spoken word poem by Fleassy, 'When Men Birth.' "Fleassy Malay is..."Fleassy Malay is an Internationally renowned, evocative and powerful spoken word artist from the UK. Now based in Melbourne, Australia, she runs one of Melbourne’s most successful Spoken Word events, Mother Tongue."
Episode host: Lara Martin
w. fleassymalay.com
w. pbbmedia.org]]>767birth,fathers,mother's,pregnancy,spoken-wordfalsefullA discussion on Abortion with Annalee Atia, Lisa Fitzpatrick & Angela Fitzgeraldhttps://www.spreaker.com/episode/a-discussion-on-abortion-with-annalee-atia-lisa-fitzpatrick-angela-fitzgerald--10013001
Women know amongst themselves that there are very few of them that have not experienced it themselves or know of a close friend that hasn’t.

There is a general lack of support and difficulty in asking & receiving support when it comes to abortion.

In this episode of the pregnancy, Birth & Beyond show we discussed the immensely important topic of abortion, its impact & the relevance of support.

Our guests are Lisa Fitzpatrick, writer, speaker, women’s leadership coach and so much more! you can find out more about lis’s work in the world on her website: lisafitzpatrick.com.au
and Angela Fitzgerald, midwife, speaker, also an amazing writer & championing the popular healing after birth program at Birth Your Truth. Find out more about Angela and her work at: birthyourtruth.com.

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>https://api.spreaker.com/episode/10013001Thu, 01 Dec 2016 13:00:00 +0000PBB Media IncorporatedWe don’t often hear the word abortion in our daily conversation. It’s a topic that is private, still controversial & often laden with emotional turmoil. But not always. Women know amongst themselves that there are very few of them that have not...
Women know amongst themselves that there are very few of them that have not experienced it themselves or know of a close friend that hasn’t.

There is a general lack of support and difficulty in asking & receiving support when it comes to abortion.

In this episode of the pregnancy, Birth & Beyond show we discussed the immensely important topic of abortion, its impact & the relevance of support.

Our guests are Lisa Fitzpatrick, writer, speaker, women’s leadership coach and so much more! you can find out more about lis’s work in the world on her website: lisafitzpatrick.com.au
and Angela Fitzgerald, midwife, speaker, also an amazing writer & championing the popular healing after birth program at Birth Your Truth. Find out more about Angela and her work at: birthyourtruth.com.

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>1705abortion,catholic,reproductiverights,unwantedpregnancy,womenshealthfalsefullThe Chakras of Pregnancy and Birth with Anna Wattshttps://www.spreaker.com/episode/the-chakras-of-pregnancy-and-birth-with-anna-watts--9938510
Produced and presented by Caroline Cowley.
Copyright PBB Media and Caroline Cowley 2016]]>https://api.spreaker.com/episode/9938510Tue, 22 Nov 2016 11:38:28 +0000PBB Media IncorporatedSpiritual Healer, Childbirth Educator, Doula Trainer and Intrepid World Traveller Anna Watts shares with us her wisdom around the Chakras for Pregnancy and Birth. Anna also describes her experience visiting the D'a'Luz Holistic Midwifery School in...
Produced and presented by Caroline Cowley.
Copyright PBB Media and Caroline Cowley 2016]]>2362birth,chakras,spiritual,yogafalsefull"At Least You Have a Healthy Baby"https://www.spreaker.com/episode/at-least-you-have-a-healthy-baby--9901583
This episode explains the symptoms, resources for help, and discusses how trauma from birth can be one of the causes. Tips for how to heal, and how to help someone you know with perinatal depression or anxiety are also given.

Aired on Monday 14 November 2016 on BayFM and Friday 18 November 2016 on the national Community Radio Network.

Produced by Sally Cusack with the assistance of the Community Broadcasting Foundation.

Important contacts for support:
Perinatal Anxiety and Depression Australia: 1300 726 306
Beyond Blue: 1300 22 4636
www.birthtalk.org

Episode notes:
www.panda.org.au
www.beyondblue.org.au
www.birthtalk.org
UK survey regarding rates of birth trauma and its impacts on women: http://www.birthrights.org.uk/wordpress/wp-content/uploads/2013/10/Birthrights-Dignity-Survey.pdf
www.safemotherhoodforall.org.au

Speakers -
* Sheena Byrom, OBE, midwife and midwifery consultant from the UK, www.sheenabyrom.com
* Bashi Kumar Hazard, lawyer and board member of Human Rights in Childbirth: www.humanrightsinchildbirth.org
* Professor of Midwifery Soo Downe, University of Central Lancashire, UK. Refs: The Lancet: Maternal Health 2016 Series
* Professor of Community Health Sciences Eugene Declerq, University of Boston, US: www.birthbythenumbers.org

With thanks to Professor Hannah Dahlen and the International Normal Labour and Birth Conference October 2016 for enabling me to conduct these interviews.

Image: www.panda.org.au]]>https://api.spreaker.com/episode/9901583Fri, 18 Nov 2016 01:23:50 +0000PBB Media IncorporatedPerinatal Depression and Anxiety Awareness Week is held over one week each November. One in 7 women and one in 10 men suffer from this condition. This episode explains the symptoms, resources for help, and discusses how trauma from birth can be...
This episode explains the symptoms, resources for help, and discusses how trauma from birth can be one of the causes. Tips for how to heal, and how to help someone you know with perinatal depression or anxiety are also given.

Aired on Monday 14 November 2016 on BayFM and Friday 18 November 2016 on the national Community Radio Network.

Produced by Sally Cusack with the assistance of the Community Broadcasting Foundation.

Important contacts for support:
Perinatal Anxiety and Depression Australia: 1300 726 306
Beyond Blue: 1300 22 4636
www.birthtalk.org

Episode notes:
www.panda.org.au
www.beyondblue.org.au
www.birthtalk.org
UK survey regarding rates of birth trauma and its impacts on women: http://www.birthrights.org.uk/wordpress/wp-content/uploads/2013/10/Birthrights-Dignity-Survey.pdf
www.safemotherhoodforall.org.au

Speakers -
* Sheena Byrom, OBE, midwife and midwifery consultant from the UK, www.sheenabyrom.com
* Bashi Kumar Hazard, lawyer and board member of Human Rights in Childbirth: www.humanrightsinchildbirth.org
* Professor of Midwifery Soo Downe, University of Central Lancashire, UK. Refs: The Lancet: Maternal Health 2016 Series
* Professor of Community Health Sciences Eugene Declerq, University of Boston, US: www.birthbythenumbers.org

With thanks to Professor Hannah Dahlen and the International Normal Labour and Birth Conference October 2016 for enabling me to conduct these interviews.

Image: www.panda.org.au]]>1671birthtrauma,pandaawareness,perinatalanxiety,perinataldepressionfalsefullPelvic Healthcare for Women with Julia Rossmanith.https://www.spreaker.com/episode/pelvic-healthcare-for-women-with-julia-rossmanith--9840755
Starting as an impassioned teacher of Anatomy & Physiology at university she became passionate and focused on all the dimensions of health and healing. Alongside the above credentials she is also an advanced practitioner of Australian Bush Flower Essences, has a Certificate IV in Kinesiology and trained in the practice of Hawaiian Lomi Lomi.

A mother of four beautiful children she is dedicated to women's health & wellbeing through the application of all these modalities.

In this episode we focus on Pelvic Health Care for Women & discuss a little of her own unique birthing journey with her four children, having had 2 Cesareans, a VBAC & a Natural Home Birth.

For further information about Julia's work visit: http://www.thenurturedwomb.com.au

Pregnancy, Birth & Beyond Media: www.pbbmedia.org

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>https://api.spreaker.com/episode/9840755Thu, 10 Nov 2016 07:11:43 +0000PBB Media IncorporatedIn this episode of Pregnancy, Birth & Beyond we speak with Julia Rossmanith, a practitioner of The Arvigo Techniques of Maya Abdominal Therapy® and Holistic Pelvic Care™, both healthcare systems designed to support women's health through pelvic health...
Starting as an impassioned teacher of Anatomy & Physiology at university she became passionate and focused on all the dimensions of health and healing. Alongside the above credentials she is also an advanced practitioner of Australian Bush Flower Essences, has a Certificate IV in Kinesiology and trained in the practice of Hawaiian Lomi Lomi.

A mother of four beautiful children she is dedicated to women's health & wellbeing through the application of all these modalities.

In this episode we focus on Pelvic Health Care for Women & discuss a little of her own unique birthing journey with her four children, having had 2 Cesareans, a VBAC & a Natural Home Birth.

For further information about Julia's work visit: http://www.thenurturedwomb.com.au

Pregnancy, Birth & Beyond Media: www.pbbmedia.org

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>1713birthtrauma,childbirth,csection,motherhood,pbbmedia,pelvicfloor,pelvichealthcare,vbac,womenshealth,womenswellbeingfalsefullPlacenta smoothie anyone? all things placenta.https://www.spreaker.com/episode/placenta-smoothie-anyone-all-things-placenta--9781642This live to air on 99.9 Bay Fm episode of Pregnancy Birth and Beyond is all about this amazing organ that sustains the life of the unborn child, yet its purpose does not end there at the birth of the placenta... Have you ever felt a scene of lacking purpose, not being grounded, or knowing where you belong... perhaps the answer is in how your placenta was discarded or revered. We also share the history of eating placenta, placenta encapsulation, traditional rituals and modern things that you can do with your babies placenta.
Special thanks to our guests:
Jodi Selander of placenta Benefits
Kirrah Holborn of Placenta Wisdom
Tanner Blake

Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/9781642Wed, 02 Nov 2016 17:47:04 +0000PBB Media IncorporatedThe placenta, your baby's first mother, this amazing organ is responsible for keeping your baby well nourished. The placenta during pregnancy sits along the uterine wall receiving all the necessary nutrients and oxygen from the mothers blood flowing...This live to air on 99.9 Bay Fm episode of Pregnancy Birth and Beyond is all about this amazing organ that sustains the life of the unborn child, yet its purpose does not end there at the birth of the placenta... Have you ever felt a scene of lacking purpose, not being grounded, or knowing where you belong... perhaps the answer is in how your placenta was discarded or revered. We also share the history of eating placenta, placenta encapsulation, traditional rituals and modern things that you can do with your babies placenta.
Special thanks to our guests:
Jodi Selander of placenta Benefits
Kirrah Holborn of Placenta Wisdom
Tanner Blake

Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>1619birth,encapsulation,homebirth,placenta,pregnancyfalsefullPaul Crebar on becoming a fatherhttps://www.spreaker.com/episode/paul-crebar-on-becoming-a-father--9709516http://www.spreaker.com/user/pregnancybirthandbeyond/paul-crebar-on-expectant-fatherhood

Now, we hear about the reality of birth and fatherhood after his daughter's birth.

Books mentioned: "Birth Without Violence" by Frederick Leboyer and "Raising Our Children, Raising Ourselves" by Naomi Aldort.

Aired on 99.9 BayFM Byron Bay Australia 24 October 2016.

www.luminousyouth.com

++++++++++

Produced and presented by Sally Cusack
Copyright 2016 PBB Media and Sally Cusack]]>https://api.spreaker.com/episode/9709516Mon, 24 Oct 2016 10:30:22 +0000PBB Media IncorporatedSally's interview with Paul, 12 months after his initial interview when he was expecting the birth of his child. http://www.spreaker.com/user/pregnancybirthandbeyond/paul-crebar-on-expectant-fatherhood Now, we hear about the reality of birth and...http://www.spreaker.com/user/pregnancybirthandbeyond/paul-crebar-on-expectant-fatherhood

Now, we hear about the reality of birth and fatherhood after his daughter's birth.

Books mentioned: "Birth Without Violence" by Frederick Leboyer and "Raising Our Children, Raising Ourselves" by Naomi Aldort.

Aired on 99.9 BayFM Byron Bay Australia 24 October 2016.

www.luminousyouth.com

++++++++++

Produced and presented by Sally Cusack
Copyright 2016 PBB Media and Sally Cusack]]>2147babymoon,birth,dadsatbirth,fatherhood,postnatalsupportfalsefullSusun Weed on herbal wisdom and the Wise Woman's Wayhttps://www.spreaker.com/episode/susun-weed-on-herbal-wisdom-and-the-wise-woman-s-way--9708402
www.susunweed.com
http://goddess.net.au/wp/susun-weed-in-australia/

Susun will be visiting Australia in November 2016.

Aired on 99.9 BayFM Byron Bay 17 October 2016

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www.pbbmedia.org]]>https://api.spreaker.com/episode/9708402Mon, 24 Oct 2016 05:34:04 +0000PBB Media IncorporatedSally and Erica Nettle-Chick's interview with Susun Weed about herbs for healing and health, the wise woman's way, plant consciousness and so much more! www.susunweed.com http://goddess.net.au/wp/susun-weed-in-australia/ Susun will be visiting...
www.susunweed.com
http://goddess.net.au/wp/susun-weed-in-australia/

Susun will be visiting Australia in November 2016.

Aired on 99.9 BayFM Byron Bay 17 October 2016

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www.pbbmedia.org]]>2091health,herbalwisdom,plantconsciousness,wisewomansway,womanhood,womenshealthfalsefullCan motherhood and sensuality coexist?https://www.spreaker.com/episode/can-motherhood-and-sensuality-coexist--9700820
Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/9700820Sat, 22 Oct 2016 22:29:17 +0000PBB Media IncorporatedAvalon Darnesh founder of Blossoming Woman shares her insights and knowledge on reclaiming yourself as a mother and whole woman. Here Avalon shares with us, ways you can easily bring self care into your life, lead the way with communication in your...
Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>1452motherhood,parenting,relationshipsfalsefullExtras: Byron Shire Mums and Munchkinshttps://www.spreaker.com/episode/extras-byron-shire-mums-and-munchkins--9667720
Aired on BayFM Byron Bay on 17 October 2016.]]>https://api.spreaker.com/episode/9667720Tue, 18 Oct 2016 22:02:37 +0000PBB Media IncorporatedSally's interview with local mum Nerrida about her community initiative "Byron Shire Mums and Munchkins" facebook group where mums can reach out for support and share their skills and knowledge with each other, and hear about Mums and Munchkins...
Aired on BayFM Byron Bay on 17 October 2016.]]>370mumsandmunchkinsfalsefullTrusting within, with Holly Goldberghttps://www.spreaker.com/episode/trusting-within-with-holly-goldberg--9376312Live to air September 2016 from Bay Fm 99.9 from the heart of Byron Bay with Lara Martin.
Key themes: breast cancer, caesarian birth, trust in body. ]]>https://api.spreaker.com/episode/9376312Sat, 10 Sep 2016 07:34:04 +0000PBB Media IncorporatedTrust. Trust in your body, trust in birth... there are many positive birth affirmations around trusting your body but what does it really mean to trust within? On today’s show I interviewed Holly Goldberg, who lives in California, USA, with her...Live to air September 2016 from Bay Fm 99.9 from the heart of Byron Bay with Lara Martin.
Key themes: breast cancer, caesarian birth, trust in body. ]]>1670birth,breastcancersurvivor,c-section,pregnancy,trust-in-ur-selffalsefullLibby O'Donnell on Post Term Pregnancyhttps://www.spreaker.com/episode/libby-o-donnell-on-post-term-pregnancy--9284149
Related links:
* "Recommendation:
Expectant mothers should be informed that there is only a 35% chance that they will actually go into labour during the week of their estimated date of birth (+/-3 days). Maternal anxiety may be alleviated if a range of dates (for example 38+0- 42+0 weeks) is substituted for a specific date of delivery, with the optimal time for birth being approximately 40+0 weeks gestation."
Management of Pregnancy Beyond 41 Weeks: http://www1.health.nsw.gov.au/PDS/pages/doc.aspx?dn=GL2014_015

* General overview of post term and induction
https://midwifethinking.com/2016/07/13/induction-of-labour-balancing-risks/

* A woman's uterus is only receptive to synthetic oxytocin hormones right at the very end of her pregnancy when she has sufficient oxytocin receptors to respond to it.
http://www.spreaker.com/user/pregnancybirthandbeyond/dr-sarah-buckley-on-the-hormones-ofbirth

* "Induction of labour carries inherent risk and must be exercised with caution. There needs to be clear benefits for the mother and/or the fetus. "
"Health care professionals offering induction of labour must:
• provide the woman with adequate time to discuss the information with her partner/support person before coming to a decision;
• encourage the woman to access a variety of sources of information;
• invite the woman to ask questions, and encourage her to think about her options; and
• support the woman in whatever decision she makes. "
http://www1.health.nsw.gov.au/pds/ActivePDSDocuments/PD2011_075.pdf

(Further info on informed consent: https://ama.com.au/ausmed/respect-informed-choices-pregnant-women-doctors-told

Aired on 99.9 BayFM Byron Bay on 22 August 2016

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www.pbbmedia.org]]>https://api.spreaker.com/episode/9284149Sun, 28 Aug 2016 22:09:29 +0000PBB Media IncorporatedSally's interview with midwife Libby O'Donnell from The Lismore Birth House on post term pregnancy, induction, weighing up the risks and benefits, alternatives to induction and the importance of have a due period, (ie 38-42 weeks) rather than a due...
Related links:
* "Recommendation:
Expectant mothers should be informed that there is only a 35% chance that they will actually go into labour during the week of their estimated date of birth (+/-3 days). Maternal anxiety may be alleviated if a range of dates (for example 38+0- 42+0 weeks) is substituted for a specific date of delivery, with the optimal time for birth being approximately 40+0 weeks gestation."
Management of Pregnancy Beyond 41 Weeks: http://www1.health.nsw.gov.au/PDS/pages/doc.aspx?dn=GL2014_015

* General overview of post term and induction
https://midwifethinking.com/2016/07/13/induction-of-labour-balancing-risks/

* A woman's uterus is only receptive to synthetic oxytocin hormones right at the very end of her pregnancy when she has sufficient oxytocin receptors to respond to it.
http://www.spreaker.com/user/pregnancybirthandbeyond/dr-sarah-buckley-on-the-hormones-ofbirth

* "Induction of labour carries inherent risk and must be exercised with caution. There needs to be clear benefits for the mother and/or the fetus. "
"Health care professionals offering induction of labour must:
• provide the woman with adequate time to discuss the information with her partner/support person before coming to a decision;
• encourage the woman to access a variety of sources of information;
• invite the woman to ask questions, and encourage her to think about her options; and
• support the woman in whatever decision she makes. "
http://www1.health.nsw.gov.au/pds/ActivePDSDocuments/PD2011_075.pdf

(Further info on informed consent: https://ama.com.au/ausmed/respect-informed-choices-pregnant-women-doctors-told

Aired on 99.9 BayFM Byron Bay on 22 August 2016

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www.pbbmedia.org]]>1600birth,birthrisk,inductionoflabour,intervention,posttermpregnancy,pregnancyfalsefullExtras: Maha and Cecile on the Mothers' Centrehttps://www.spreaker.com/episode/extras-maha-and-cecile-on-the-mothers-centre--9250345
If you have an offering for families related to birth or parenting, you can contact Maha or Cecile at :
www.facebook.com/themotherscentre/

Aired on 99.9 BayFM Byron Bay on Monday 22 August 2016.]]>https://api.spreaker.com/episode/9250345Wed, 24 Aug 2016 03:30:15 +0000PBB Media IncorporatedSally's interview with Maha al Musa and Cecile Love about the upcoming popup event for families - "The Mothers' Centre" on 26 November at St John's Hall in Mullumbimby. If you have an offering for families related to birth or parenting, you can...
If you have an offering for families related to birth or parenting, you can contact Maha or Cecile at :
www.facebook.com/themotherscentre/

Aired on 99.9 BayFM Byron Bay on Monday 22 August 2016.]]>358birth,familysupport,parenting,pregnancy,themotherscentrefalsefullA family Afloathttps://www.spreaker.com/episode/a-family-afloat--9181028“People say that what we’re all seeking is a meaning for life. I don’t think that’s what we’re really seeking. I think that what we’re seeking is an experience of being alive, so that our life experiences on the purely physical plane will have resonances with our own innermost being and reality, so that we actually feel the rapture of being alive.” Joseph Campbell.

Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/9181028Fri, 12 Aug 2016 22:43:47 +0000PBB Media IncorporatedWhat does it take to live a life less ordinary... On the Pregnancy Birth and Beyond Radio show we share the story of the Lauducci family of five aboard their sailboat the Shawnigan. A Family Afloat set sail about a year ago, we hear of their...“People say that what we’re all seeking is a meaning for life. I don’t think that’s what we’re really seeking. I think that what we’re seeking is an experience of being alive, so that our life experiences on the purely physical plane will have resonances with our own innermost being and reality, so that we actually feel the rapture of being alive.” Joseph Campbell.

Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>1624family,family-stories,homeschooling,parenting,sailingfalsefullAngela Fitzgerald on Healing After Birthhttps://www.spreaker.com/episode/angela-fitzgerald-on-healing-after-birth--9014194
Aired on 99.9 BayFM Byron Bay Australia on 18 July 2016.

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www.pbbmedia.org]]>https://api.spreaker.com/episode/9014194Tue, 19 Jul 2016 10:51:11 +0000PBB Media IncorporatedSally's interview with Angela Fitzgerald and local mum Kate about the power of sharing birth stories for healing from birth. Includes brief recording with Jane Hardwicke Collings about how our behavioural patterns influence our births and how...
Aired on 99.9 BayFM Byron Bay Australia on 18 July 2016.

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www.pbbmedia.org]]>2422birthstories,healingfrombirthfalsefullConnecting children with Nature and Rhythm with Annie Bryanthttps://www.spreaker.com/episode/connecting-children-with-nature-and-rhythm-with-annie-bryant--8947805Annie brings a contemporary twist to the ancient art of storytelling with a combination of mostly original folktales and fairytales woven together with her own enchanting voice and sing-along folk songs. http://www.talesandsongs.com

++++++++++

Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin]]>https://api.spreaker.com/episode/8947805Sat, 09 Jul 2016 04:35:04 +0000PBB Media IncorporatedAnnie Bryant is a storyteller and songwriter who loves nothing more than to transform the joy, laughter, growls and tears of her own family life into tales and songs for children. Annie brings a contemporary twist to the ancient art of storytelling...Annie brings a contemporary twist to the ancient art of storytelling with a combination of mostly original folktales and fairytales woven together with her own enchanting voice and sing-along folk songs. http://www.talesandsongs.com

++++++++++

Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin]]>1814attachmentparenting,children,childrenmusic,parenting,story-tellingfalsefullTami Lynn Kent Women's Holistic Pelvic Healthhttps://www.spreaker.com/episode/tami-lynn-kent-women-s-holistic-pelvic-health--8871115
www.wildfeminine.com

Aired on BayFM Byron Bay Australia on 27 June 2016.

++++++++++

Produced and presented by Sally Cusack
Copyright 2016 PBB Media and Sally Cusack]]>https://api.spreaker.com/episode/8871115Tue, 28 Jun 2016 11:29:11 +0000PBB Media IncorporatedSally's interview with Tami Lynn Kent, mother of 3 boys, physiotherapist and author of 3 books about bringing spiritual awareness to women's pelvic region, for health, happiness and interconnectedness. www.wildfeminine.com Aired on BayFM Byron Bay...
www.wildfeminine.com

Aired on BayFM Byron Bay Australia on 27 June 2016.

++++++++++

Produced and presented by Sally Cusack
Copyright 2016 PBB Media and Sally Cusack]]>2049birth,motherhood,newfeminism,physiotherapy,womenshealthfalsefullJacinta McEwan - Ayurvedic Approach to Pregnancy and Post-Natal Wellbeinghttps://www.spreaker.com/episode/jacinta-mcewan-ayurvedic-approach-to-pregnancy-and-post-natal-wellbeing--8861425
Produced and Presented by Caroline Cowley
Copyright PBB Media and Caroline Cowley 2016
www,pbbmedia.org]]>https://api.spreaker.com/episode/8861425Mon, 27 Jun 2016 04:15:27 +0000PBB Media IncorporatedIn this episode, Caroline talks to Wise Medicine Woman Jacinta McEwan from Mullum Herbals / Om Healing about the Ayurvedic Approach to Pregnancy, Birth, and Post-Natal Wellness. This juicy little episode is packed full of amazing pearls of common...
Produced and Presented by Caroline Cowley
Copyright PBB Media and Caroline Cowley 2016
www,pbbmedia.org]]>1524ayurveda,doshas,nourishment,postnatalsupport,pregnancyfalsefullExtras: Dr Lauren Tober on Mental Health for Mothershttps://www.spreaker.com/episode/extras-dr-lauren-tober-on-mental-health-for-mothers--8856262https://api.spreaker.com/episode/8856262Sun, 26 Jun 2016 11:02:40 +0000PBB Media IncorporatedCaroline interviews Dr Lauren Tober on her Integrated perspective drawn from the traditions of both Clinical Psychology and Ancient Yogic Wisdom, discussing Post-Natal Depression and more generally, Mental Health for Mothers - how to recognise it, how...1723drlaurentober,gratitude,mentalhealth,postnataldepression,yogafalsefullHelena Norberg-Hodge - The Economics of Happinesshttps://www.spreaker.com/episode/helena-norberg-hodge-the-economics-of-happiness--8855332https://api.spreaker.com/episode/8855332Sun, 26 Jun 2016 06:16:55 +0000PBB Media IncorporatedCaroline interviews Localisation Pioneer and Founder of localfutures.org Helena Norberg Hodge, about her life's work based on her many decades working with the people of Ladakh, Northern India, and on how we can be inspired by this ancient culture,...2292ancientculture,economicsofhappiness,helenanorberghodge,interconnectedness,localfuturesfalsefullTamar Ben Hur - Self Actualisationhttps://www.spreaker.com/episode/tamar-ben-hur-self-actualisation--8849731https://api.spreaker.com/episode/8849731Sat, 25 Jun 2016 07:05:26 +0000PBB Media IncorporatedCaroline interviews psychotherapist Tamar Ben Hur on the question of whether self actualisation for women is attainable inside a long term monogamous relationship. We explore the road map for navigating through what can be some extremely rocky and...1559couplestherapy,feminine,receiving,relationships,selfactualisationfalsefullHope Medford on motherhood, music and creativityhttps://www.spreaker.com/episode/hope-medford-on-motherhood-music-and-creativity--8834348
Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/8834348Thu, 23 Jun 2016 05:31:44 +0000PBB Media IncorporatedHope Medford is a mother, musician and visual artist involved in the healing arts, sustainability education and community health. She has been the percussionist for the tribal roots rock band, Medicine for the People since 2008. Hope has trained and...
Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>1672hopemedford,mothering,music.,pregnancy,pregnancybirthandbeyondradiofalsefullMumpreneur Baylee on Mama + Me Marketshttps://www.spreaker.com/episode/mumpreneur-baylee-on-mama-me-markets--8832217
Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/8832217Wed, 22 Jun 2016 22:33:14 +0000PBB Media IncorporatedInterview with mumpreneur Baylee founder of the Mama + Me. The Mama + Me blossomed out of my frustrations of trying to raise two children and also thrive as a budding entrepreneur in Byron Bay. I knew I was not alone in my plight for having both a...
Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>1284byronbay,mamaandme,mompreneur,mothering,parentingfalsefullIngrid Pullen Photography and breastfeedinghttps://www.spreaker.com/episode/ingrid-pullen-photography-and-breastfeeding--8826374
Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/8826374Wed, 22 Jun 2016 05:01:07 +0000PBB Media IncorporatedInterview with Ingrid Pullen, photographer, mother and accidental breastfeeding advocate. Ingrid shares with us her passion and life through the camera lens. Including her mega 70 mama breastfeeding photo shoot, tips for taking your own home pics,...
Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>1917breastfeeding,photographytips,pregnancyfalsefullDana Martin on radical un-schooling and natural learninghttps://www.spreaker.com/episode/dana-martin-on-radical-un-schooling-and-natural-learning--8826111
Guest: Dana Martin
Presenter and Producer: Lara Martin
Date: 2016]]>https://api.spreaker.com/episode/8826111Wed, 22 Jun 2016 03:53:06 +0000PBB Media IncorporatedJoin us for an interview with radical unschooling mama Dayna Martin. Dayna has been inspiring families for over a decade through sharing her experiences of natural learning, natural birth and attachment parenting. She is an activist, educator and...
Guest: Dana Martin
Presenter and Producer: Lara Martin
Date: 2016]]>969homeschool,natural-learning,parenting,unschoolingfalsefullRobin Grille on the link between Healthy Birth and a Healthy Earthhttps://www.spreaker.com/episode/robin-grille-on-the-link-between-healthy-birth-and-a-healthy-earth--8818397
Robin speaks about how a gentle birth and peaceful childhood creates a population who wants to preserve the natural environment.

Robin also speaks about what he calls the 'neuro-social evolution' that has happened in recent generations and its impacts. This will be one of his topics at the Healthy Birth Healthy Earth Conference.

Aired on BayFM Byron Bay, Australia on 13 June 2016.

www.hbhe.co
www.our-emotional-health.com
"Parenting for Peaceful World" and "Heart to Heart Parenting" by Robin Grille

Produced and Presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www,pbbmedia.org]]>https://api.spreaker.com/episode/8818397Tue, 21 Jun 2016 02:58:26 +0000PBB Media IncorporatedSally's interview with Robin Grille, psychologist, author and speaker at the upcoming Healthy Birth Healthy Earth Conference in September 2016 at Findhorn, Scotland. Robin speaks about how a gentle birth and peaceful childhood creates a population...
Robin speaks about how a gentle birth and peaceful childhood creates a population who wants to preserve the natural environment.

Robin also speaks about what he calls the 'neuro-social evolution' that has happened in recent generations and its impacts. This will be one of his topics at the Healthy Birth Healthy Earth Conference.

Aired on BayFM Byron Bay, Australia on 13 June 2016.

www.hbhe.co
www.our-emotional-health.com
"Parenting for Peaceful World" and "Heart to Heart Parenting" by Robin Grille

Produced and Presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www,pbbmedia.org]]>2247birth,ecobirth,eco-community,environmentalhealth,environmentalism,naturalbirth,parentingfalsefullContinuity of Care with Byron Community Birthing Servicehttps://www.spreaker.com/episode/continuity-of-care-with-byron-community-birthing-service--8514341
http://nnswlhd.health.nsw.gov.au/about/hospitals/byron-central-hospital/birthing-suite/

Aired on BayFM on 2 May 2016.

Photo credit: Souls of Byron Bay

Produced and Presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www,pbbmedia.org]]>https://api.spreaker.com/episode/8514341Wed, 15 Jun 2016 09:00:45 +0000PBB Media IncorporatedSally's interview with Ti Harrison and Cathy Adams from the Northern New South Wales Local Health District about the birth service at Mullumbimby which moved to Byron Central Hospital in June 2016....
http://nnswlhd.health.nsw.gov.au/about/hospitals/byron-central-hospital/birthing-suite/

Aired on BayFM on 2 May 2016.

Photo credit: Souls of Byron Bay

Produced and Presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www,pbbmedia.org]]>2399birth,continuityofcare,midwifery,midwiferygrouppractice,pregnancyfalsefullDr Oscar Serrallach on Postnatal Depletionhttps://www.spreaker.com/episode/dr-oscar-serrallach-on-postnatal-depletion--8643975
www.oscarserrallach.com

Aired on 99.9 BayFM Byron Bay on 23 May 2016.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2016.
www.pbbmedia.org]]>https://api.spreaker.com/episode/8643975Mon, 30 May 2016 11:26:11 +0000PBB Media IncorporatedSally's interview with Oscar Serrallach about post natal depletion, the social causes, the classic signs, and tips for recovery. www.oscarserrallach.com Aired on 99.9 BayFM Byron Bay on 23 May 2016. Produced and presented by Sally Cusack. Copyright...
www.oscarserrallach.com

Aired on 99.9 BayFM Byron Bay on 23 May 2016.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2016.
www.pbbmedia.org]]>2546motherhood,postnataldepletion,postnatalsupport,recoveryfrombirthfalsefullNew Conscious Motherhood Magazine - WILLOW, Fi & Sandra.https://www.spreaker.com/episode/new-conscious-motherhood-magazine-willow-fi-sandra--8366339
With the delightful focus on gentle birthing and conscious parenting, they fit right in, here on Pregnancy, Birth & Beyond ☺

Sandra Colley & Fiona Olsen two of the three women behind this project will share their excitement, joys & challenges of getting such a mammoth production up off the ground and share why they are so passionate about providing a wealth of information for the parent looking to lead by the heart.

Willow Magazine
www.willowmagazine.org

Robin Lim's Bumi Sehat Foundation
http://www.bumisehatfoundation.org

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media, Willow Magazine]]>https://api.spreaker.com/episode/8366339Thu, 28 Apr 2016 02:05:29 +0000PBB Media IncorporatedWe are excited to have the beautiful women behind the recently revealed Willow Magazine, a new one of a kind interactive and digital magazine, created to provide support, love and empowerment to help women transition into motherhood with ease....
With the delightful focus on gentle birthing and conscious parenting, they fit right in, here on Pregnancy, Birth & Beyond ☺

Sandra Colley & Fiona Olsen two of the three women behind this project will share their excitement, joys & challenges of getting such a mammoth production up off the ground and share why they are so passionate about providing a wealth of information for the parent looking to lead by the heart.

Willow Magazine
www.willowmagazine.org

Robin Lim's Bumi Sehat Foundation
http://www.bumisehatfoundation.org

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media, Willow Magazine]]>1989consciousmama,gentlebirth,motherhood,parenting,willowmagazinefalsefullTuriya Hanover & Rupda on Healing Trauma through the Nervous System.https://www.spreaker.com/episode/turiya-hanover-rupda-on-healing-trauma-through-the-nervous-system--8348815
Find out how simple non-invasive somatic (body) work can help you effectively heal trauma through the Nervous System.

Astounding & insightful work - a must hear for parents & community members as we discuss healing trauma (birth trauma, trauma in children etc.) for all family members.

To find out more about Turiya Hanover & Rupda's work go to:
http://www.divinemeetings.com

For more about Dr Peter Levine's work go to:
http://www.traumahealing.org/peter-a-levine-phd.php

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>https://api.spreaker.com/episode/8348815Tue, 26 Apr 2016 02:56:40 +0000PBB Media IncorporatedOur gusts today, Turiya & Rupda will be talking with us about Somatic Experiencing or SE as its known in the field. The deep understandings and insights of Dr Peter A Levine around the nervous system and healing from Trauma have opened up a new world...
Find out how simple non-invasive somatic (body) work can help you effectively heal trauma through the Nervous System.

Astounding & insightful work - a must hear for parents & community members as we discuss healing trauma (birth trauma, trauma in children etc.) for all family members.

To find out more about Turiya Hanover & Rupda's work go to:
http://www.divinemeetings.com

For more about Dr Peter Levine's work go to:
http://www.traumahealing.org/peter-a-levine-phd.php

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>2207healingtrauma,nervoussystem,peterlevine,somaticexperiancing,traumafalsefullTwo Midwifery Students talk Birth and Student Lifehttps://www.spreaker.com/episode/two-midwifery-students-talk-birth-and-student-life--8293030
https://www.facebook.com/events/1539679542992347/

Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
www.pbbmedia.org]]>https://api.spreaker.com/episode/8293030Tue, 19 Apr 2016 02:18:49 +0000PBB Media IncorporatedSally's interview with Gaby Tudor and Ineka Morrosini about being student midwives, what brought them to study midwifery, their understanding of birth, and the Southern Cross University's Midwifery Students' Society Conference on 5 May International...
https://www.facebook.com/events/1539679542992347/

Produced and presented by Sally Cusack
Copyright 2017 PBB Media and Sally Cusack
www.pbbmedia.org]]>2286birth,midwifery,midwiferystudents,sacredbirthfalsefullMoving with the Moon with Ana Davishttps://www.spreaker.com/episode/moving-with-the-moon-with-ana-davis--8191074https://api.spreaker.com/episode/8191074Wed, 06 Apr 2016 09:55:04 +0000PBB Media IncorporatedCaroline Cowley speaks with Ana Davis from Bliss Baby Yoga about her new book "Moving with the Moon: Nurturing Yoga, Movement and Meditation for every phase of your Menstrual Cycle"; about why women need their own more feminine approach to yoga to and...1732anadavis,birth,blissbabyyoga,feminine,menstruation,pregnancy,womanhood,yogafalsefullSequoia Krop from the School of Shamanic Womancrafthttps://www.spreaker.com/episode/sequoia-krop-from-the-school-of-shamanic-womancraft--8183227www.withinwoman.com.au]]>https://api.spreaker.com/episode/8183227Tue, 05 Apr 2016 11:36:15 +0000PBB Media IncorporatedSequoia Krop from Within Woman talks about travel, birth, sisterhood, and her life's calling towards Shamanic Womancraft, as well as the Red Tent Ceremony and other sacred offerings to the women of the Byron Shire. For more info www.withinwoman.com.auwww.withinwoman.com.au]]>1993redtent,shamanic,withinwoman,womancraftfalsefullYnte Kylstra on Womanhood and Motherhoodhttps://www.spreaker.com/episode/ynte-kylstra-on-womanhood-and-motherhood--8165249
Aired on 99.9 BayFM Byron Bay on 28 March 2016.

Produced and presented by Sally Cusack
Copyright 2016 PBB Media and Sally Cusack
www.pbbmedia.org]]>https://api.spreaker.com/episode/8165249Sun, 03 Apr 2016 07:46:29 +0000PBB Media IncorporatedSally's interview with local mum Ynte Kylstra on her major influences in womanhood, birth and into motherhood, including "Spiritual Midwifery" by Ina May Gaskin, Attachment Parenting by Dr William Sears, how she makes major decisions for her family,...
Aired on 99.9 BayFM Byron Bay on 28 March 2016.

Produced and presented by Sally Cusack
Copyright 2016 PBB Media and Sally Cusack
www.pbbmedia.org]]>2286birth,feminism,homebirth,homeschool,motherhoodfalsefullHope Medford on birth, music & women's well beinghttps://www.spreaker.com/episode/hope-medford-on-birth-music-women-s-well-being--8134791

Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/8134791Wed, 30 Mar 2016 07:25:39 +0000PBB Media IncorporatedLara's interview with Hope Medford; mother, midwife, solo artist, percussionist for Medicine for the People. Hope shares with us her her wisdom on birthing, the sacred feminine, her art, her music and how women can reconnect with the feminine through...

Produced and presented by Lara Martin
Copyright 2016 PBB Media and Lara Martin
www.pbbmedia.org]]>2455birth,drum,hopemedfordfalsefullMedicine Woman & Herbalist Linda Bates in her home with Annalee Atiahttps://www.spreaker.com/episode/medicine-woman-herbalist-linda-bates-in-her-home-with-annalee-atia--7951697
"plants that heal and how to use them, medicine from the garden and from the wild, plant alchemy, body alchemy, magic, love and wisdom from the earth" - are all her domain.

From a long line of women healers and of Romani Gypsy origins via England, now calling calling Australia home, she embodies the traditional wisdom of natural home-keeping and natural health-care for the family. The vital knowledge of medicine from the earth is being kept by the very few and Linda is certainly one of these.

As well as lecturing at Nature Care and the Australasian College of Natural Therapies, Linda is regularly invited to speak at Findhorn in Scotland and many other locations around the world. Linda has been teaching Herbal Medicine at its purest form. Fraging for wild herb in your environment; making tinctures and lineaments from fresh organic, wild herbs; Potency and correct dosage; and above all honouring the amazing power of herbs to support the body in its healing process.

Most Herbalists and Naturopaths today receive their herbs directly from the manufacturer, dry & in sealed pre-packaged boxes. They simply dispense a product often without cultivating a connection with the herbs themselves.

Linda believes that "A herbalist needs to take herbs and grow herbs and learn to love herbs. To familiarise all levels of your awareness with the vibrations and potential of the plants. To study herbal medicine is often only a feeding of the mind with information. It is the whole body which works with healing and so the whole body must be taught in appropriate ways what the plants are for. Grow them, feel them, smell them, nurture them, love them, thank them, pick them, eat them, drink them, thank them again."

"I am a traditional, wholistic herbalist. That is, I believe our bodies are self healing and that I am a therapist professionally trained to prescribe and dispense the plant medicines (as powerful tincture mixes) needed for the healing process; to interrupt the state of deficiency, imbalance or dis-ease and restore harmony and function."

For more about Linda's work & to find out about upcoming workshops & classes visit:

http://lindabatesherbalmedicine.com

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media, Linda Bates]]>https://api.spreaker.com/episode/7951697Tue, 08 Mar 2016 11:57:00 +0000PBB Media IncorporatedLinda Bates is a fourth-generation Master Herbalist and Medicine Woman. "plants that heal and how to use them, medicine from the garden and from the wild, plant alchemy, body alchemy, magic, love and wisdom from the earth" - are all her domain....
"plants that heal and how to use them, medicine from the garden and from the wild, plant alchemy, body alchemy, magic, love and wisdom from the earth" - are all her domain.

From a long line of women healers and of Romani Gypsy origins via England, now calling calling Australia home, she embodies the traditional wisdom of natural home-keeping and natural health-care for the family. The vital knowledge of medicine from the earth is being kept by the very few and Linda is certainly one of these.

As well as lecturing at Nature Care and the Australasian College of Natural Therapies, Linda is regularly invited to speak at Findhorn in Scotland and many other locations around the world. Linda has been teaching Herbal Medicine at its purest form. Fraging for wild herb in your environment; making tinctures and lineaments from fresh organic, wild herbs; Potency and correct dosage; and above all honouring the amazing power of herbs to support the body in its healing process.

Most Herbalists and Naturopaths today receive their herbs directly from the manufacturer, dry & in sealed pre-packaged boxes. They simply dispense a product often without cultivating a connection with the herbs themselves.

Linda believes that "A herbalist needs to take herbs and grow herbs and learn to love herbs. To familiarise all levels of your awareness with the vibrations and potential of the plants. To study herbal medicine is often only a feeding of the mind with information. It is the whole body which works with healing and so the whole body must be taught in appropriate ways what the plants are for. Grow them, feel them, smell them, nurture them, love them, thank them, pick them, eat them, drink them, thank them again."

"I am a traditional, wholistic herbalist. That is, I believe our bodies are self healing and that I am a therapist professionally trained to prescribe and dispense the plant medicines (as powerful tincture mixes) needed for the healing process; to interrupt the state of deficiency, imbalance or dis-ease and restore harmony and function."

For more about Linda's work & to find out about upcoming workshops & classes visit:

http://lindabatesherbalmedicine.com

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media, Linda Bates]]>4152herbalmedicine,lindabates,medicinewoman,naturalhealthcare,traditionalmedicinefalsefullAnnalee and Sally about Arabian Nights Fundraiserhttps://www.spreaker.com/episode/annalee-and-sally-about-arabian-nights-fundraiser--7906303
Arabian Nights Fundraiser: Honouring Birthworkers, Honouring the Feminine
Saturday 5 March 2016
Drill Hall, Mullumbimby
6:30-9pm
Min rec. age: 14 years
$20 tickets at door, or at Santos
www.facebook.com/events/766385813466293/

Aired on 99.9 BayFM Byron Bay 29 February 2016

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>https://api.spreaker.com/episode/7906303Wed, 02 Mar 2016 03:05:47 +0000PBB Media IncorporatedAnnalee and Sally speaking about the fundraiser evening for our radio show and for BayFM, why we are wanting to raise funds for the show and how our radio show project is structured. Arabian Nights Fundraiser: Honouring Birthworkers, Honouring the...
Arabian Nights Fundraiser: Honouring Birthworkers, Honouring the Feminine
Saturday 5 March 2016
Drill Hall, Mullumbimby
6:30-9pm
Min rec. age: 14 years
$20 tickets at door, or at Santos
www.facebook.com/events/766385813466293/

Aired on 99.9 BayFM Byron Bay 29 February 2016

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>395pregnancybirthandbeyondradiofalsefullAngela Fitzgerald on midwifery and women in birthhttps://www.spreaker.com/episode/angela-fitzgerald-on-midwifery-and-women-in-birth--7906069
Aired on 99.9 BayFM in Byron Bay on 29 February 2016.

//angelafitzgerald.wordpress.com/

Produced and presented by Sally Cusack
Copyright 2016 PBB Media and Sally Cusack
www.pbbmedia.org]]>https://api.spreaker.com/episode/7906069Wed, 02 Mar 2016 02:19:56 +0000PBB Media IncorporatedSally's interview with midwife Angela Fitzgerald about the issues women face in birth. Aired on 99.9 BayFM in Byron Bay on 29 February 2016. //angelafitzgerald.wordpress.com/ Produced and presented by Sally Cusack Copyright 2016 PBB Media and Sally...
Aired on 99.9 BayFM in Byron Bay on 29 February 2016.

//angelafitzgerald.wordpress.com/

Produced and presented by Sally Cusack
Copyright 2016 PBB Media and Sally Cusack
www.pbbmedia.org]]>1933birth,maternitycare,maternitysystem,midwifery,womenfalsefullDenise Love on Supporting Birthing Womenhttps://www.spreaker.com/episode/denise-love-on-supporting-birthing-women--7644299
Recorded in November 2014, aired on 99.9 BayFM on 28 December 2015

http://mummadoula.wix.com/lifeoptions-4#!__contact

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/7644299Tue, 26 Jan 2016 04:38:06 +0000PBB Media IncorporatedSally's interview with mother, grandmother and doula Denise Love about preparing to be in the birth space as a support person. Recorded in November 2014, aired on 99.9 BayFM on 28 December 2015 http://mummadoula.wix.com/lifeoptions-4#!__contact...
Recorded in November 2014, aired on 99.9 BayFM on 28 December 2015

http://mummadoula.wix.com/lifeoptions-4#!__contact

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>1184birthspace,birthsupport,doulafalsefullCsilla Tottzer on Homeschoolinghttps://www.spreaker.com/episode/csilla-tottzer-on-homeschooling--7644126www.lovelearnlive.com.au

Recorded at the Conscious Parenting and Natural Learning Conference in Byron Bay in February 2014.

Aired on 99.9 BayFM Byron Bay on 25 January 2016.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2016]]>https://api.spreaker.com/episode/7644126Tue, 26 Jan 2016 03:52:57 +0000PBB Media IncorporatedSally's interview with Csilla Tottzer, mother of 6, who homeschooled 5 of her children and wrote "Love Learn Live" about her family's experiences of home based learning. www.lovelearnlive.com.au Recorded at the Conscious Parenting and Natural...www.lovelearnlive.com.au

Recorded at the Conscious Parenting and Natural Learning Conference in Byron Bay in February 2014.

Aired on 99.9 BayFM Byron Bay on 25 January 2016.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2016]]>2110consciousparenting,homeschooling,naturallearning,parenting,unschoolingfalsefullMother and Son: A solo parenting journeyhttps://www.spreaker.com/episode/mother-and-son-a-solo-parenting-journey--7597383
Sandy says in spite of the enormous challenges of solo parenting, she has gained a great trust in her intuition, an unfailing ability to manifest whatever she wants in life, and a strong sense of independence.

She didn't get to say this on air, but Sandy also believes that looking back, finding herself alone as a parent was part of a Master Plan to transform her into a fully independent woman. And after all her years of hard work, patience and discipline, that is exactly what she has become.

She also talks about her son's Montessori education she managed to pay for and its benefits.

An overall positive view of the experience of single parenting and the power of self-belief.

Thank you for sharing your experiences with our listeners Sandy!

Aire on 99.9 BayFM Byron Bay on 18 January 2016.

Podcast edited on 21/7/2018

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www.pbbmedia.org]]>https://api.spreaker.com/episode/7597383Wed, 20 Jan 2016 00:26:26 +0000PBB Media IncorporatedSally's interview with Sandy Baxter about her experience of raising her son, now 21 yrs, on her own. Sandy says in spite of the enormous challenges of solo parenting, she has gained a great trust in her intuition, an unfailing ability to manifest...
Sandy says in spite of the enormous challenges of solo parenting, she has gained a great trust in her intuition, an unfailing ability to manifest whatever she wants in life, and a strong sense of independence.

She didn't get to say this on air, but Sandy also believes that looking back, finding herself alone as a parent was part of a Master Plan to transform her into a fully independent woman. And after all her years of hard work, patience and discipline, that is exactly what she has become.

She also talks about her son's Montessori education she managed to pay for and its benefits.

An overall positive view of the experience of single parenting and the power of self-belief.

Thank you for sharing your experiences with our listeners Sandy!

Aire on 99.9 BayFM Byron Bay on 18 January 2016.

Podcast edited on 21/7/2018

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www.pbbmedia.org]]>2551montessori,parenting,soloparentingfalsefullPrem Williams from Sacred Earth, on motherhood.https://www.spreaker.com/episode/prem-williams-from-sacred-earth-on-motherhood--7354044https://api.spreaker.com/episode/7354044Sat, 12 Dec 2015 10:09:51 +0000PBB Media IncorporatedListen to Prem Williams, from Australian Music Duo Sacred Earth, talking about motherhood, the sisterhood, relationships, music and her connection to the divine, in this interview by Caroline Cowley. Also containing inspiration for women who feel...1851creativity,mantra,motherhood,parenting,sacredearthfalsefullThe best way to Cloth Nappy; with Jannine Barronhttps://www.spreaker.com/episode/the-best-way-to-cloth-nappy-with-jannine-barron--7345916
Aired on 99.9 BayFM Byron Bay on 7 Dec 2015.

www.natureschild.com.au

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015.
www.pbbmedia.org]]>https://api.spreaker.com/episode/7345916Fri, 11 Dec 2015 03:45:58 +0000PBB Media IncorporatedSally's interview with Jannine Barron, founder of Nature's Child on cloth nappies. Aired on 99.9 BayFM Byron Bay on 7 Dec 2015. www.natureschild.com.au Produced and presented by Sally Cusack. Copyright PBB Media and Sally Cusack 2015. www.pbbmedia.org
Aired on 99.9 BayFM Byron Bay on 7 Dec 2015.

www.natureschild.com.au

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015.
www.pbbmedia.org]]>1233clothdiapers,clothnappies,ecofriendly,eliminationcommunication,parenthoodfalsefullAnnie Bryant singer storyteller "Summertime Christmas"https://www.spreaker.com/episode/annie-bryant-singer-storyteller-summertime-christmas--7344966
www.talesandsongs.com

Aired on 99.9 BayFM Byron Bay on 7 Dec 2015.

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>https://api.spreaker.com/episode/7344966Fri, 11 Dec 2015 00:20:24 +0000PBB Media IncorporatedSally's interview with Annie Bryant about ways to bring meaning to the festive season beyond just consumerism. And she performs live her new song "Summertime Christmas Song" in the studio with a small children's choir. www.talesandsongs.com Aired...
www.talesandsongs.com

Aired on 99.9 BayFM Byron Bay on 7 Dec 2015.

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>1083anniebryant,childrensmusic,christmas,storytellingfalsefullFrom Medical to Home Birth, Annalee interviews her partner Danny on fatherhood.https://www.spreaker.com/episode/from-medical-to-home-birth-annalee-interviews-her-partner-danny-on-fatherhood--7268161
We chat about the process of becoming parents, starting from the seeding event ;-) and cover his unique journey into parenthood including:

-Coming from the Medical more Managed way of thinking and transitioning into Birth Trust + Home Birth
-Doing it together, what it takes to co-create family
-Being Dad, in the 21st Century + self-care practices.

Join us for a beautiful conversation on the parenthood journey, from a fathers perspective.

Annalee

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>https://api.spreaker.com/episode/7268161Mon, 30 Nov 2015 11:02:17 +0000PBB Media IncorporatedIn today's episode, my husband and life partner, Danny has graciously agreed to come on the show and talk about his experience with fatherhood. We chat about the process of becoming parents, starting from the seeding event ;-) and cover his unique...
We chat about the process of becoming parents, starting from the seeding event ;-) and cover his unique journey into parenthood including:

-Coming from the Medical more Managed way of thinking and transitioning into Birth Trust + Home Birth
-Doing it together, what it takes to co-create family
-Being Dad, in the 21st Century + self-care practices.

Join us for a beautiful conversation on the parenthood journey, from a fathers perspective.

Annalee

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>2007childbirth,family,fatherhood,homebirth,naturalbirth,parenting,pbbmedia,pregnancyfalsefullPaul Crebar on Expectant Fatherhoodhttps://www.spreaker.com/episode/paul-crebar-on-expectant-fatherhood--7260253
Features a couple of mins of another interview with Robin Grille on the birth of his daughter. "It was like the ocean was looking at me."

Paul also talks about the imprint of fatherhood that his dedicated father has given him, what he wants to do the same, what he would do differently.

Paul also cites his most important educational resources for preparing for birth:

Films: Birth as We Know it by Elena Tonetti-Vladimirova and Birth Day by Frank Ferrel and Diana Paul

Book: Down to Earth Birth Book by Jenny Blyth

Also cites Will Smith when wondering about one of the mysteries that awaits him.

Aired on 99.9 BayFM Byron Bay, Australia on 16 November 2015.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/7260253Sat, 28 Nov 2015 21:31:29 +0000PBB Media IncorporatedSally's interview with expectant father, Paul Crebar about his hopes and expectations and the mysteries of parenthood that await him. The two main mysteries for him are in the last 10 mins! Features a couple of mins of another interview with Robin...
Features a couple of mins of another interview with Robin Grille on the birth of his daughter. "It was like the ocean was looking at me."

Paul also talks about the imprint of fatherhood that his dedicated father has given him, what he wants to do the same, what he would do differently.

Paul also cites his most important educational resources for preparing for birth:

Films: Birth as We Know it by Elena Tonetti-Vladimirova and Birth Day by Frank Ferrel and Diana Paul

Book: Down to Earth Birth Book by Jenny Blyth

Also cites Will Smith when wondering about one of the mysteries that awaits him.

Aired on 99.9 BayFM Byron Bay, Australia on 16 November 2015.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>2444birth,expectantfather,parentingfalsefullExtras: Birthing Service at Murwillumbah - continuity of care, early dischargehttps://www.spreaker.com/episode/extras-birthing-service-at-murwillumbah-continuity-of-care-early-discharge--7071258
Aired 6 November 2015
https://www.facebook.com/Friends-of-Tweed-Valley-Birthing-Service-263998260419560/?fref=ts]]>https://api.spreaker.com/episode/7071258Thu, 05 Nov 2015 22:01:51 +0000PBB Media IncorporatedRachel Bryant and Sally Cusack on ABC North Coast Radio news on Tweed Valley Birthing Service and discharge of women 4-6 hours post birth. Aired 6 November 2015 https://www.facebook.com/Friends-of-Tweed-Valley-Birthing-Service-263998260419560/?fref=ts
Aired 6 November 2015
https://www.facebook.com/Friends-of-Tweed-Valley-Birthing-Service-263998260419560/?fref=ts]]>616continuityofcare,earlydischarge,lowriskbirth,midwifery,murwillumbahbirthingfalsefullRaine Sharpe, CalmBirth & Becoming Grandmother + Jennifer Lalor on the Halprin Art/Life Process. Produced and Presented by Annalee Atia.https://www.spreaker.com/episode/raine-sharpe-calmbirth-becoming-grandmother-jennifer-lalor-on-the-halprin-art-life-process-produced-and-presented-by-annalee-atia--6889583
Jennifer Lalor is a somatic (body-based) educator and practitioner with over 17 years experience working with a diverse range of clients including executive teams, professionals, artists, and social entrepreneurs.

Jennifer had the amazing privilege of studying directly under Anna and her daughter Daria Halprin intensively in the use of the expressive arts in therapy and education before being invited onto Tamalpa’s core faculty. She taught an international student body at the Institute in California for four years before coming to live in Australia.

Raine Sharpe, a local woman, mother and grandmother. Apart from her roles as CalmBirth facilitator, midwife & doula, Raine is also a source of vital knowledge and an educator in our community. She carries with her the old knowings of birth.

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media
We call women of her calibre – Birth keepers. And I say calibre because in my mind – birth keepers are not only heroes, they are courageous being walking the earth containing a memory stick if you like, of something that has long been forgotten in western society.

Both women today herald the benefits of Somatic work, somatic knowing. That is that The Body Knows and given the opportunity it can manifest itself harmoniously.

During the program, Raine speaks of her passion for acknowledging the rite of passage of 'becoming grandmother'. She has been collecting and recording stories from grandmothers from around the world and has a book in the works about this important phase in a woman's life.

To get in touch with Raine regarding your unique story of becoming grandmother, email her at:
raines@australis.net

For CalmBirth information:

http://www.calmbirth.com.au
To find out more about Jennifer's work, visit:]]>https://api.spreaker.com/episode/6889583Thu, 22 Oct 2015 01:36:00 +0000PBB Media Incorporatedour wonderful guests today are Jennifer Lalor and Raine Sharpe. Jennifer Lalor is a somatic (body-based) educator and practitioner with over 17 years experience working with a diverse range of clients including executive teams, professionals,...
Jennifer Lalor is a somatic (body-based) educator and practitioner with over 17 years experience working with a diverse range of clients including executive teams, professionals, artists, and social entrepreneurs.

Jennifer had the amazing privilege of studying directly under Anna and her daughter Daria Halprin intensively in the use of the expressive arts in therapy and education before being invited onto Tamalpa’s core faculty. She taught an international student body at the Institute in California for four years before coming to live in Australia.

Raine Sharpe, a local woman, mother and grandmother. Apart from her roles as CalmBirth facilitator, midwife & doula, Raine is also a source of vital knowledge and an educator in our community. She carries with her the old knowings of birth.

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media
We call women of her calibre – Birth keepers. And I say calibre because in my mind – birth keepers are not only heroes, they are courageous being walking the earth containing a memory stick if you like, of something that has long been forgotten in western society.

Both women today herald the benefits of Somatic work, somatic knowing. That is that The Body Knows and given the opportunity it can manifest itself harmoniously.

During the program, Raine speaks of her passion for acknowledging the rite of passage of 'becoming grandmother'. She has been collecting and recording stories from grandmothers from around the world and has a book in the works about this important phase in a woman's life.

To get in touch with Raine regarding your unique story of becoming grandmother, email her at:
raines@australis.net

For CalmBirth information:

http://www.calmbirth.com.au
To find out more about Jennifer's work, visit:]]>1778calmbirth,embodiment,grandmothers,halprinartlifeporocess,motherhood,pbbmedia,somaticknowing,womenshealthfalsefullMum writes book about differences to support son with Autism Spectrum Disorder & change perceptions, with Misa Alexander.https://www.spreaker.com/episode/mum-writes-book-about-differences-to-support-son-with-autism-spectrum-disorder-change-perceptions-with-misa-alexander--6839223
We will be discussing the way we perceive disabilities. We will also be discussing her journey as a mother of a child diagnosed with Autism Spectrum Disability.

One of the aspects that most affect children with ASD is their ability to interact with their environment. When Misa first sent her son Hugo to pre-school she encountered first hand the effect of 'empowering his environment' – his teachers, the parents of children attending and the children themselves – to understand Hugo better and ultimately create a space where he belonged.

Since then, Misa and her dear friend Erin Knutt have been working to create a visual expression of what it looks and feels like to both be; supported by your environment and be; the support needed for children with any disability to feel connected and a part of their community.

We also spoke about the correlation between Gut Health and ADS and how treatment for her son has included testing his gut & supporting him through diet, microbial aspects and fat absorption support.

To support their inspiring project Fergus & Delilah in shaping a generation's view on disabilities go to their website:
http://fergus-delilah.com

Their Campaign runs from 30 days from the 20th of October 2015, make sure to check in during that time for best impact.

Also like them up on facebook at:
https://www.facebook.com/FergusDelilahCampaign

For further information if you are in Australia:
https://www.autismspectrum.org.au

For further information on Microbiome & gut health research in relation to Autism Spectrum Disorder visit the following research papers (free):

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3700858/
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3072352/
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC4591364/
http://www.ncbi.nlm.nih.gov/pubmed/21555957

There are many more research paper, please do your own reaserch for specific informaiton.

Thanks for tuning in,

Annalee & the pregnancy Birth & Beyond team.

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>https://api.spreaker.com/episode/6839223Wed, 14 Oct 2015 07:57:01 +0000PBB Media IncorporatedToday on the show we have a beautiful guest with us, Misa Alexander, a Canadian that calls our beloved Byron shire, home. Misa is a graphic designer and Artist who has worked around the world in various roles as a designer. She is also a mother of 3...
We will be discussing the way we perceive disabilities. We will also be discussing her journey as a mother of a child diagnosed with Autism Spectrum Disability.

One of the aspects that most affect children with ASD is their ability to interact with their environment. When Misa first sent her son Hugo to pre-school she encountered first hand the effect of 'empowering his environment' – his teachers, the parents of children attending and the children themselves – to understand Hugo better and ultimately create a space where he belonged.

Since then, Misa and her dear friend Erin Knutt have been working to create a visual expression of what it looks and feels like to both be; supported by your environment and be; the support needed for children with any disability to feel connected and a part of their community.

We also spoke about the correlation between Gut Health and ADS and how treatment for her son has included testing his gut & supporting him through diet, microbial aspects and fat absorption support.

To support their inspiring project Fergus & Delilah in shaping a generation's view on disabilities go to their website:
http://fergus-delilah.com

Their Campaign runs from 30 days from the 20th of October 2015, make sure to check in during that time for best impact.

Also like them up on facebook at:
https://www.facebook.com/FergusDelilahCampaign

For further information if you are in Australia:
https://www.autismspectrum.org.au

For further information on Microbiome & gut health research in relation to Autism Spectrum Disorder visit the following research papers (free):

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3700858/
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC3072352/
http://www.ncbi.nlm.nih.gov/pmc/articles/PMC4591364/
http://www.ncbi.nlm.nih.gov/pubmed/21555957

There are many more research paper, please do your own reaserch for specific informaiton.

Thanks for tuning in,

Annalee & the pregnancy Birth & Beyond team.

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>1570autismspectrumdisorder,changingagenerationsview,disabilities,microbiome,parenting,pbbmedia,shapingoutcomesfalsefullPearls of Parenting Wisdom: Ep. 10 Erica - The Budding of their Wingshttps://www.spreaker.com/episode/pearls-of-parenting-wisdom-ep-10-erica-the-budding-of-their-wings--6823717
Segment 10 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.luminousyouth.com

Produced and presented by Sally Cusack
Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org]]>https://api.spreaker.com/episode/6823717Mon, 12 Oct 2015 06:57:17 +0000PBB Media IncorporatedErica Nettle-Chik, mother, herbalist and founder of Luminous Youth on supporting our children as they unfold to realise their full potential as human beings. Segment 10 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from...
Segment 10 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.luminousyouth.com

Produced and presented by Sally Cusack
Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org]]>400parentingfalsefullPearls of Parenting Wisdom: Ep. 09 Zanni Louise - Fostering Creativityhttps://www.spreaker.com/episode/pearls-of-parenting-wisdom-ep-09-zanni-louise-fostering-creativity--6823333
Segment 6 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.zannilouise.com

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/6823333Mon, 12 Oct 2015 06:50:21 +0000PBB Media IncorporatedZanni Louise, mother and author on how we can foster our creativity as parents. Segment 6 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM. Aired on the CRN...
Segment 6 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.zannilouise.com

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>396creativity,motherhood,parentingfalsefullPearls of Parenting Wisdom: Ep. 08 Paulette Bray-Narai- Parenting with Compassionhttps://www.spreaker.com/episode/pearls-of-parenting-wisdom-ep-08-paulette-bray-narai-parenting-with-compassion--6822955
Segment 8 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.expresspeace.com

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/6822955Mon, 12 Oct 2015 06:40:54 +0000PBB Media IncorporatedPaulette Bray-Narai, mother and compassionate communication (NVC) instructor parenting with compassion. Segment 8 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's...
Segment 8 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.expresspeace.com

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>455communication,compassionate,nvc,parentingfalsefullPearls of Parenting Wisdom: Ep. 07 Annalee Atia - For Mothers, Building Support Around Youhttps://www.spreaker.com/episode/pearls-of-parenting-wisdom-ep-07-annalee-atia-for-mothers-building-support-around-you--6822870
Segment 7 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.annaleeatia.com

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/6822870Mon, 12 Oct 2015 06:30:16 +0000PBB Media IncorporatedAnnalee Atia, mother, presenter on "Pregnancy, Birth and Beyond Radio" and health coach on ways to build the support networks we need as parents. Segment 7 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy...
Segment 7 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.annaleeatia.com

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>409children,community,parenthood,supportfalsefullPearls of Parenting Wisdom: Ep. 06 Star Despres - Caring for Ourselveshttps://www.spreaker.com/episode/pearls-of-parenting-wisdom-ep-06-star-despres-caring-for-ourselves--6822494
Segment 6 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.divinestar.com.au

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/6822494Mon, 12 Oct 2015 05:45:45 +0000PBB Media IncorporatedStar Despres, mother and sacred rest specialist on caring for ourselves as mothers. Segment 6 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM. Aired on the CRN...
Segment 6 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.divinestar.com.au

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>346motherhood,rest,selfcare,yogafalsefullPearls of Parenting Wisdom: Ep. 05 Caroline - Life with 3 Childrenhttps://www.spreaker.com/episode/pearls-of-parenting-wisdom-ep-05-caroline-life-with-3-children--6817034
Segment 5 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

Facebook: Shakti Mum

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/6817034Mon, 12 Oct 2015 04:36:44 +0000PBB Media IncorporatedCaroline Cowley, mother, presenter on "Pregnancy, Birth and Beyond Radio" and pregnancy yoga instructor on life with three young children. Segment 5 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth...
Segment 5 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

Facebook: Shakti Mum

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>432birth,community,parenting,supportfalsefullPearls of Parenting Wisdom: Ep. 04 Annalee Atia on Intuitive + Gentle Parentinghttps://www.spreaker.com/episode/pearls-of-parenting-wisdom-ep-04-annalee-atia-on-intuitive-gentle-parenting--6813298
Segment 4 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

Facebook: BIRTH Love with Certified Health Coach Annalee

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/6813298Mon, 12 Oct 2015 02:46:38 +0000PBB Media IncorporatedAnnalee Atia, mother, presenter on "Pregnancy, Birth and Beyond Radio" and health coach on intuitive and gentle parenting. Segment 4 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio...
Segment 4 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

Facebook: BIRTH Love with Certified Health Coach Annalee

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>432birth,intuition,motherhood,parentingfalsefullPearls of Parenting Wisdom: Ep. 03 Jannine Barron - Caring for our Earthhttps://www.spreaker.com/episode/pearls-of-parenting-wisdom-ep-03-jannine-barron-caring-for-our-earth--6811089
Segment 3 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.natureschild.com.au

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/6811089Mon, 12 Oct 2015 02:08:35 +0000PBB Media IncorporatedJannine Barron, founder of Nature's Child on caring for our earth as we care for our children. Segment 3 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM. Aired...
Segment 3 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.natureschild.com.au

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>480birth,eco-parenting,parenting,pregnancyfalsefullPearls of Parenting Wisdom: Ep. 02 Darren Mattock - Preparing for Fatherhoodhttps://www.spreaker.com/episode/pearls-of-parenting-wisdom-ep-02-darren-mattock-preparing-for-fatherhood--6806323
Segment 2 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.becomingdad.com.au

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/6806323Sun, 11 Oct 2015 21:07:52 +0000PBB Media IncorporatedDarren Mattock, founder of Becoming Dad on preparing for fatherhood. Segment 2 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM. Aired on the CRN Aug-Sept 2015....
Segment 2 from the 10 part series "Pearls of Parenting Wisdom" created by Sally Cusack from "Pregnancy Birth and Beyond" Radio on Byron Bay's BayFM.
Aired on the CRN Aug-Sept 2015.

www.becomingdad.com.au

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>444birth,fatherhoodfalsefullPearls of Parenting Wisdom: Ep. 01 Lara Martin - Preparing for Birth + Series Previewhttps://www.spreaker.com/episode/pearls-of-parenting-wisdom-ep-01-lara-martin-preparing-for-birth-series-preview--6800946
www.consciousbirth.com

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>https://api.spreaker.com/episode/6800946Sun, 11 Oct 2015 08:55:48 +0000PBB Media IncorporatedLara Martin, mother, doula, broadcaster and childbirth educator on preparing for birth. www.consciousbirth.com Copyright 2015 PBB Media and Sally Cusack All rights reserved. www.pbbmedia.org
www.consciousbirth.com

Copyright 2015 PBB Media and Sally Cusack
All rights reserved.
www.pbbmedia.org
]]>324birth,parentingfalsefullMonica Elliott on cravings during her pregnancieshttps://www.spreaker.com/episode/monica-elliott-on-cravings-during-her-pregnancies--6745489
Sincerest thanks to Ros for the recording, and to Monica for sharing her experiences.

Aired on BayFM on 5 October 2015

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015.
www.pbbmedia.org]]>https://api.spreaker.com/episode/6745489Mon, 05 Oct 2015 09:37:43 +0000PBB Media IncorporatedMonica Elliott, mother of Ros Elliott from Go Earthcare show on BayFM, shares her experiences with cravings during pregnancy over 60 years ago. Sincerest thanks to Ros for the recording, and to Monica for sharing her experiences. Aired on BayFM on 5...
Sincerest thanks to Ros for the recording, and to Monica for sharing her experiences.

Aired on BayFM on 5 October 2015

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015.
www.pbbmedia.org]]>510cravings,pregnancyfalsefullPatricia Edmonds PART 2 Home Birth Midwifery & morehttps://www.spreaker.com/episode/patricia-edmonds-part-2-home-birth-midwifery-more--6745347
Part 1 here:
http://www.spreaker.com/user/pregnancybirthandbeyond/patricia-edmonds-on-use-of-ultrasounds-i

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>https://api.spreaker.com/episode/6745347Mon, 05 Oct 2015 08:39:08 +0000PBB Media IncorporatedPart 2 of Sally's interview with Patricia Edmonds, American homebirth midwife about midwifery, continuity of care and much more. Recorded at Byron Bay in November 2014, aired on BayFM on 5 Oct 2015. Part 1 here:...
Part 1 here:
http://www.spreaker.com/user/pregnancybirthandbeyond/patricia-edmonds-on-use-of-ultrasounds-i

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>1059birth,homebirth,midwiferyfalsefullNicole Moore on the limbic imprint and our olfactory senseshttps://www.spreaker.com/episode/nicole-moore-on-the-limbic-imprint-and-our-olfactory-senses--6745094

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/6745094Mon, 05 Oct 2015 06:14:28 +0000PBB Media IncorporatedNicole Moore from Birth into Being Australia on the impact of smells in our early life and how we carry them into our adult lives, as well as for a mother and baby to bond. Produced and presented by Sally Cusack. Copyright PBB Media and Sally Cusack...

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>599birth,limbicimprintfalsefullPatricia Edmonds on use of ultrasounds in pregnancy Pt1https://www.spreaker.com/episode/patricia-edmonds-on-use-of-ultrasounds-in-pregnancy-pt1--6740042
Part 2 here: http://www.spreaker.com/user/pregnancybirthandbeyond/patriciaedmondspart2of2-20150928

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/6740042Sun, 04 Oct 2015 08:10:22 +0000PBB Media IncorporatedPart one of Sally's two part interview with Patricia Edmonds, homebirth midwife from the US about the role of technology such as ultrasounds during pregnancy and their perceived benefits. Aired on 99.9 BayFM on 28 September 2015. Part 2 here:...
Part 2 here: http://www.spreaker.com/user/pregnancybirthandbeyond/patriciaedmondspart2of2-20150928

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>1477birth,intervention,medical,pregnancy,ultrasoundfalsefullNicole Moore on emotional healing with waterhttps://www.spreaker.com/episode/nicole-moore-on-emotional-healing-with-water--6739827Refs:
http://birthintobeing.com.au/nicole-moore/
Call to Conscious Birth video: https://vimeo.com/91479892

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>https://api.spreaker.com/episode/6739827Sun, 04 Oct 2015 05:38:50 +0000PBB Media IncorporatedSally's interview with Nicole about the use of water in healing from past traumas and 'recoding' our limbic imprint. Aired on BayFM on 28 September 2015. Refs: http://birthintobeing.com.au/nicole-moore/ Call to Conscious Birth video:...Refs:
http://birthintobeing.com.au/nicole-moore/
Call to Conscious Birth video: https://vimeo.com/91479892

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>560birth,birthtrauma,healingfrombirth,limbicimprint,waterfalsefullCaroline interviews Jody Vassallo about Balancing The Busyhttps://www.spreaker.com/episode/caroline-interviews-jody-vassallo-about-balancing-the-busy--6661192
Produced and presented by Caroline Cowley
Copyright PBB Media and Caroline Cowley 2015
www.pbbmedia.org]]>https://api.spreaker.com/episode/6661192Tue, 22 Sep 2015 10:24:52 +0000PBB Media IncorporatedJody Vassallo talks about Balancing The Busy, a Womens Health Conference on Oct 10 2015 in Bangalow, NSW, Australia, featuring Dr Libby Weaver as keynote speaker. Produced and presented by Caroline Cowley Copyright PBB Media and Caroline Cowley 2015...
Produced and presented by Caroline Cowley
Copyright PBB Media and Caroline Cowley 2015
www.pbbmedia.org]]>2225health,motherhood,womanhood,womenshealthfalsefullBone Broth and its healing little miracles with Angela and Tamihttps://www.spreaker.com/episode/bone-broth-and-its-healing-little-miracles-with-angela-and-tami--6594400
Bone Broth has been around for millennia & its miracles known to many. From grandmothers & mothers to physicians & healers, bone broth has been & still is, a staple in the diet of many cultures. In the west, and since the industrial revolution theer has been a loss of tradition in the area of slow food & home cooking in general.

We look at Bone broth, its many benefits, recipes & other information in this delicious episode.

Links:
http://www.soulfullbroth.com
https://www.facebook.com/SoulfullBroths

Links to research discussed:
1. Moses Maimonides on Asthma - http://thorax.bmj.com/content/36/4/245.full.pdf
2. Weston A Price foundation on Bone Broth - http://www.westonaprice.org/health-topics/broth-is-beautiful/
3. Glutamine & the microbime - http://www.westonaprice.org/uncategorized/can-broth-help-us-maintain-a-healthy-weight-a-study-on-glutamine-and-the-microbiome-suggests-it/

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>https://api.spreaker.com/episode/6594400Tue, 08 Sep 2015 04:40:34 +0000PBB Media IncorporatedIn this episode, Annalee speaks with Angela Snow & Tamar Dubb from Soulfull Broths about the benefits of brothing. Bone Broth has been around for millennia & its miracles known to many. From grandmothers & mothers to physicians & healers, bone...
Bone Broth has been around for millennia & its miracles known to many. From grandmothers & mothers to physicians & healers, bone broth has been & still is, a staple in the diet of many cultures. In the west, and since the industrial revolution theer has been a loss of tradition in the area of slow food & home cooking in general.

We look at Bone broth, its many benefits, recipes & other information in this delicious episode.

Links:
http://www.soulfullbroth.com
https://www.facebook.com/SoulfullBroths

Links to research discussed:
1. Moses Maimonides on Asthma - http://thorax.bmj.com/content/36/4/245.full.pdf
2. Weston A Price foundation on Bone Broth - http://www.westonaprice.org/health-topics/broth-is-beautiful/
3. Glutamine & the microbime - http://www.westonaprice.org/uncategorized/can-broth-help-us-maintain-a-healthy-weight-a-study-on-glutamine-and-the-microbiome-suggests-it/

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>1641autoimmune,bonebroth,microbiome,nutrition,paleo,pbbmedia,traditionalfoodfalsefullShayla Plosko and Ritchie Male Student Midwifehttps://www.spreaker.com/episode/shayla-plosko-and-ritchie-male-student-midwife--6568920https://www.change.org/p/health-minister-revise-outdated-hospital-policies

From 26:55 we also have a follow up interview with male student midwife and dad Ritchie. We first met Ritchie earlier this year when we played his interview recorded at the Midwifery Today Conference in Byron Bay in November 2014. Ritchie is an officer in the navy and is looking to make the career transformation to homebirth midwifery next year.
Recorded via Skype from Singapore, so please excuse the sound quality.
First interviews with Ritchie at: http://www.spreaker.com/user/pregnancybirthandbeyond/student-male-midwife-part-1-of-2

Interviews aired on 99.9 BayFM on 10 Aug 2015

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/6568920Wed, 02 Sep 2015 06:53:25 +0000PBB Media IncorporatedSally's interview with Shayla Plosko, mum from Canberra who started a petition to have maternity services policies and procedures updated according to latest research. This is in response to what she describes as being her son's unnecessarily...https://www.change.org/p/health-minister-revise-outdated-hospital-policies

From 26:55 we also have a follow up interview with male student midwife and dad Ritchie. We first met Ritchie earlier this year when we played his interview recorded at the Midwifery Today Conference in Byron Bay in November 2014. Ritchie is an officer in the navy and is looking to make the career transformation to homebirth midwifery next year.
Recorded via Skype from Singapore, so please excuse the sound quality.
First interviews with Ritchie at: http://www.spreaker.com/user/pregnancybirthandbeyond/student-male-midwife-part-1-of-2

Interviews aired on 99.9 BayFM on 10 Aug 2015

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>2687birth,homebirth,hospital,intervention,midwiferyfalsefullMurwillumbah Birth Service Update and Jane Hardwicke Collingshttps://www.spreaker.com/episode/murwillumbah-birth-service-update-and-jane-hardwicke-collings--6560192
Sally's update on campaign to reinstate birthing services at Murwillumbah Hospital
and
at 7:45 mins her interview with independent homebirth midwife and teacher of women's mysteries Jane Hardwicke Collings. Topics include how each rite of passage a woman goes through informs the next rite of passage, eg from menarche to birth to peri-menopause and menopause, benefits of preparing for each rite of passage to be open to the change and learn from each experience.

More info on Jane: www.moonsong.com.au

References: "The Wisdom of Menopause" by Dr Christiane Northrup, "Being Born" by Robyn Fernance and maieutic (Socratic) method of midwifery, Dr Sharon Maloney, Qld, re. connection between menstrual shame and difficulties in birth.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/6560192Mon, 31 Aug 2015 10:22:52 +0000PBB Media IncorporatedAired on 99.9 BayFM on 31 Aug 2015. Sally's update on campaign to reinstate birthing services at Murwillumbah Hospital and at 7:45 mins her interview with independent homebirth midwife and teacher of women's mysteries Jane Hardwicke Collings....
Sally's update on campaign to reinstate birthing services at Murwillumbah Hospital
and
at 7:45 mins her interview with independent homebirth midwife and teacher of women's mysteries Jane Hardwicke Collings. Topics include how each rite of passage a woman goes through informs the next rite of passage, eg from menarche to birth to peri-menopause and menopause, benefits of preparing for each rite of passage to be open to the change and learn from each experience.

More info on Jane: www.moonsong.com.au

References: "The Wisdom of Menopause" by Dr Christiane Northrup, "Being Born" by Robyn Fernance and maieutic (Socratic) method of midwifery, Dr Sharon Maloney, Qld, re. connection between menstrual shame and difficulties in birth.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>2153birth,hospital,menopause,menstruation,midwiferyfalsefullCaroline Cowley with Anna Watts - Spiritual Birthinghttps://www.spreaker.com/episode/caroline-cowley-with-anna-watts-spiritual-birthing--6531061https://api.spreaker.com/episode/6531061Tue, 25 Aug 2015 11:17:48 +0000PBB Media IncorporatedCaroline Cowley interviews Anna Watts, Child Birth Educator, Doula Trainer and Spiritual Healer on Spiritual Birthing and the Sacred Feminine. Midway through the episode, Anna also shares a beautiful meditation for connecting with your baby, or sacred...2007falsefullReine DuBois on Integrative Medicine, The Health Lodge + Naturopathy during Pregnancy & Labourhttps://www.spreaker.com/episode/reine-dubois-on-integrative-medicine-the-health-lodge-naturopathy-during-pregnancy-labour--6505602
Founding Byron Integrated Medicine in 2010 & working alongside Integrative Medicine Doctors, Psychologists, Acupuncturists & a whole host of other complementary medicine practitioners, she has been leading her teams to create a safe haven for clients.

A vision to create a dedicated space to explore the true nature of a client’s health concerns & seeing them through to recovery & a deeper understanding of their condition is the force behind her enterprise.

To find out more about Reine's work, visit:
http://www.byronintegratedmedicine.com.au
http://www.thehealthlodge.com.au

Interview originally recorded at Bay FM, Byron Bay, Australia
Live to Air on 99.9FM on the 17th August 2015.

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>https://api.spreaker.com/episode/6505602Wed, 19 Aug 2015 10:27:34 +0000PBB Media IncorporatedThis week Annalee speaks with a very special guest. A woman pioneering in the field of Integrated Medicine, a director of a renowned health care practice & the weaver of a new concept in health care. Reine DuBois, is a dedicated local Naturopath &...
Founding Byron Integrated Medicine in 2010 & working alongside Integrative Medicine Doctors, Psychologists, Acupuncturists & a whole host of other complementary medicine practitioners, she has been leading her teams to create a safe haven for clients.

A vision to create a dedicated space to explore the true nature of a client’s health concerns & seeing them through to recovery & a deeper understanding of their condition is the force behind her enterprise.

To find out more about Reine's work, visit:
http://www.byronintegratedmedicine.com.au
http://www.thehealthlodge.com.au

Interview originally recorded at Bay FM, Byron Bay, Australia
Live to Air on 99.9FM on the 17th August 2015.

Produced and Presented by Annalee Atia for PBB Media

Copyright Annalee Atia, PBB Media]]>1870annaleeatia,familyhealthcare,functionalmedicine,integrativemedicine,naturopathy,pbbmedia,pregnancy,reineduboisfalsefullWorld Breastfeeding Week with Juliana Zago and Caroline Cowleyhttps://www.spreaker.com/episode/world-breastfeeding-week-with-juliana-zago-and-caroline-cowley--6485490
This year, WABA calls for:
~ Concerted global action to support women to combine breastfeeding and work, whether in the formal sector, non-formal sector, or at home
~ Ratification and implementation of maternity protection laws and regulations by governments, in line with the ILO Maternity Protection Convention
~ Inclusion of breastfeeding target indicators in the Sustainable Development Goals (SDGs)

Supporting Breastfeeding is a particular passion of mine. I am a strong advocate for the benefits of breastfeeding & I have long understood the significance of breastfeeding in creating a healthy & happy society. This episodes features two mothers Juliana Zago and Caroline Cowley.

If you would like to find out more about WBW; where you can learn how to support women during this period & as a woman, where you can get support:

Australian Breastfeeding Association (look up your local branch): https://www.breastfeeding.asn.au

World Breastfeeding Week official website:
http://worldbreastfeedingweek.org

For breastfeeding support within Australia call anytime: 1300mum2mum

For questions about our show, please email us at hello@pbbmedia.org
Produced and Presented by Annalee Atia.
www.pbbmedia.org]]>https://api.spreaker.com/episode/6485490Fri, 14 Aug 2015 02:50:31 +0000PBB Media IncorporatedThis week its World Breastfeeding Week & the focus is on women returning to the workforce (formally & informally) whilst still breastfeeding. This year, WABA calls for: ~ Concerted global action to support women to combine breastfeeding and work,...
This year, WABA calls for:
~ Concerted global action to support women to combine breastfeeding and work, whether in the formal sector, non-formal sector, or at home
~ Ratification and implementation of maternity protection laws and regulations by governments, in line with the ILO Maternity Protection Convention
~ Inclusion of breastfeeding target indicators in the Sustainable Development Goals (SDGs)

Supporting Breastfeeding is a particular passion of mine. I am a strong advocate for the benefits of breastfeeding & I have long understood the significance of breastfeeding in creating a healthy & happy society. This episodes features two mothers Juliana Zago and Caroline Cowley.

If you would like to find out more about WBW; where you can learn how to support women during this period & as a woman, where you can get support:

Australian Breastfeeding Association (look up your local branch): https://www.breastfeeding.asn.au

World Breastfeeding Week official website:
http://worldbreastfeedingweek.org

For breastfeeding support within Australia call anytime: 1300mum2mum

For questions about our show, please email us at hello@pbbmedia.org
Produced and Presented by Annalee Atia.
www.pbbmedia.org]]>1879breastfeeding,childbirth,motherhood,parenting,pbbmedia,waba2015,womenintheworkforce,womenshealth,womenswellbeingfalsefullCaroline Cowley with Lisa Fitzpatrick on Motherhood As Transformationhttps://www.spreaker.com/episode/caroline-cowley-with-lisa-fitzpatrick-on-motherhood-as-transformation--6422224
If you'd like to find out more about Lisa and her work you can go to www.lisafitzpatrick.com.au]]>https://api.spreaker.com/episode/6422224Thu, 30 Jul 2015 04:34:38 +0000PBB Media IncorporatedCaroline Cowley interviews Lisa Fitzpatrick, from Sacred Women's Business on the topic of Motherhood As Transformation, examining motherhood as a Rite of Passage for women. If you'd like to find out more about Lisa and her work you can go to...
If you'd like to find out more about Lisa and her work you can go to www.lisafitzpatrick.com.au]]>2222motherhood,pregnancybirth&beyond,ritesofpassage,sacredwomensbusiness,soulpurposefalsefullAnnalee Atia with Debby Rayfield, Homeopathy & Antimicrobial Resistancehttps://www.spreaker.com/episode/annalee-atia-with-debby-rayfield-homeopathy-antimicrobial-resistance--6412143
Specialising in Child and Family Healthcare, Debbie is a practitioner of homeopathy and naturopathic nutrition with over 25 years of practical experience, as well as a registered nurse and a qualified Montessori teacher.

Links for Debbie Rayfield's work:

1. http://debbierayfield.com

2. http://www.fountaincentre.com.au/natural-therapies-practitioners/debbie-rayfield-homeopath/

Links for Microbial Resistance information:

1. University of Minnesota, Academic Health Center. "Infant antibiotic use linked to adult diseases." ScienceDaily. ScienceDaily, 13 May 2015:www.sciencedaily.com/releases/2015/05/150513140929.htm

2. WHO facts on Antimicrobial resistance:
http://www.who.int/mediacentre/factsheets/fs194/en/

3. The Guardian - a genuine threat:
http://www.theguardian.com/society/2013/jul/12/chief-scientist-antibiotic-resistance-warning
&
http://www.theguardian.com/society/2015/jun/02/australian-government-to-crack-down-on-antibiotic-overuse-in-humans-and-animals

4. Australia's National Anti-microbial Resistance Strategy, published June 2015:
http://www.health.gov.au/internet/main/publishing.nsf/Content/ohp-amr.htm]]>https://api.spreaker.com/episode/6412143Tue, 28 Jul 2015 10:12:54 +0000PBB Media IncorporatedAnnalee Atia speaks with Debbie Rayfield about Homeopathy during pregnancy, birth & early childhood. Specialising in Child and Family Healthcare, Debbie is a practitioner of homeopathy and naturopathic nutrition with over 25 years of practical...
Specialising in Child and Family Healthcare, Debbie is a practitioner of homeopathy and naturopathic nutrition with over 25 years of practical experience, as well as a registered nurse and a qualified Montessori teacher.

Links for Debbie Rayfield's work:

1. http://debbierayfield.com

2. http://www.fountaincentre.com.au/natural-therapies-practitioners/debbie-rayfield-homeopath/

Links for Microbial Resistance information:

1. University of Minnesota, Academic Health Center. "Infant antibiotic use linked to adult diseases." ScienceDaily. ScienceDaily, 13 May 2015:www.sciencedaily.com/releases/2015/05/150513140929.htm

2. WHO facts on Antimicrobial resistance:
http://www.who.int/mediacentre/factsheets/fs194/en/

3. The Guardian - a genuine threat:
http://www.theguardian.com/society/2013/jul/12/chief-scientist-antibiotic-resistance-warning
&
http://www.theguardian.com/society/2015/jun/02/australian-government-to-crack-down-on-antibiotic-overuse-in-humans-and-animals

4. Australia's National Anti-microbial Resistance Strategy, published June 2015:
http://www.health.gov.au/internet/main/publishing.nsf/Content/ohp-amr.htm]]>1747antibiotics,antimicrobialresistance,birth,homeopathy,pregnancyfalsefullRites of Passage with Tamara Newlands and Natural Learning with Dudley Leggetthttps://www.spreaker.com/episode/rites-of-passage-with-tamara-newlands-and-natural-learning-with-dudley-leggett--6407683Refs: tamaranewlands.com and doctorarne.com

And Dudley Leggett, co-founder of Dharamananda Community and Sustainability Research Institute about natural learning and models for families living in community.
www.sustainable-research.org
infinitechoices.com.au conference - 1-3 October 2015

Aired on BayFM on 27 July 2015

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>https://api.spreaker.com/episode/6407683Mon, 27 Jul 2015 10:35:05 +0000PBB Media IncorporatedSally's interview with Tamara Newlands facilitator of Rites of Passage to Womanhood Camp about the importance of acknowledging rites of passage for young women. Refs: tamaranewlands.com and doctorarne.com And Dudley Leggett, co-founder of...Refs: tamaranewlands.com and doctorarne.com

And Dudley Leggett, co-founder of Dharamananda Community and Sustainability Research Institute about natural learning and models for families living in community.
www.sustainable-research.org
infinitechoices.com.au conference - 1-3 October 2015

Aired on BayFM on 27 July 2015

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>2473environmentalism,parenting,ritesofpassage,sustainableliving,womanhoodfalsefullZiggy Alberts on Homeschoolinghttps://www.spreaker.com/episode/ziggy-alberts-on-homeschooling--6407623Other refs: "Live Learn Love" by his mother Csilla Totzer
Aired on BayFM on 13 July 2015

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>https://api.spreaker.com/episode/6407623Mon, 27 Jul 2015 10:12:29 +0000PBB Media IncorporatedSally's interview with local musician and free surfer Ziggy Alberts (ziggyalberts.com) about his homeschooling experiences with his family until he was 13 years old. Other refs: "Live Learn Love" by his mother Csilla Totzer Aired on BayFM on 13 July...Other refs: "Live Learn Love" by his mother Csilla Totzer
Aired on BayFM on 13 July 2015

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>1783alberts,homeschool,ziggyfalsefullAnnalee Atia with Dr Lauren Tober, Highly Sensitive Personhttps://www.spreaker.com/episode/annalee-atia-with-dr-lauren-tober-highly-sensitive-person--6323724
The links we discuss on the show are:

Dr Lauren Tober's website - www.laurentober.com
Capturing Gratitude - www.capturinggratitude.com
Dr Elaine Aron's website - www.hsperson.com
Dr Neff's Ted Talk - http://tedxtalks.ted.com/video/The-Space-Between-Self-Esteem-a]]>https://api.spreaker.com/episode/6323724Wed, 08 Jul 2015 10:32:29 +0000PBB Media IncorporatedAnnalee Atia interviews Dr Lauren Tober on the Highly Sensitive Person. HSPs comprise approximately 20% of the population & their unique trait affords them greater insight & attunement. Dr Tober discusses living as an HPS & familiarising yourself with...
The links we discuss on the show are:

Dr Lauren Tober's website - www.laurentober.com
Capturing Gratitude - www.capturinggratitude.com
Dr Elaine Aron's website - www.hsperson.com
Dr Neff's Ted Talk - http://tedxtalks.ted.com/video/The-Space-Between-Self-Esteem-a]]>1712highsensitivity,hsp,pregnanybirthandbeyond,seflcare,sensitivechildrenfalsefullThe state of maternity services in Northern NSWhttps://www.spreaker.com/episode/the-state-of-maternity-services-in-northern-nsw--6310870With thanks to Carolyn Hastie and Rachel Bryant.

To find out more: go to www.facebook.com/pages/Friends-of-Tweed-Valley-Birthing-Service/

and

www.facebook.com/groups/FriendsofNNSWLHDBirthingServices

How are maternity services in your area? We'd love to hear from you!

And you can make your voice heard at:
nnswlhd.health.nsw.gov.au/about/northern-nsw-local-health-district/complaints-and-compliments/

Aired at 99.9 BayFM on 29 June 2015

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>https://api.spreaker.com/episode/6310870Sun, 05 Jul 2015 09:38:54 +0000PBB Media IncorporatedSally Cusack on the state of maternity services in the Northern NSW Local Health District. In 2009 national health reforms led to the signing of the National Maternity Services Plan (NMSP), which obliged the implementation of midwifery-led continuity...With thanks to Carolyn Hastie and Rachel Bryant.

To find out more: go to www.facebook.com/pages/Friends-of-Tweed-Valley-Birthing-Service/

and

www.facebook.com/groups/FriendsofNNSWLHDBirthingServices

How are maternity services in your area? We'd love to hear from you!

And you can make your voice heard at:
nnswlhd.health.nsw.gov.au/about/northern-nsw-local-health-district/complaints-and-compliments/

Aired at 99.9 BayFM on 29 June 2015

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>2418birth,continuityofmidwiferyledcare,hospital,maternity,maternityadvocacyfalsefullPaulette Bray-Narai on NVC and parentinghttps://www.spreaker.com/episode/paulette-bray-narai-on-nvc-and-parenting--6275683www.expresspeace.com
www.cnvc.org
Marshall Rosenberg's Book "Non-Violent Communication"
Aired on 99.9 BayFM on 15 June 2015

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015.
www.pbbmedia.org]]>https://api.spreaker.com/episode/6275683Sat, 27 Jun 2015 11:53:27 +0000PBB Media IncorporatedSally's interview with local certified Non-Violent Communication instructor, Paulette Bray-Narai about NVC and its value in parenting. www.expresspeace.com www.cnvc.org Marshall Rosenberg's Book "Non-Violent Communication" Aired on 99.9 BayFM on 15...www.expresspeace.com
www.cnvc.org
Marshall Rosenberg's Book "Non-Violent Communication"
Aired on 99.9 BayFM on 15 June 2015

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015.
www.pbbmedia.org]]>1821communication,nonviolent,nvc,parentingfalsefullAnnalee with Sarah Armstrong on "His Other House"https://www.spreaker.com/episode/annalee-with-sarah-armstrong-on-his-other-house--6185311www.sarah-armstrong.com]]>https://api.spreaker.com/episode/6185311Mon, 08 Jun 2015 08:40:59 +0000PBB Media IncorporatedAnnalee Atia's interview with Sarah Armstrong on how her own personal experiences with IVF, gentle, respectful c-section and aware parenting informed her characters in her new novel "His Other House". Aired on 99.9 BayFM on 8 June 2015....www.sarah-armstrong.com]]>1770aware,c-section,gentle,ivf,parentingfalsefullZanni Louise on creativity for parentshttps://www.spreaker.com/episode/zanni-louise-on-creativity-for-parents--6177166Zannilouise.com
mylittlesunshinehouse.com
Aired on 99.9 BayFM on 1 June 2015

Motherhood and Creativity: The Divided Heart by Rachel Powers, featuring conversations with some of Australia’s most prominent female artists like Rachel Griffiths and Clare Bowditch
http://rachel-power.blogspot.com.au/

The North Coast Creative Business Women’s Community - a closed Facebook group for connection and inspiration https://www.facebook.com/groups/creativebusinesswomen/

Mama Creative: Interviews with women who balance creativity with motherhood on My Little Sunshine House blog: http://mylittlesunshinehouse.com/category/mama-creative/

Meet Me At Mikes: a blog by Pip Lincoln who is a very creative mother. She’s also written a book called “Craft for the Soul" http://meetmeatmikes.com/

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/6177166Sat, 06 Jun 2015 08:53:09 +0000PBB Media IncorporatedImportance of parents expressing their creativity and tips for doing so. Zannilouise.com mylittlesunshinehouse.com Aired on 99.9 BayFM on 1 June 2015 Motherhood and Creativity: The Divided Heart by Rachel Powers, featuring conversations with some of...Zannilouise.com
mylittlesunshinehouse.com
Aired on 99.9 BayFM on 1 June 2015

Motherhood and Creativity: The Divided Heart by Rachel Powers, featuring conversations with some of Australia’s most prominent female artists like Rachel Griffiths and Clare Bowditch
http://rachel-power.blogspot.com.au/

The North Coast Creative Business Women’s Community - a closed Facebook group for connection and inspiration https://www.facebook.com/groups/creativebusinesswomen/

Mama Creative: Interviews with women who balance creativity with motherhood on My Little Sunshine House blog: http://mylittlesunshinehouse.com/category/mama-creative/

Meet Me At Mikes: a blog by Pip Lincoln who is a very creative mother. She’s also written a book called “Craft for the Soul" http://meetmeatmikes.com/

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>1408blogging,creativity,motherhood,parenting,writingfalsefullSally with Erica NettleChik - Creating Luminous Youthhttps://www.spreaker.com/episode/sally-with-erica-nettlechik-creating-luminous-youth--6113583http://www.luminousyouth.com/events.html
Refs: Nassim Harramein, Robin Grille, Bruce Lipton, Anastasia and the Ringing Cedar Series, Lucy Cavendish, Heart Math Institute

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>https://api.spreaker.com/episode/6113583Sun, 24 May 2015 04:56:12 +0000PBB Media IncorporatedSally's interview with Erica Nettle-Chik on the work of mums to create luminous youth, how we need to develop our intuition for raising our children, as we are the experts in what they need. http://www.luminousyouth.com/events.html Refs: Nassim...http://www.luminousyouth.com/events.html
Refs: Nassim Harramein, Robin Grille, Bruce Lipton, Anastasia and the Ringing Cedar Series, Lucy Cavendish, Heart Math Institute

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>1488ittakesavillage,motherhood,parentingfalsefullCaroline Cowley with Star Despres + Annalee Atia on Self Carehttps://www.spreaker.com/episode/caroline-cowley-with-star-despres-annalee-atia-on-self-care--6092750www.divinestar.com.au
Annalee Atia on why mothers aren't inclined to care for themselves, ancient cultures and what they do.
Ref: bluezones.com on longevity and happiness

Produced and presented by Caroline Cowley
Copyright PBB Media and Caroline Cowley 2016
www.pbbmedia.org]]>https://api.spreaker.com/episode/6092750Tue, 19 May 2015 21:42:47 +0000PBB Media IncorporatedCaroline's interview with Star Despres about self care for women. www.divinestar.com.au Annalee Atia on why mothers aren't inclined to care for themselves, ancient cultures and what they do. Ref: bluezones.com on longevity and happiness Produced...www.divinestar.com.au
Annalee Atia on why mothers aren't inclined to care for themselves, ancient cultures and what they do.
Ref: bluezones.com on longevity and happiness

Produced and presented by Caroline Cowley
Copyright PBB Media and Caroline Cowley 2016
www.pbbmedia.org]]>1924care,health,mothers,self,womenfalsefullRobbie Davis Floydhttps://www.spreaker.com/episode/robbie-davis-floyd--6029005
Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/6029005Wed, 06 May 2015 01:48:11 +0000PBB Media IncorporatedAired live 27th April 2015, from the heart of Byron Bay at Bay Fm 99.9. Robbie Davis-Floyd, PhD, Senior Research Fellow, Dept. of Anthropology, University of Texas Austin, and Fellow of the Society for Applied Anthropology, is a medical...
Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>1699birth,homebirth,midwifery,pregnancy,robbiedavisfloydfalsefullIn Celebration of Publicly Funded Homebirthhttps://www.spreaker.com/episode/in-celebration-of-publicly-funded-homebirth--6019793

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015

Link: http://nnswlhd.health.nsw.gov.au/about/hospitals/mullumbimby-district-war-memorial-hospital/mullumbimby-birth-centre/the-home-birth-program/

Other: Birth Afloat birthing pools]]>https://api.spreaker.com/episode/6019793Mon, 04 May 2015 10:55:53 +0000PBB Media IncorporatedTo mark the 3rd anniversary of commencement of Mullumbimby Community Birthing Service's Homebirth Programme, Sally's interview with midwife Debra Hayhoe and local mother Bridget Perry. Aired on 99.9 BayFM on Monday 4 May 2015. Produced and...

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015

Link: http://nnswlhd.health.nsw.gov.au/about/hospitals/mullumbimby-district-war-memorial-hospital/mullumbimby-birth-centre/the-home-birth-program/

Other: Birth Afloat birthing pools]]>1811birth,homebirth,midwiferyfalsefullMichel Odent on the Foetal Ejection Reflex - Entire Interviewhttps://www.spreaker.com/episode/michel-odent-on-the-foetal-ejection-reflex-entire-interview--5978444
0-6 mins - Introduction
6 min - Interview commences
15 min - Natural childbirth advocates and medical view have been working to short term criteria of emphasis on live mother and baby at the end of the process, but he calls for us to expand our view to take into account longer term impacts of interventions.

18:30 min - Hormones of childbirth

20 min - Lack of general understanding of birth physiology and the needs of the labouring woman. Need to ask "what are the needs of the labouring woman, and not simply promote natural childbirth. We need to think "like physiologists" and identify possible inhibitory factors. Key word - to "protect" the natural process.

24:30 - Our powerful neo-cortex and how it inhibits our birth process if engaged and active.

27:30 - Human sense of smell is stronger than we realise and is inhibited by the neo-cortex.

29:30 Need reduced neo-cortical activity to give birth.

31 min - How to reduce neo-cortical activity (eg be in dark)

35 min - Our cultural conditioning of "helping" the labouring woman - where there is an active role necessarily played by someone else, not the woman, which is disempowering for her. Socialisation of birth started in Neolithic times.

37 min - Paleolithic women probably isolated themselves, so our cultural conditioning is around 10,000 years old.

45 min - Turning 85 yrs this year and feels he is running out of time so must speak directly about these issues and not worry about being politically correct.

48 min - Our fear of birth started during Neolithic times when women saw other women giving birth and built up culture around experts and helpers needing to attend birthing women, whereas Paleolithic women probably did it alone, ie their behaviour not observed so story couldn't build up around what they did when birthing.

49 min - most women experience disturbed birth. Authentic midwifery needs to set up optimal conditions for foetal ejection reflex to occur. Difficulty for women is that when they birth instinctively their behaviour can be culturally unacceptable for those present.

57 min - 1970 footage of Papua New Guinean woman giving birth alone. Her mother helps her set up birth space then moves away for the actual moment of birth.

1:01 min - "Support" is the most toxic word as it gives women the idea that they can only do it with the help of others. Urgent need to reconsider words we use and look at using words like "protection" instead.

1:06 - Natural childbirth advocates and medical practioners alike interfere with natural childbirth process by using words like "Support".

1:07 - Newborns need love, microbes and stress - what is meant by stress. Impacts on pre-labour caesarean babies.

1:13 - We need to study babies born without labour and those born with labour (and born either vaginally or by C/s)

1:14 - Swedish study into sense of smell on newborns - comparison between babies born vaginally or by C/S. The sense of smell is 'switched on' by noradrenalin, a hormone produced by the baby in labour and it is needed to help a baby find the nipple.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/5978444Sat, 25 Apr 2015 11:02:13 +0000PBB Media IncorporatedSally's complete interview with retired French obstetrician Michel Odent and 'protector' of the labouring woman's natural process (or "foetus ejection reflex"). Recorded 30 March 2015. 0-6 mins - Introduction 6 min - Interview commences 15 min -...
0-6 mins - Introduction
6 min - Interview commences
15 min - Natural childbirth advocates and medical view have been working to short term criteria of emphasis on live mother and baby at the end of the process, but he calls for us to expand our view to take into account longer term impacts of interventions.

18:30 min - Hormones of childbirth

20 min - Lack of general understanding of birth physiology and the needs of the labouring woman. Need to ask "what are the needs of the labouring woman, and not simply promote natural childbirth. We need to think "like physiologists" and identify possible inhibitory factors. Key word - to "protect" the natural process.

24:30 - Our powerful neo-cortex and how it inhibits our birth process if engaged and active.

27:30 - Human sense of smell is stronger than we realise and is inhibited by the neo-cortex.

29:30 Need reduced neo-cortical activity to give birth.

31 min - How to reduce neo-cortical activity (eg be in dark)

35 min - Our cultural conditioning of "helping" the labouring woman - where there is an active role necessarily played by someone else, not the woman, which is disempowering for her. Socialisation of birth started in Neolithic times.

37 min - Paleolithic women probably isolated themselves, so our cultural conditioning is around 10,000 years old.

45 min - Turning 85 yrs this year and feels he is running out of time so must speak directly about these issues and not worry about being politically correct.

48 min - Our fear of birth started during Neolithic times when women saw other women giving birth and built up culture around experts and helpers needing to attend birthing women, whereas Paleolithic women probably did it alone, ie their behaviour not observed so story couldn't build up around what they did when birthing.

49 min - most women experience disturbed birth. Authentic midwifery needs to set up optimal conditions for foetal ejection reflex to occur. Difficulty for women is that when they birth instinctively their behaviour can be culturally unacceptable for those present.

57 min - 1970 footage of Papua New Guinean woman giving birth alone. Her mother helps her set up birth space then moves away for the actual moment of birth.

1:01 min - "Support" is the most toxic word as it gives women the idea that they can only do it with the help of others. Urgent need to reconsider words we use and look at using words like "protection" instead.

1:06 - Natural childbirth advocates and medical practioners alike interfere with natural childbirth process by using words like "Support".

1:07 - Newborns need love, microbes and stress - what is meant by stress. Impacts on pre-labour caesarean babies.

1:13 - We need to study babies born without labour and those born with labour (and born either vaginally or by C/s)

1:14 - Swedish study into sense of smell on newborns - comparison between babies born vaginally or by C/S. The sense of smell is 'switched on' by noradrenalin, a hormone produced by the baby in labour and it is needed to help a baby find the nipple.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>4641birth,ceasarean,intervention,paleo,prelabourfalsefullHannah Dahlen-epigenetics and birthhttps://www.spreaker.com/episode/hannah-dahlen-epigenetics-and-birth--5943903http://www.hannahdahlen.com.au/ Aired 13 April 2015.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/5943903Sat, 18 Apr 2015 06:36:44 +0000PBB Media IncorporatedEpigenetic impacts of birth interventions on our species, what women need to give birth, experiences with midwifery in hospital and home with Hannah Dahlen. http://www.hannahdahlen.com.au/ Aired 13 April 2015. Produced and presented by Sally...http://www.hannahdahlen.com.au/ Aired 13 April 2015.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>1688birth,epigenetics,epiic,midwiferyfalsefullExtras: History of PBB Radio + Dedication to Larahttps://www.spreaker.com/episode/extras-history-of-pbb-radio-dedication-to-lara--5943799https://api.spreaker.com/episode/5943799Sat, 18 Apr 2015 05:48:15 +0000PBB Media IncorporatedAs we embark on our 10th season (we'll be 5 yrs old in November), we give you a history of our show and farewell and dedication to Lara Martin, who has been with our show for nearly 4 years. Thank you Lara! www.consciousbirth.com Aired 13 April 2015744birth,parenting,pregnancy,radiofalsefullAnnie Bryant storytelling for childrenhttps://www.spreaker.com/episode/annie-bryant-storytelling-for-children--5917558www.talesandsongs.com

Produced and presented by Annalee Atia.
Copyright PBB Media and Annalee Atia 2015]]>https://api.spreaker.com/episode/5917558Sun, 12 Apr 2015 23:00:20 +0000PBB Media IncorporatedAnnie Bryant talking about her new album for Autumn 2015 "Seek and Find" and the power of story telling for children, and creating with our children. www.talesandsongs.com Produced and presented by Annalee Atia. Copyright PBB Media and Annalee Atia 2015www.talesandsongs.com

Produced and presented by Annalee Atia.
Copyright PBB Media and Annalee Atia 2015]]>693children,storytellingfalsefullAn active neocortex: The greatest risk in birth with Michel Odenthttps://www.spreaker.com/episode/an-active-neocortex-the-greatest-risk-in-birth-with-michel-odent--5914835
Sally's complete interview with Michel is here: https://www.spreaker.com/user/pregnancybirthandbeyond/michel-odent-entire-interview-30-mar2015

www.wombecology.com

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/5914835Sun, 12 Apr 2015 09:35:05 +0000PBB Media IncorporatedFrench obstetrician Michel Odent on the disruptive role that the neocortext can plan in birth. The biggest risk to a woman giving birth naturally is from her neocortex, and not being able to disengage from it. Sally's complete interview with Michel...
Sally's complete interview with Michel is here: https://www.spreaker.com/user/pregnancybirthandbeyond/michel-odent-entire-interview-30-mar2015

www.wombecology.com

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>1152birth,birthrisk,michel,neocortex,odentfalsefullGail Tully - Spinning Babieshttps://www.spreaker.com/episode/gail-tully-spinning-babies--5851823
Produced and presented by Lara Martin
Copyright 2015 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/5851823Mon, 30 Mar 2015 04:39:22 +0000PBB Media IncorporatedGail Tully of Spinning Babies joins us for the Pregnancy Birth and Beyond Radio program. Interview took place at the November 2014 Midwifery Today held in Byron Bay Australia. Interview aired live on 99.9 Bay Fm - Byron's community station, 23rd of...
Produced and presented by Lara Martin
Copyright 2015 PBB Media and Lara Martin
www.pbbmedia.org]]>2096birth,midwifery,midwiferytoday,naturalbirth,pregnancy,spinningbabiesfalsefullAustralian Bush Flower Essences for Health and Wellbeinghttps://www.spreaker.com/episode/australian-bush-flower-essences-for-health-and-wellbeing--5838854http://www.thefloweringsoul.com/

Produced and presented by Lara Martin
Copyright 2015 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/5838854Fri, 27 Mar 2015 07:07:30 +0000PBB Media IncorporatedJewelli of The Flowering Soul joins us live in the BayFm 99.9 studio March 9th 2015. Hear about how Australian bush flower essence can benefit the growth and well being of you and your family. http://www.thefloweringsoul.com/ Produced and presented...http://www.thefloweringsoul.com/

Produced and presented by Lara Martin
Copyright 2015 PBB Media and Lara Martin
www.pbbmedia.org]]>1254bushfloweressence,floweressence,flowersfalsefullDr. Sarah Buckley on Birth Hormoneshttps://www.spreaker.com/episode/dr-sarah-buckley-on-birth-hormones--5752236
Hormones of birth with Dr Sarah Buckley
'Physiological' birth with Scandinavian midwife Tine Greve
Interviews recorded at Midwifery Today Conference Nov 2014 Byron Bay

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/5752236Mon, 09 Mar 2015 02:19:24 +0000PBB Media IncorporatedPBB Radio's contribution to Australia's Community Radio Network's broadcast for International Women's Day 2015 - aired Sunday 8 March 2015. Hormones of birth with Dr Sarah Buckley 'Physiological' birth with Scandinavian midwife Tine Greve Interviews...
Hormones of birth with Dr Sarah Buckley
'Physiological' birth with Scandinavian midwife Tine Greve
Interviews recorded at Midwifery Today Conference Nov 2014 Byron Bay

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>3350birth,drsarahbuckley,tinegrevefalsefullSister MorningStar on birth traditionshttps://www.spreaker.com/episode/sister-morningstar-on-birth-traditions--5689457http://www.midwiferytoday.com/articles/whocounts.asp

Produced and presented by Lara Martin
Copyright 2015 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/5689457Mon, 23 Feb 2015 22:49:04 +0000PBB Media IncorporatedAired live 9-02-2015 from Bay Fm 99.9 Byron's community station. Listen to Sister MorningStar, Cherokee daughter, shares her and her people's wisdom and traditions from midwifery to early childhood. "Sister MorningStar has dedicated a lifetime to...http://www.midwiferytoday.com/articles/whocounts.asp

Produced and presented by Lara Martin
Copyright 2015 PBB Media and Lara Martin
www.pbbmedia.org]]>1513birth,cherokee,midwifery,mothering,pregnancyfalsefullFrom Midwife to Mother with Danie Smallwoodhttps://www.spreaker.com/episode/from-midwife-to-mother-with-danie-smallwood--5673378
First part of this recording is a review of VDay Byron Bay's performance of Vagina Monologues, including a brief recording from the birth monologue.

Then final part of (part 3 of 3) interview with a male student midwife. See parts 1 and 2 with our other recent episodes.
(Part 1: https://www.spreaker.com/user/pregnancybirthandbeyond/student-male-midwife-part-1-of-2)
(Part 2: https://www.spreaker.com/user/4527888/male-student-midwife-part-2-of-3)

Then interview with Danie.

Related links:
www.vdaybyronbay.com.au
"The Aware Baby" book by Aletha Solter, PhD.

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www.pbbmedia.org]]>https://api.spreaker.com/episode/5673378Fri, 20 Feb 2015 08:35:42 +0000PBB Media IncorporatedSally's interview with Danie Smallwood, local midwife of 3 yrs, becoming a mother, how this experience may be changing her perspectives as a midwife. First part of this recording is a review of VDay Byron Bay's performance of Vagina Monologues,...
First part of this recording is a review of VDay Byron Bay's performance of Vagina Monologues, including a brief recording from the birth monologue.

Then final part of (part 3 of 3) interview with a male student midwife. See parts 1 and 2 with our other recent episodes.
(Part 1: https://www.spreaker.com/user/pregnancybirthandbeyond/student-male-midwife-part-1-of-2)
(Part 2: https://www.spreaker.com/user/4527888/male-student-midwife-part-2-of-3)

Then interview with Danie.

Related links:
www.vdaybyronbay.com.au
"The Aware Baby" book by Aletha Solter, PhD.

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www.pbbmedia.org]]>2030midwifery,motherhood,vaginamonologuesfalsefullRitchie's Journey to Midwiferyhttps://www.spreaker.com/episode/ritchie-s-journey-to-midwifery--5652537
Follow up interview 6 months later here: http://www.spreaker.com/user/pregnancybirthandbeyond/shayla-plosko-and-ritchie-male-student-m

And interview with Ritchie's wife Grace about their third child's birth here:
https://www.spreaker.com/user/4527888/grace-unleashed-birthing-differently-this-time

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015.
www.pbbmedia.org]]>https://api.spreaker.com/episode/5652537Mon, 16 Feb 2015 04:09:53 +0000PBB Media IncorporatedSally's interview with US Naval officer turned student midwife, about fatherhood, his second child's VBAC birth and his upcoming career change. Recorded at Midwifery Today Conference in Byron in November 2014. Aired 19 Jan, 2 Feb and 16 Feb 2015 on...
Follow up interview 6 months later here: http://www.spreaker.com/user/pregnancybirthandbeyond/shayla-plosko-and-ritchie-male-student-m

And interview with Ritchie's wife Grace about their third child's birth here:
https://www.spreaker.com/user/4527888/grace-unleashed-birthing-differently-this-time

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015.
www.pbbmedia.org]]>1619malemidwife,studentmidwife,vbacfalsefullVBAC and stalled labour with midwife Deborah McGillivrayhttps://www.spreaker.com/episode/vbac-and-stalled-labour-with-midwife-deborah-mcgillivray--5648537
Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>https://api.spreaker.com/episode/5648537Sun, 15 Feb 2015 04:38:28 +0000PBB Media IncorporatedInterview with Deborah McGillivray from familymidwives.com.au about her VBAC practice and the gentle, on again, off again nature of VBAC labour. Recorded at Midwifery Today Conf. 2014 and aired on 19 Jan2015. Produced and presented by Sally Cusack...
Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>553vbacfalsefullMale Student Midwife Part 2 of 3https://www.spreaker.com/episode/male-student-midwife-part-2-of-3--5648497
Part 3 here (approx 5 mins in): https://www.spreaker.com/user/pregnancybirthandbeyond/danie-smallwoodmidwife-becoming-a-mother

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/5648497Sun, 15 Feb 2015 04:22:42 +0000PBB Media IncorporatedPart 2 of Sally's interview with a male student midwife, about how becoming a father has inspired him to study midwifery, particularly homebirth midwifery. Aired on 2 Feb 2015. Part 3 here (approx 5 mins in):...
Part 3 here (approx 5 mins in): https://www.spreaker.com/user/pregnancybirthandbeyond/danie-smallwoodmidwife-becoming-a-mother

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>384fatherhood,midwiferyfalsefullTigress Yoga for Intuition with Claudine von Niederhausernhttps://www.spreaker.com/episode/tigress-yoga-for-intuition-with-claudine-von-niederhausern--5627494
(Note BayFM experienced some transmitter disruption that day, which can be heard slightly in the early part of this interview only.)

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/5627494Tue, 10 Feb 2015 12:03:55 +0000PBB Media IncorporatedSally's interview with Claudine, Tigress Yoga instructor about TY and how she taps into her intuition as a mother and a woman. (Note BayFM experienced some transmitter disruption that day, which can be heard slightly in the early part of this...
(Note BayFM experienced some transmitter disruption that day, which can be heard slightly in the early part of this interview only.)

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>688feminine,intuition,motherhood,tigress,womanhood,yogafalsefullMale Student Midwife Part 1 of 3https://www.spreaker.com/episode/male-student-midwife-part-1-of-3--5587405
Part 2 here: http://www.spreaker.com/user/pregnancybirthandbeyond/male-student-midwife-part-2-of-3

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www.pbbmedia.org]]>https://api.spreaker.com/episode/5587405Sun, 01 Feb 2015 02:33:00 +0000PBB Media IncorporatedSally's interview with student male midwife about his wife's VBAC experience that ignited an interest in him to change careers from being an officer in the US Navy to midwifery. Recorded at Midwifery Today Conference in Byron Bay November 2014....
Part 2 here: http://www.spreaker.com/user/pregnancybirthandbeyond/male-student-midwife-part-2-of-3

Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2016
www.pbbmedia.org]]>755malemidwifefalsefullRachel Reed Midwife Thinkinghttps://www.spreaker.com/episode/rachel-reed-midwife-thinking--5473888

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin 2015
www.pbbmedia.org]]>https://api.spreaker.com/episode/5473888Mon, 12 Jan 2015 13:55:52 +0000PBB Media IncorporatedAired live from 99.9 Bay Fm, in the heart of Byron Bay. During the Australia HomeBirth Conference 2014 I was able to catch up with Rachel Reed, author of the popular birth blog 'Midwife Thinking'. Rites of Passage, QLD cesarean rates and more....

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin 2015
www.pbbmedia.org]]>1462birth,homebirth,midwifery,pregnancy,rachelreedfalsefullScarlet Lewis Chooses Love for her Son Jesse Lewishttps://www.spreaker.com/episode/scarlet-lewis-chooses-love-for-her-son-jesse-lewis--5473744
Produced and presented by Lara Martin
Copyright 2015 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/5473744Mon, 12 Jan 2015 13:02:34 +0000PBB Media IncorporatedAired live Dec 15th 2015, 99.9 Bay Fm. During the 2014 December Uplift Festival I was able to catch up with Scarlet Lewis, Author of Nurturing, Healing, Love: A Mother’s Journey of Hope and Forgiveness. Hear from her the pain and wisdom that came...
Produced and presented by Lara Martin
Copyright 2015 PBB Media and Lara Martin
www.pbbmedia.org]]>1190forgiveness,love,parenting,scarletlewisfalsefullThe Teachings of the Goddesses with Kerrihttps://www.spreaker.com/episode/the-teachings-of-the-goddesses-with-kerri--5473664
Produced and presented by Lara Martin
Copyright 2015 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/5473664Mon, 12 Jan 2015 12:23:42 +0000PBB Media IncorporatedAired live 12 - 1 - 2015 from the heart of Byron Bay at 99.9 Bay Fm. On today's show we talk with Kerri - founder of The Goddess of Sacred Sex. We hear all about the Goddess and how these ancient mythological women have powerful teachings for women...
Produced and presented by Lara Martin
Copyright 2015 PBB Media and Lara Martin
www.pbbmedia.org]]>1944goddesses,inanna,women,womenmysteries,womenwellbeingfalsefullMaternity services at new Byron Hospitalhttps://www.spreaker.com/episode/maternity-services-at-new-byron-hospital--5441761

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>https://api.spreaker.com/episode/5441761Tue, 06 Jan 2015 08:46:08 +0000PBB Media IncorporatedInterview by Sally and Samaya Nicholls-Askill from Mullumbimby Aust Breastfeeding Association with Jenny Shaw from NNSW Local Health District about the move of the maternity services at Mullumbimby Hospital to the new Byron hospital site in 2016....

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2015]]>2849birth,hospital,maternityadvocacyfalsefullDr Sarah Buckley on Birth Hormoneshttps://www.spreaker.com/episode/dr-sarah-buckley-on-birth-hormones--5440304
www.sarahbuckley.com

Produced and Presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www,pbbmedia.org]]>https://api.spreaker.com/episode/5440304Tue, 06 Jan 2015 01:33:39 +0000PBB Media IncorporatedSally's interview with Dr Sarah Buckley at the Midwifery Today Conference in Byron Bay in November 2014. Here she talks about the main hormones of birth and childrearing, breastfeeding, and how they equate to the hormonal interactions of sexual...
www.sarahbuckley.com

Produced and Presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www,pbbmedia.org]]>1402birth,hormones,induction,oxytocinfalsefullWhat does meconium in the waters really mean with Rachel Reedhttps://www.spreaker.com/episode/what-does-meconium-in-the-waters-really-mean-with-rachel-reed--5436394
Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>https://api.spreaker.com/episode/5436394Mon, 05 Jan 2015 07:56:18 +0000PBB Media IncorporatedSally's interview with Dr Rachel Reed regarding health issues for babies when their amniotic sacs break at the end of pregnancy and the fluid is stained with meconium (baby's first bowel movement). Recorded at the Midwifery Today Conference in Byron...
Produced and presented by Sally Cusack
Copyright PBB Media and Sally Cusack 2015
www.pbbmedia.org]]>2137amniotic,birth,birthrisk,fluid,induction,intervention,meconium,pregnancyfalsefullEmbodied birth with Maha Al Musahttps://www.spreaker.com/episode/embodied-birth-with-maha-al-musa--1903991
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2012.
PBBmedia.org]]>https://api.spreaker.com/episode/1903991Sun, 21 Dec 2014 07:06:00 +0000PBB Media IncorporatedWednesday the 19th of December 2012, Maha Al Musa founder of Belly Dance For Birth & Author of Dance of the Womb was in the studio talking all things belly dance and birth. Maha was also recently featured in Australia's Women's Day Magazine and on...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2012.
PBBmedia.org]]>2102bellydancebirth,birth,breastfeeding,embodiedbirth,labour,mahaalmusa,motherhood,pregnancyfalsefullEcoParenting: Saving the world one baby at a time.https://www.spreaker.com/episode/ecoparenting-saving-the-world-one-baby-at-a-time--5326917
All things eco parenting in a nutshell. - Nappies, Diapers, cloth diapers, organic and how you can "be the change you want to see in the world."

Aired live November 17th 2014 from Bay Fm 99.9 Byron's community station.

Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org
Photo credit: Ingrid Pullen Photography]]>https://api.spreaker.com/episode/5326917Mon, 08 Dec 2014 21:39:53 +0000PBB Media IncorporatedEco Parenting with Jannine Barron of Natures Child that started in Byron Bay 15 years ago. All things eco parenting in a nutshell. - Nappies, Diapers, cloth diapers, organic and how you can "be the change you want to see in the world." Aired...
All things eco parenting in a nutshell. - Nappies, Diapers, cloth diapers, organic and how you can "be the change you want to see in the world."

Aired live November 17th 2014 from Bay Fm 99.9 Byron's community station.

Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org
Photo credit: Ingrid Pullen Photography]]>1972clotherdiapers,clothnappies,ecoparenting,natureschild,oragnicbabyfalsefullDarren Mattock founder of Becoming Dadhttps://www.spreaker.com/episode/darren-mattock-founder-of-becoming-dad--3690557
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/3690557Mon, 01 Dec 2014 00:05:00 +0000PBB Media IncorporatedOn the Pregnancy Birth and Beyond show we had guest Darren Mattock in the studio talking all things Becoming Dad and birth preparation for fathers. Aired live on 99.9 Bay fm 20th Nov 2013 from the heart of Byron Bay. Produced and presented by Lara...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
www.pbbmedia.org]]>1892birth,childbirth,dads,fatherhood,parentingfalsefullMoana Pearl on the Red Tenthttps://www.spreaker.com/episode/moana-pearl-on-the-red-tent--1724983
Presenter Lara Martin
Copyright PBB Media and Lara Martin 2012
www.pbbmedia.org]]>https://api.spreaker.com/episode/1724983Sun, 09 Nov 2014 02:48:00 +0000PBB Media IncorporatedLara's interview with Moana Pearl about the 'red tent'. Features music from Maryen Cairns from her Red Tent album. Presenter Lara Martin Copyright PBB Media and Lara Martin 2012 www.pbbmedia.org
Presenter Lara Martin
Copyright PBB Media and Lara Martin 2012
www.pbbmedia.org]]>2201redtent,redtentfestival,womanhoodfalsefullPregnancy, still birth & infant losshttps://www.spreaker.com/episode/pregnancy-still-birth-infant-loss--5131802
Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/5131802Mon, 27 Oct 2014 02:39:32 +0000PBB Media IncorporatedEach year in Australia, close to 800 babies die within the first 28 days of their birth, almost 2000 babies are stillborn and over 147,000 miscarries occur. In the studio 20-10-2014 two mothers join me to share their story of stillbirth. Ten years...
Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>2727stillbirthfalsefullLara Martin on Birthing From Withinhttps://www.spreaker.com/episode/lara-martin-on-birthing-from-within--3475885
Guest Lara Martin consciousbirth.com
Produced and presented by Taneal Cadou-Blake
Copyright PBB Media and Lara Martin

PBBmedia.org]]>https://api.spreaker.com/episode/3475885Sat, 18 Oct 2014 21:53:00 +0000PBB Media IncorporatedThis week on the Pregnancy Birth and Beyond show we hear about BFW, Birth as a Rite of Passage and the labyrinth as a symbol for labour, birth and postpartum, also fathers and partners support in birth. Aired live on bayfm 99.9 16th of Oct 2013....
Guest Lara Martin consciousbirth.com
Produced and presented by Taneal Cadou-Blake
Copyright PBB Media and Lara Martin

PBBmedia.org]]>1759birhtingfromwithin,birth,childbirtheducation,pregnancyfalsefullMidwifery Today Conference Byron Bayhttps://www.spreaker.com/episode/midwifery-today-conference-byron-bay--5049256
Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/5049256Tue, 07 Oct 2014 01:32:24 +0000PBB Media IncorporatedAired live from 99.9 fm Byron Bay community station, 6th October 2014. Sue Cookson joins us in the studio talking all things the Midwifery Today Conference being held in Byron Bay Australia, November 2014. Produced and presented by Lara Martin...
Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>1631birth,homebirth,midwiferytodayfalsefullMothers in Business/ Baba Slinghttps://www.spreaker.com/episode/mothers-in-business-baba-sling--3385928
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org]]>https://api.spreaker.com/episode/3385928Mon, 29 Sep 2014 00:15:00 +0000PBB Media IncorporatedAired live 25th of September 2013. In the Bay fm 99.9 Byron Bay Australia studio we had guest Shanti, mother of 5 and founder of Baba Slings discussing baby wearing and mothers in business. Shanti shares with us how her baby wearing business got...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org]]>1711baba sling,baby wearing,mothers,pregnancyfalsefullJane Hardwicke Collingshttps://www.spreaker.com/episode/jane-hardwicke-collings--5014942www.moonsong.com.au

Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/5014942Sat, 27 Sep 2014 23:46:32 +0000PBB Media IncorporatedOn the Pregnancy Birth & Beyond Radio show aired live 8th of September 2014, from 99.9 Bay Fm in Byron Bay AU. We have an interview with Jane Hardwicke Collings. Here, Jane shares with us her wisdom on women's moon mysteries, birth as a rite of...www.moonsong.com.au

Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>2160birth,childbirth,mothering,pregnancy,ritesofpassagefalsefullThe art of children's story tellinghttps://www.spreaker.com/episode/the-art-of-children-s-story-telling--4998904and
Healing Stories for Challenging Behaviour (2008)
and numerous children's story books.

Susan Shares with us how parents can support their young children through life changes through the simple art of story telling and more...
www.susanperrow.com

Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/4998904Tue, 23 Sep 2014 21:39:33 +0000PBB Media IncorporatedAired live 11th of August from 99.9 Bay FM Byron Bay's community station. This week on the Pregnancy Birth and Beyond program we had guest Susan Perrow, world class story teller, author of "Therapeutic Storytelling: 101 Healing Stories for Children...and
Healing Stories for Challenging Behaviour (2008)
and numerous children's story books.

Susan Shares with us how parents can support their young children through life changes through the simple art of story telling and more...
www.susanperrow.com

Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>1628mothering,parenting,pottytraining,storytellerfalsefullBreast-feeding & Hypnobirthing with Michelle Walkerhttps://www.spreaker.com/episode/breast-feeding-hypnobirthing-with-michelle-walker--3355026
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org]]>https://api.spreaker.com/episode/3355026Sun, 21 Sep 2014 23:26:00 +0000PBB Media IncorporatedMichelle Walker - mother, lactation consultant, doula, parent team social worker and hypno-birthing instructor joins us on the Pregnancy Birth & Beyond show streamed live from Bay fm 99.9 Byron Bay local community station 31st of July 2013. In honor...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org]]>2094birth,extended breastfeeding,hypnobirthing,pregnancyfalsefullSocial worker Simon on fathering after seperationhttps://www.spreaker.com/episode/social-worker-simon-on-fathering-after-seperation--3316791
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org]]>https://api.spreaker.com/episode/3316791Sat, 13 Sep 2014 21:17:00 +0000PBB Media IncorporatedAustralia, Byron Bay Local Bayfm 99.9 community radio 2013. This week on the Pregnancy Birth & Beyond show we interviewed Simon from the Family center on fatherhood and issues that arise for single dads. Produced and presented by Lara Martin...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org]]>1441fathers,parenting,parentingafterseperation,pregnancyfalsefullAntonella Gambotto-Burkehttps://www.spreaker.com/episode/antonella-gambotto-burke--4819414
++++++++++

Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin]]>https://api.spreaker.com/episode/4819414Tue, 05 Aug 2014 21:32:03 +0000PBB Media IncorporatedAired live, 28th of July 2014, from the 99.9 Bay Fm studio's in the heart of Byron Bay Australia. Our guest today on the Pregnancy Birth and Beyond show Antonella Gambotto-Burke, Author of Mama: Dispatches from the Frontline of Love. We talk all...
++++++++++

Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin]]>1877attachmentparenting,motherhood,parenting,pregnancyfalsefullDo the kegel with Laura Doehttps://www.spreaker.com/episode/do-the-kegel-with-laura-doe--4816580
Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/4816580Tue, 05 Aug 2014 02:21:45 +0000PBB Media IncorporatedAired live 19th of May 2014 from the Bay Fm Community Radio station in the heart of Byron Bay Australia. Laura Doe founder of Yoniversity in the studio talking all things the pelvic floor wellness for women, the kegel exercise and womens' sexual...
Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>2186birth,incontinence,kegel,mothering,pelvicfloor,sexualhealthfalsefullWater Birthhttps://www.spreaker.com/episode/water-birth--2969462
Guest website: www.birthafloat.com

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org]]>https://api.spreaker.com/episode/2969462Mon, 14 Jul 2014 03:04:00 +0000PBB Media IncorporatedAired live 8th of May in the Bayfm studio's Byron Bay 2013. Our guest Maureen, founder of Birth Afloat shares with us all about the wonders of Water Birth at home and at hospital. "Water - The Gentle Journey For You & Your Baby" Guest website:...
Guest website: www.birthafloat.com

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org]]>1522birthafloat,childbirth,waterbirthfalsefullTara Singh On Raising A Conscious Childhttps://www.spreaker.com/episode/tara-singh-on-raising-a-conscious-child--2965240
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org

Born 1919 in India, Tara Singh spent the early years of his life in a small village in Punjab. From this sheltered environment his family then traveled and lived in Europe and Central America. At 22, his search for the truth led him to the Himalayas where he lived for four years as an ascetic. He became more and more removed from worldly affairs and devoted several years of his life to the study and practice of yoga. The discipline imparted through yoga helped make possible a three-year period of silent retreat in California in the early 1970s.
  As he emerged from the years of silence in 1976, he came into contact with the contemporary scripture A Course in Miracles. Its impact on him was profound. He recognized it “as an answer to man's urgent need for direct contact with truth.” There followed a close relationship with its scribe. From then on, the Course was the focal point of his life. Known for the wisdom he freely imparted, he will also be remembered for the virtue of a noble life and the lasting friendship he openly extended to all he met. Tara Singh passed away in 2006 at the age of 87. Sourced from the Joseph plan foundation.
visit us at www.facebook.com/pregnancybirthandbeyondradio]]>https://api.spreaker.com/episode/2965240Sun, 13 Jul 2014 02:56:00 +0000PBB Media IncorporatedOn today's show we have very special recording to share of Tara Singh on How to raise a child of God. Aired live 2013. Produced and presented by Lara Martin Copyright PBB Media and Lara Martin PBBmedia.org Born 1919 in India, Tara Singh...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org

Born 1919 in India, Tara Singh spent the early years of his life in a small village in Punjab. From this sheltered environment his family then traveled and lived in Europe and Central America. At 22, his search for the truth led him to the Himalayas where he lived for four years as an ascetic. He became more and more removed from worldly affairs and devoted several years of his life to the study and practice of yoga. The discipline imparted through yoga helped make possible a three-year period of silent retreat in California in the early 1970s.
  As he emerged from the years of silence in 1976, he came into contact with the contemporary scripture A Course in Miracles. Its impact on him was profound. He recognized it “as an answer to man's urgent need for direct contact with truth.” There followed a close relationship with its scribe. From then on, the Course was the focal point of his life. Known for the wisdom he freely imparted, he will also be remembered for the virtue of a noble life and the lasting friendship he openly extended to all he met. Tara Singh passed away in 2006 at the age of 87. Sourced from the Joseph plan foundation.
visit us at www.facebook.com/pregnancybirthandbeyondradio]]>1539falsefullGirls Rights of passage and Birth Storyhttps://www.spreaker.com/episode/girls-rights-of-passage-and-birth-story--2964325
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org]]>https://api.spreaker.com/episode/2964325Sat, 12 Jul 2014 23:14:00 +0000PBB Media IncorporatedOn the Pregnancy Birth and Beyond show we hear from Amriata Hoobs on the importance of honoring girls rights of passage. Second half of the show we hear the trails and tribulations of a gay woman trying to conceive and the joy of finally giving birth...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org]]>1808amritahobbs,girlhood,girlsritesofpassage,ritesofpassagefalsefullWhat is Calm Birth with Peter Jackson and Karen McCoyhttps://www.spreaker.com/episode/what-is-calm-birth-with-peter-jackson-and-karen-mccoy--4700396
Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>https://api.spreaker.com/episode/4700396Sun, 06 Jul 2014 21:51:24 +0000PBB Media IncorporatedDuring the 2014 Australian Home Birth Conference I was able to catch up with Peter Jackson founder of Calm Birth and his daughter Karen McCoy midwife and calm birth educator. Aired lived on Bay fm 99.9 Byron Bay's community station June 30th of 2014....
Produced and presented by Lara Martin
Copyright 2014 PBB Media and Lara Martin
www.pbbmedia.org]]>1161birth,calmbirth,pregnancyfalsefullAnnie Bryant Children's musichttps://www.spreaker.com/episode/annie-bryant-children-s-music--4700334
Guest: Annie Bryant.
Presenter & Producer: Lara Martin
Date: 2014]]>https://api.spreaker.com/episode/4700334Sun, 06 Jul 2014 21:29:17 +0000PBB Media IncorporatedAnnie was in our Pregnancy Birth and Beyond studio discussing her latest EP. "Come Gather: Tales & songs to warm young hearts". Aired live June 30th 2014. Guest: Annie Bryant. Presenter & Producer: Lara Martin Date: 2014
Guest: Annie Bryant.
Presenter & Producer: Lara Martin
Date: 2014]]>532childrensmusic,steinerfalsefullDr Andrew Bisits & VBAC motherhttps://www.spreaker.com/episode/dr-andrew-bisits-vbac-mother--4700292Known for his advocating for women's childbirth choices particularly when it comes to vaginal breech birth and other "deemed high risk" women such as VBAC. Also in the studio with have Lismore Maternity Choices branch president Sophie, who as a mother experienced for her first baby's birth an emergency cesarean when it was discovered at 8 centimeters dilation her baby was in frank breech position and her second baby was birthed as what is called a VBAC vaginal birth after cesarean.
Interview with Dr Andrew Bisits held at the Australian Home Birth Conference February 2014 and aired live on Bay Fm 99.9 Byron's community station 16th of June 2014.

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2014.
PBBmedia.org]]>https://api.spreaker.com/episode/4700292Sun, 06 Jul 2014 21:14:12 +0000PBB Media IncorporatedDr Andrew Bisits, staff specialist obstetrics working in in Obstetrics for 30 years and Director of Obstetrics at the Sydney's Royal Hospital for Women. Known for his advocating for women's childbirth choices particularly when it comes to vaginal...Known for his advocating for women's childbirth choices particularly when it comes to vaginal breech birth and other "deemed high risk" women such as VBAC. Also in the studio with have Lismore Maternity Choices branch president Sophie, who as a mother experienced for her first baby's birth an emergency cesarean when it was discovered at 8 centimeters dilation her baby was in frank breech position and her second baby was birthed as what is called a VBAC vaginal birth after cesarean.
Interview with Dr Andrew Bisits held at the Australian Home Birth Conference February 2014 and aired live on Bay Fm 99.9 Byron's community station 16th of June 2014.

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2014.
PBBmedia.org]]>2259birth,breech,cesarean,drandrewbisists,vbacfalsefullGary Simpson on Fatherhoodhttps://www.spreaker.com/episode/gary-simpson-on-fatherhood--4668251www.fatherhood.com.au about the impact of our fatherhood blueprint from our experiences of childhood, support for fathers, blessing ceremonies for expectant fathers.

Also features four women speaking about their experiences with their fathers and what they feel a father can bring to their young daughters as they grow into womanhood.

Aired on 99.9 BayFM Byron Bay on 23 June 2014

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2014.
www.pbbmedia.org]]>https://api.spreaker.com/episode/4668251Sat, 28 Jun 2014 07:44:46 +0000PBB Media IncorporatedSally's interview with Gary Simpson, fatherhood educator from the Fatherhood Project: www.fatherhood.com.au about the impact of our fatherhood blueprint from our experiences of childhood, support for fathers, blessing ceremonies for expectant fathers....www.fatherhood.com.au about the impact of our fatherhood blueprint from our experiences of childhood, support for fathers, blessing ceremonies for expectant fathers.

Also features four women speaking about their experiences with their fathers and what they feel a father can bring to their young daughters as they grow into womanhood.

Aired on 99.9 BayFM Byron Bay on 23 June 2014

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2014.
www.pbbmedia.org]]>1671fatherhood,menatbirth,parentingfalsefullDr Sears on early parentinghttps://www.spreaker.com/episode/dr-sears-on-early-parenting--2588452
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2013.
PBBmedia.org]]>https://api.spreaker.com/episode/2588452Sat, 26 Apr 2014 21:51:00 +0000PBB Media IncorporatedThe PBB show was able to catch up with Dr William Sear, guru of attachment parenting, during his visit down under. Here Dr Sears gives us the low down on how it all began, even a tip on keeping a lasting marriage and more. Aired live February 2013....
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2013.
PBBmedia.org]]>1274attachment,attachmentparenting,drsears,williamsearsfalsefullMaking Love Matter with Avalon and Bretthttps://www.spreaker.com/episode/making-love-matter-with-avalon-and-brett--4362105www.lovingfamilies.com.au

Copyright PBB Media and Lara Martin
Date 2014.
PBBmedia.org]]>https://api.spreaker.com/episode/4362105Sun, 20 Apr 2014 02:44:29 +0000PBB Media IncorporatedAired Live 26th of February 2014 from the heart of Byron Bay 99.9 Bay Fm studio's. Parents, bring love and passion back into your family life. How can parents make love matter once two becomes 3 or 4 or more? Take a listen to find out. You can...www.lovingfamilies.com.au

Copyright PBB Media and Lara Martin
Date 2014.
PBBmedia.org]]>1226birth,parenting,relationshipsfalsefullHome Birth with Sue Cookson Midwifehttps://www.spreaker.com/episode/home-birth-with-sue-cookson-midwife--4361286
Presenter and producer Lara Martin
Copyright PBB Media and Lara Martin
Date 2014.
PBBmedia.org]]>https://api.spreaker.com/episode/4361286Sat, 19 Apr 2014 21:52:20 +0000PBB Media IncorporatedAired live 12th - March 2014. Sue Cookson joins us in the studio to talk the changing face of home birth in the Northern Rivers/ Byron Shire NSW Australia. Home Birth has always been a popular choice for women in the NR region - Sue takes us back in...
Presenter and producer Lara Martin
Copyright PBB Media and Lara Martin
Date 2014.
PBBmedia.org]]>1595home-birth,midwiery,midwifefalsefullBruce Lipton on raising happy childrenhttps://www.spreaker.com/episode/bruce-lipton-on-raising-happy-children--4357054
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2014.
PBBmedia.org]]>https://api.spreaker.com/episode/4357054Fri, 18 Apr 2014 22:47:37 +0000PBB Media IncorporatedAired live with love 12 - 2 - 2014, from the heart of Byron Bay at Bay fm 99.9 community radio. On todays show we have an interview with Bruce Lipton, internationally acclaimed Author of best selling book "The Biology of Belief" and the 2009 Goi...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2014.
PBBmedia.org]]>1524birth,bruce-lipton,pregnancyfalsefullMen becoming Fathershttps://www.spreaker.com/episode/men-becoming-fathers--4356691
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2014.
PBBmedia.org]]>https://api.spreaker.com/episode/4356691Fri, 18 Apr 2014 21:07:38 +0000PBB Media IncorporatedBecoming a dad can be a joyful, wonderful experience, it also can be one of the most challenging times in a man's life. Fostering personal growth with being present as a father and as a partner creates stronger families and more fulfilling...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2014.
PBBmedia.org]]>1542birth,dads,pregnancyfalsefullMaha al Musa on finding your primal birthing zone with bellydancehttps://www.spreaker.com/episode/maha-al-musa-on-finding-your-primal-birthing-zone-with-bellydance--4310500Host Sally, assisted by Taneal (Taneal's last show - for now:)

Aired on BayFM on 2 April 2014

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2014
www.pbbmedia.org]]>https://api.spreaker.com/episode/4310500Tue, 08 Apr 2014 22:25:22 +0000PBB Media IncorporatedGuest Maha al Musa, founder of Bellydance for Birth, speaking about using bellydance to access the primal space for birth, her talk "Birth: The Sacred View" at the Baby! International Film Fest on 5 April. Host Sally, assisted by Taneal (Taneal's last...Host Sally, assisted by Taneal (Taneal's last show - for now:)

Aired on BayFM on 2 April 2014

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2014
www.pbbmedia.org]]>1743birth,pregnancyfalsefullKarin Ecker on being a "Breech in the System"https://www.spreaker.com/episode/karin-ecker-on-being-a-breech-in-the-system--4302685
Sally's first show as presenter. First broadcast on 99.9 BayFM Byron Bay Australia on 19 March 2014.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2014]]>https://api.spreaker.com/episode/4302685Mon, 07 Apr 2014 09:14:30 +0000PBB Media IncorporatedKarin Ecker talking about her film A Breech in the System and listening to our inner voices when conventional advice conflicts with what we feel is the right thing to do. Sally's first show as presenter. First broadcast on 99.9 BayFM Byron Bay...
Sally's first show as presenter. First broadcast on 99.9 BayFM Byron Bay Australia on 19 March 2014.

Produced and presented by Sally Cusack.
Copyright PBB Media and Sally Cusack 2014]]>1564birth,breechbirth,pregnancyfalsefullDoula/ birth companionhttps://www.spreaker.com/episode/doula-birth-companion--2447798Aired live 27th of March 2013.

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2013.
PBBmedia.org]]>https://api.spreaker.com/episode/2447798Tue, 01 Apr 2014 00:18:00 +0000PBB Media IncorporatedWhat is a doula and how can she/he serve the expecting couple during birth. Anna Watts founder of Celebration of Birth Doula Training and doula Shanelle join us in the bayfm studio located from Byron Bay Australia, to talk doula. Aired live 27th...Aired live 27th of March 2013.

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2013.
PBBmedia.org]]>1732annawatts,birthdoula,doula,doulatrainingfalsefullThe Challenges of Womanhood with Moana Pearlhttps://www.spreaker.com/episode/the-challenges-of-womanhood-with-moana-pearl--4229752And the meaning of art and its healing power for men and women alike.
And challenges for young women in today's society.

Aired on 99.9 BayFM Byron Bay Australia 5 March 2014
Presenter Taneal Blake
2014
www.pbbmedia.org]]>https://api.spreaker.com/episode/4229752Sun, 23 Mar 2014 08:38:24 +0000PBB Media IncorporatedTaneal's interview with Moana Pearl on her woven art exhibit "Mahmi" with the Women of Essence exhibition in Byron Bay March 2014. And the meaning of art and its healing power for men and women alike. And challenges for young women in today's society....And the meaning of art and its healing power for men and women alike.
And challenges for young women in today's society.

Aired on 99.9 BayFM Byron Bay Australia 5 March 2014
Presenter Taneal Blake
2014
www.pbbmedia.org]]>1104womanhoodfalsefullChoices for Childbirth Sessions in Byron Bayhttps://www.spreaker.com/episode/choices-for-childbirth-sessions-in-byron-bay--4229734Note: These sessions are on hiatus.]]>https://api.spreaker.com/episode/4229734Sun, 23 Mar 2014 08:26:23 +0000PBB Media IncorporatedDescription of new Choices for Childbirth class in Byron - Sally Cusack Note: These sessions are on hiatus.Note: These sessions are on hiatus.]]>100birth,birthchoices,maternityadvocacy,pregnancyfalsefullKid Whisperer on ADD, ADHD, Dyslexia & Learning Difficultieshttps://www.spreaker.com/episode/kid-whisperer-on-add-adhd-dyslexia-learning-difficulties--2307722
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2013.
PBBmedia.org]]>https://api.spreaker.com/episode/2307722Wed, 05 Mar 2014 03:56:00 +0000PBB Media IncorporatedDiana Vogel dubbed the kid whisperer was in the bayfm studio talking with us about her new book "How to Stop the ADD/ADHD Nightmare" Diana has developed a new way to help kids with learning difficulties such as dyslexia and attention-deficit...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2013.
PBBmedia.org]]>1251dyslexia,kidwhisperfalsefullThe Healthy Child by Dr Courntnyhttps://www.spreaker.com/episode/the-healthy-child-by-dr-courntny--2216201
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2013.
PBBmedia.org]]>https://api.spreaker.com/episode/2216201Sat, 15 Feb 2014 19:07:00 +0000PBB Media IncorporatedOur guest Sydney sider Dr. Rosealba Courtney is an Osteopath with over 30 years experience. She is also a specialist in breathing therapy and has done extensive research, writing and teaching on this subject. She trains health professionals and runs...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2013.
PBBmedia.org]]>906parenting,raisinghealthchildrenfalsefullBirth Story: birth in the 50's.https://www.spreaker.com/episode/birth-story-birth-in-the-50-s--2130683
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2013.
PBBmedia.org]]>https://api.spreaker.com/episode/2130683Fri, 31 Jan 2014 22:12:00 +0000PBB Media Incorporated"You'll be fine, cows do it all the time" is what our mother's husband said to her when she was led off to the birthing room and her husband shown to the waiting room. It was the late 1950's. Here our mother shares the birth stories of her 4...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2013.
PBBmedia.org]]>583falsefullBirth story; From self doubt to belief in selfhttps://www.spreaker.com/episode/birth-story-from-self-doubt-to-belief-in-self--2130072
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org]]>https://api.spreaker.com/episode/2130072Fri, 31 Jan 2014 21:40:00 +0000PBB Media IncorporatedOur mother shares her two stories of giving birth. From self-doubt and disbelief in herself to birth to strength and belief in herself. "it felt like a balloon" baby born in the caul. Aired on the Pregnancy Birth and Beyond radio show Bayfm 99.9...
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
PBBmedia.org]]>548birthfalsefullBirth story with Lisa on surrogacyhttps://www.spreaker.com/episode/birth-story-with-lisa-on-surrogacy--2129429
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2013.
PBBmedia.org]]>https://api.spreaker.com/episode/2129429Fri, 31 Jan 2014 21:22:00 +0000PBB Media IncorporatedWould you be able to carry a baby for 9 month, give birth and pass him over to his mother? Here, Lisa shares her story of surrogacy and love. Produced and presented by Lara Martin Copyright PBB Media and Lara Martin Date 2013. PBBmedia.org
Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2013.
PBBmedia.org]]>546australianbirthstory,birthstoryfalsefullPBB Efrat Nappy Freehttps://www.spreaker.com/episode/pbb-efrat-nappy-free--3948942https://api.spreaker.com/episode/3948942Sun, 26 Jan 2014 02:52:28 +0000PBB Media IncorporatedAired live from the Bay Fm studio in the heart of Byron Shire 12th of Nov 2013. Joining us on the show is Efrat Wolfson who will be sharing with us all about Nappy Free also known as emotional elimination communication ECC. Efrat lives in...2282ecc,nappy,nappyfree,parentingfalsefullRobin Grille on Parenting for a Peaceful Worldhttps://www.spreaker.com/episode/robin-grille-on-parenting-for-a-peaceful-world--3947530www.our-emotional-health.com

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2012.
PBBmedia.org]]>https://api.spreaker.com/episode/3947530Sat, 25 Jan 2014 21:26:00 +0000PBB Media IncorporatedAired live from Bay fm 99.9 located in the heart of Byron Bay. The Conscious Parenting Natural Learning Conference 2012 interview with Robin Grille renowned author of Parenting For A Peaceful World and Heart To Heart Parenting. In this show Robin...www.our-emotional-health.com

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2012.
PBBmedia.org]]>1693birth,consciousparenting,parenting,robingrillefalsefullJasper Mills with father Anthony Millshttps://www.spreaker.com/episode/jasper-mills-with-father-anthony-mills--3923822On the show we had Anthony Mills in the studio sharing his story as a father of two, Jasper Mills his two year old son who was born with Cerebral Palsy & microcephaly and also the birth of his angle, Julian who will always be in his parents hearts. https://www.facebook.com/thejaspermillsappeal

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2014.
PBBmedia.org]]>https://api.spreaker.com/episode/3923822Tue, 21 Jan 2014 06:18:42 +0000PBB Media IncorporatedAired live 18th of December 2013 from Bay fm 99.9 community radio in the heart of Byron Bay. On the show we had Anthony Mills in the studio sharing his story as a father of two, Jasper Mills his two year old son who was born with Cerebral Palsy &...On the show we had Anthony Mills in the studio sharing his story as a father of two, Jasper Mills his two year old son who was born with Cerebral Palsy & microcephaly and also the birth of his angle, Julian who will always be in his parents hearts. https://www.facebook.com/thejaspermillsappeal

Produced and presented by Lara Martin
Copyright PBB Media and Lara Martin
Date 2014.
PBBmedia.org]]>1954birth,jaspermillsfalsefullProfessor of Midwifery SCU Kathleen Fahyhttps://www.spreaker.com/episode/professor-of-midwifery-scu-kathleen-fahy--3691063

Produced and presented by Taneal Blake.
Copyright PBB Media and Taneal Blake 2013]]>https://api.spreaker.com/episode/3691063Sun, 01 Dec 2013 02:29:53 +0000PBB Media IncorporatedAired live on 30th of October 2013. Our guest Professor of Midwifery at Southern Cross University on the Gold Coast, Kathleen Fahy was in the Bay fm 99.9 studio talking the future of midwifery and in-particular the implications for midwifery...

Produced and presented by Taneal Blake.
Copyright PBB Media and Taneal Blake 2013]]>2311childbirth,midwiferyfalsefullpeace activist Maha Lakshmihttps://www.spreaker.com/episode/peace-activist-maha-lakshmi--3687262"mothers compassion needs to arise in every human on the planet today, it is not a gender issue"
"changing the world, one birth at a time"]]>https://api.spreaker.com/episode/3687262Sat, 30 Nov 2013 08:33:51 +0000PBB Media IncorporatedAired live 27th of November 2013 from the Byron Bay, AU, 99,9 Bay fm studio. Interview on birth and on the amazing work being done at Robin lim and Bumi Sehat and at the end of the interview a little history of the local Byron Community primary..."mothers compassion needs to arise in every human on the planet today, it is not a gender issue"
"changing the world, one birth at a time"]]>1762falsefullSally and Taneal on Maternity Coalitionhttps://www.spreaker.com/episode/sally-and-taneal-on-maternity-coalition--3686848
Presenter Taneal Blake
Copyright PBB Media and Taneal Blake 2013
www.pbbmedia.org]]>https://api.spreaker.com/episode/3686848Sat, 30 Nov 2013 04:08:59 +0000PBB Media IncorporatedAired live from the 99.9 Bay Fm studio's in the heart of Byron Bay Australia, the most easterly point in Australia. Sally Cusack president of the Northern Rivers Maternity Coalition branch talks with Taneal about the work being done nationally and...
Presenter Taneal Blake
Copyright PBB Media and Taneal Blake 2013
www.pbbmedia.org]]>647birthchoices,maternityadvocacyfalsefullJewelli Deva Flower essence for kidshttps://www.spreaker.com/episode/jewelli-deva-flower-essence-for-kids--3444486www.thefloweringsoul.com]]>https://api.spreaker.com/episode/3444486Fri, 11 Oct 2013 21:40:42 +0000PBB Media IncorporatedOn the Pregnancy Birth & Beyond show aired live from Bayfm 99.9 Byron community radio 9th of October 2013 we have guest Jewelli Deva on flower and Bush essence for birth preparation, children and motherhood. Jewelli also shares with us her insights...www.thefloweringsoul.com]]>2032babies,birth,children,flower essence,pregnancyfalsefullIsraeli doula Sigal Golanhttps://www.spreaker.com/episode/israeli-doula-sigal-golan--3355514

Produced and presented by Taneal Blake.
Copyright PBB Media and Taneal Blake 2013]]>https://api.spreaker.com/episode/3355514Sun, 22 Sep 2013 01:56:18 +0000PBB Media IncorporatedSigal Golan Lactation consultant, doula, birth educator, birth activist from Isreal traveling the world joins us in Byron Bay Australia. Sigal shares with us in an interview on a windy day in the Peace Park Byron Bay Australia, about the birthing...

Produced and presented by Taneal Blake.
Copyright PBB Media and Taneal Blake 2013]]>2334birth,israel,pregnancyfalsefullParental decision makinghttps://www.spreaker.com/episode/parental-decision-making--2965857
Presenter Taneal Blake
Copyright PBB Media and Taneal Blake 2013
www.pbbmedia.org]]>https://api.spreaker.com/episode/2965857Sat, 13 Jul 2013 07:13:24 +0000PBB Media IncorporatedOur guest on today's show is Millie, Byron Shire mum of 5 discussing how as parents we come to make the little and big decisions that parenthood presents us with. If you are a pregnant, a new parent or well into your parenting years, this show is for...
Presenter Taneal Blake
Copyright PBB Media and Taneal Blake 2013
www.pbbmedia.org]]>1462parentingfalsefullBirth into Being with Nicole Moorehttps://www.spreaker.com/episode/birth-into-being-with-nicole-moore--2448333
Presented by Taneal Blake
Copyright PBB Media and Taneal Blake 2013.
www.pbbmedia.org]]>https://api.spreaker.com/episode/2448333Mon, 01 Apr 2013 03:00:05 +0000PBB Media IncorporatedNicole Moore from Birth into Being Australia joins us on the Pregnancy Birth and Beyond show to talk limbic imprinting and how you can recode your birth imprint. Fascinating! Aired live on Bay fm 99.9 during February from the heart of Byron Bay....
Presented by Taneal Blake
Copyright PBB Media and Taneal Blake 2013.
www.pbbmedia.org]]>985birth,limbicimprint,pregnancyfalsefullKarin & Taneal on Breech Birthhttps://www.spreaker.com/episode/karin-taneal-on-breech-birth--1884250https://api.spreaker.com/episode/1884250Mon, 17 Dec 2012 00:08:55 +0000PBB Media Incorporated12th Dec 2012. 'A Breech In The System' Film maker Karin Ecker was in the studio with Taneal talking about Breech Birth and her current birth film project in the works.1996falsefullDomestic Violence and Resources for Womenhttps://www.spreaker.com/episode/domestic-violence-and-resources-for-women--1810069
www.pbbmedia.org

First broadcast live from BayFM Byron Bay on 30 November 2012.]]>https://api.spreaker.com/episode/1810069Fri, 30 Nov 2012 05:06:49 +0000PBB Media IncorporatedJoin Taneal on the Pregnancy BIrth and Beyond Radio show talking with Neroli Jager from Mullumbimby women's resource centre and on Domestic Violence. www.pbbmedia.org First broadcast live from BayFM Byron Bay on 30 November 2012.
www.pbbmedia.org

First broadcast live from BayFM Byron Bay on 30 November 2012.]]>2081falsefullWhat Happens within the Red Tent and morehttps://www.spreaker.com/episode/what-happens-within-the-red-tent-and-more--1789600www.redtentfestival.com

www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay in February 2012]]>https://api.spreaker.com/episode/1789600Sun, 25 Nov 2012 06:12:25 +0000PBB Media IncorporatedJoin Taneal on the Pregnancy Birth & Beyond show as she shares the message of the Red Tent Festival. www.redtentfestival.com www.pbbmedia.org First aired on 99.9 BayFM Byron Bay in February 2012www.redtentfestival.com

www.pbbmedia.org

First aired on 99.9 BayFM Byron Bay in February 2012]]>1433falsefull